>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif. CDSP32 is a stress-inducible TRX, i.e., it acts as a TRX by reducing protein disulfides and is induced by environmental and oxidative stress conditions. It plays a critical role in plastid defense against oxidative damage, a role related to its function as a physiological electron donor to BAS1, a plastidic 2-cys peroxiredoxin. Plants lacking CDSP32 exhibit decreased photosystem II photochemical efficiencies and chlorophyll retention compared to WT controls, as well as an increased proportion of BAS1 in its overoxidized monomeric form.

Probab=95.33 E-value=0.12 Score=31.13 Aligned_cols=72 Identities=18% Similarity=0.259 Sum_probs=45.5 Q ss_pred HHHHHHHH--CCEEEEECCCCCCCCCCHHHHHHHHHHHC-----CCCEEEEECCCCHHHHHHHHHHHCCCCCCE--EEEC Q ss_conf 99999644--89799944899989983179999999974-----996589971144037999999734787763--8989 Q gi|254780968|r 8 IIQNEIKK--NDVVLFMKGTPTSPRCGFSGKVVQVLDSL-----GVSYKGIDVLADDALRQSIKEYSNWPTIPQ--LYVK 78 (106) Q Consensus 8 ~i~~~i~~--~~Vvifskgt~~~p~C~~c~~ak~lL~~~-----~i~y~~~dv~~d~~~~~~l~~~sg~~TvPq--IFv~ 78 (106) T Consensus 5 ef~~~l~~a~~kLVVvdF---~A~WCgPCk~i~P~~e~La~~~~~v~F~kV~~De~~~~~ela~~-~~I~s~PTF~f~k~ 80 (103) T cd02985 5 ELDEALKKAKGRLVVLEF---ALKHSGPSVKIYPTMVKLSRTCNDVVFLLVNGDENDSTMELCRR-EKIIEVPHFLFYKD 80 (103) T ss_pred HHHHHHHHCCCCEEEEEE---ECCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHH-CCCCCCCEEEEEEC T ss_conf 999999977998899999---89989777763089999997779978999977676557999997-79806337999999 Q ss_pred CEEEC Q ss_conf 98942 Q gi|254780968|r 79 GDFIG 83 (106) Q Consensus 79 G~~IG 83 (106) T Consensus 81 G~~v~ 85 (103) T cd02985 81 GEKIH 85 (103) T ss_pred CEEEE T ss_conf 98999

HHsearch alignment for GI: 254780968 and conserved domain: cd02985