RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780966|ref|YP_003065379.1| hypothetical protein
CLIBASIA_04335 [Candidatus Liberibacter asiaticus str. psy62]
         (53 letters)



>gnl|CDD|145125 pfam01797, Transposase_17, Transposase IS200 like.  Transposases
          are needed for efficient transposition of the insertion
          sequence or transposon DNA. This family includes
          transposases for IS200 from E. coli.
          Length = 121

 Score = 25.6 bits (57), Expect = 3.1
 Identities = 7/14 (50%), Positives = 11/14 (78%)

Query: 8  SRTMHYLKGKSSRK 21
          S+ +  LKG+SSR+
Sbjct: 65 SKLVQRLKGRSSRR 78


>gnl|CDD|144046 pfam00308, Bac_DnaA, Bacterial dnaA protein. 
          Length = 219

 Score = 24.2 bits (53), Expect = 8.0
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 2/31 (6%)

Query: 11  MHYLKGKSSRKECFLAIFNPLIECLDFKEIV 41
           + +L GK   +E F   FN L E  + K+IV
Sbjct: 106 IQFLAGKEKTQEEFFHTFNALHE--NNKQIV 134


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.328    0.143    0.431 

Gapped
Lambda     K      H
   0.267   0.0677    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 652,927
Number of extensions: 22702
Number of successful extensions: 66
Number of sequences better than 10.0: 1
Number of HSP's gapped: 66
Number of HSP's successfully gapped: 5
Length of query: 53
Length of database: 6,263,737
Length adjustment: 26
Effective length of query: 27
Effective length of database: 5,701,903
Effective search space: 153951381
Effective search space used: 153951381
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (23.5 bits)