RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780965|ref|YP_003065378.1| hypothetical protein CLIBASIA_04330 [Candidatus Liberibacter asiaticus str. psy62] (229 letters) >gnl|CDD|30435 COG0086, RpoC, DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Transcription]. Length = 808 Score = 30.2 bits (68), Expect = 0.53 Identities = 13/52 (25%), Positives = 17/52 (32%), Gaps = 4/52 (7%) Query: 155 NPGVFPYSAGHFVKSSHKDGLIELIFSYPLRSCHGCEDIGFMDIAYKFTTKG 206 V A +SS +GL E + G G +D A K G Sbjct: 703 EVTVKHLEAEGPGESSFLEGLTENEYFG---HPIGGRT-GLVDTALKTADSG 750 >gnl|CDD|147383 pfam05170, AsmA, AsmA family. The AsmA gene, whose product is involved in the assembly of outer membrane proteins in Escherichia coli. AsmA mutations were isolated as extragenic suppressors of an OmpF assembly mutant. AsmA may have a role in LPS biogenesis. Length = 537 Score = 27.8 bits (62), Expect = 2.5 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Query: 1 MKY--KIAIIILLVLVGVILAFYF 22 MK KI +IIL+VL+ +I+A Sbjct: 1 MKKALKILLIILIVLLLLIIALIA 24 >gnl|CDD|35669 KOG0448, KOG0448, KOG0448, Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones]. Length = 749 Score = 26.5 bits (58), Expect = 5.8 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Query: 53 RAHEFD--ENFDNCIITSIKKTGGTQEALRAAQYLEK 87 R EF E F+ CI S KT Q RA QYL K Sbjct: 335 RFIEFQDFEKFEECISQSALKTKFEQHLHRAKQYLSK 371 >gnl|CDD|146406 pfam03748, FliL, Flagellar basal body-associated protein FliL. This FliL protein controls the rotational direction of the flagella during chemotaxis. FliL is a cytoplasmic membrane protein associated with the basal body. Length = 145 Score = 26.0 bits (58), Expect = 9.3 Identities = 9/30 (30%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Query: 1 MKYKIAIIILLVLVGVIL--AFYFQQSSTP 28 K I +I+ L+L+ FYF P Sbjct: 1 KKKLILLILGLLLLAAGGGGGFYFLLKGGP 30 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.140 0.423 Gapped Lambda K H 0.267 0.0672 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,891,596 Number of extensions: 150615 Number of successful extensions: 415 Number of sequences better than 10.0: 1 Number of HSP's gapped: 414 Number of HSP's successfully gapped: 9 Length of query: 229 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 138 Effective length of database: 4,297,318 Effective search space: 593029884 Effective search space used: 593029884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 56 (25.5 bits)