BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780963|ref|YP_003065376.1| hypothetical protein CLIBASIA_04320 [Candidatus Liberibacter asiaticus str. psy62] (215 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780963|ref|YP_003065376.1| hypothetical protein CLIBASIA_04320 [Candidatus Liberibacter asiaticus str. psy62] Length = 215 Score = 443 bits (1140), Expect = e-127, Method: Compositional matrix adjust. Identities = 215/215 (100%), Positives = 215/215 (100%) Query: 1 MVRVFCAIIFVLITFIGEFSQALEHEDELKVNFGLMRRVMIDLWSREISSYRTPLSLDLD 60 MVRVFCAIIFVLITFIGEFSQALEHEDELKVNFGLMRRVMIDLWSREISSYRTPLSLDLD Sbjct: 1 MVRVFCAIIFVLITFIGEFSQALEHEDELKVNFGLMRRVMIDLWSREISSYRTPLSLDLD 60 Query: 61 YKHRVYLDTYKSFSINLGFETFNEIVNPTTMRVLVLPVLSMHKTWNNNFDDSYFFKKIGV 120 YKHRVYLDTYKSFSINLGFETFNEIVNPTTMRVLVLPVLSMHKTWNNNFDDSYFFKKIGV Sbjct: 61 YKHRVYLDTYKSFSINLGFETFNEIVNPTTMRVLVLPVLSMHKTWNNNFDDSYFFKKIGV 120 Query: 121 GVVASTGFNTGDKWLGAEMGMSFYVYPTPWLILQSDFAIRHASSDVVVCMRYQAKFLITD 180 GVVASTGFNTGDKWLGAEMGMSFYVYPTPWLILQSDFAIRHASSDVVVCMRYQAKFLITD Sbjct: 121 GVVASTGFNTGDKWLGAEMGMSFYVYPTPWLILQSDFAIRHASSDVVVCMRYQAKFLITD 180 Query: 181 SIGILYRNVSAVSAAVDKNIGLGVTKIGLDYVYKF 215 SIGILYRNVSAVSAAVDKNIGLGVTKIGLDYVYKF Sbjct: 181 SIGILYRNVSAVSAAVDKNIGLGVTKIGLDYVYKF 215 >gi|254781154|ref|YP_003065567.1| hypothetical protein CLIBASIA_05305 [Candidatus Liberibacter asiaticus str. psy62] Length = 65 Score = 36.6 bits (83), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 12/72 (16%) Query: 148 TPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSAAVDKNI----GLG 203 T WL LQ DF + R Q + LITD N+SA+ ++ DKNI G Sbjct: 2 TSWLKLQRDFGVVLIGDKAFNTYRSQLRILITD-------NLSALISS-DKNITESGKEG 53 Query: 204 VTKIGLDYVYKF 215 + K+ L YVY F Sbjct: 54 IVKMDLSYVYTF 65 >gi|254780782|ref|YP_003065195.1| succinyl-diaminopimelate desuccinylase [Candidatus Liberibacter asiaticus str. psy62] Length = 389 Score = 23.1 bits (48), Expect = 3.6, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 76 NLGFETFNEIVNPTTMRVLVLPV 98 N+GF+T N +PT M + + V Sbjct: 221 NIGFDTGNTTFSPTNMEITTIDV 243 >gi|254780786|ref|YP_003065199.1| ribosome-binding factor A [Candidatus Liberibacter asiaticus str. psy62] Length = 128 Score = 22.3 bits (46), Expect = 6.5, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 4/25 (16%) Query: 150 WLILQSDFAIRHASSDVV----VCM 170 W+IL ++F R S DV+ VCM Sbjct: 25 WVILNNEFQDRLISRDVISISEVCM 49 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.141 0.428 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 144,476 Number of Sequences: 1233 Number of extensions: 6045 Number of successful extensions: 23 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 18 Number of HSP's gapped (non-prelim): 7 length of query: 215 length of database: 328,796 effective HSP length: 70 effective length of query: 145 effective length of database: 242,486 effective search space: 35160470 effective search space used: 35160470 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 36 (18.5 bits)