BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780965|ref|YP_003065378.1| hypothetical protein
CLIBASIA_04330 [Candidatus Liberibacter asiaticus str. psy62]
         (229 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780965|ref|YP_003065378.1| hypothetical protein CLIBASIA_04330 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 229

 Score =  475 bits (1222), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 229/229 (100%), Positives = 229/229 (100%)

Query: 1   MKYKIAIIILLVLVGVILAFYFQQSSTPQNHLLFFSEKAVWKGDSETYFQCKRAHEFDEN 60
           MKYKIAIIILLVLVGVILAFYFQQSSTPQNHLLFFSEKAVWKGDSETYFQCKRAHEFDEN
Sbjct: 1   MKYKIAIIILLVLVGVILAFYFQQSSTPQNHLLFFSEKAVWKGDSETYFQCKRAHEFDEN 60

Query: 61  FDNCIITSIKKTGGTQEALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGT 120
           FDNCIITSIKKTGGTQEALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGT
Sbjct: 61  FDNCIITSIKKTGGTQEALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGT 120

Query: 121 LLIPTVGSHIIDINDSSVHQLYDSSPIAKDFVLRNPGVFPYSAGHFVKSSHKDGLIELIF 180
           LLIPTVGSHIIDINDSSVHQLYDSSPIAKDFVLRNPGVFPYSAGHFVKSSHKDGLIELIF
Sbjct: 121 LLIPTVGSHIIDINDSSVHQLYDSSPIAKDFVLRNPGVFPYSAGHFVKSSHKDGLIELIF 180

Query: 181 SYPLRSCHGCEDIGFMDIAYKFTTKGAFIGRKVFGIRNDNAKYPMHFFI 229
           SYPLRSCHGCEDIGFMDIAYKFTTKGAFIGRKVFGIRNDNAKYPMHFFI
Sbjct: 181 SYPLRSCHGCEDIGFMDIAYKFTTKGAFIGRKVFGIRNDNAKYPMHFFI 229


>gi|254780870|ref|YP_003065283.1| prolyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 449

 Score = 23.9 bits (50), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 21/44 (47%)

Query: 59  ENFDNCIITSIKKTGGTQEALRAAQYLEKYLEPGYVSSYRKEAL 102
           +N +  I     +TG  + ++   Q  + ++E G   SY KE L
Sbjct: 51  DNVNAIIREEQNRTGAIEMSVPTLQSADLWVESGRYDSYGKEML 94


>gi|254780826|ref|YP_003065239.1| phosphoenolpyruvate carboxykinase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 509

 Score = 23.1 bits (48), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 31/76 (40%), Gaps = 8/76 (10%)

Query: 64  CIITSIKKTGGTQEALRAAQYLEKYLEPGYVSSYRKEALIGIVEVQYPYRANENSG---T 120
           C+   +  TG T     A  Y E Y  P  V+    +A+        PYR +EN G    
Sbjct: 410 CVDCWLVNTGWT-----AGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVP 464

Query: 121 LLIPTVGSHIIDINDS 136
           L +  V   +++  DS
Sbjct: 465 LEVKGVDRKLLNPRDS 480


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.324    0.140    0.423 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 156,993
Number of Sequences: 1233
Number of extensions: 6501
Number of successful extensions: 14
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 11
Number of HSP's gapped (non-prelim): 4
length of query: 229
length of database: 328,796
effective HSP length: 71
effective length of query: 158
effective length of database: 241,253
effective search space: 38117974
effective search space used: 38117974
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 37 (18.9 bits)