RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780968|ref|YP_003065381.1| hypothetical protein CLIBASIA_04345 [Candidatus Liberibacter asiaticus str. psy62] (106 letters) >gnl|CDD|30626 COG0278, COG0278, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]. Length = 105 Score = 155 bits (393), Expect = 3e-39 Identities = 58/102 (56%), Positives = 74/102 (72%), Gaps = 1/102 (0%) Query: 2 NSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLG-VSYKGIDVLADDALR 60 + IQ +IK+N VVLFMKGTP P+CGFS + VQ+L + G V + +DVL D +R Sbjct: 1 MMEILDRIQKQIKENPVVLFMKGTPEFPQCGFSAQAVQILSACGVVDFAYVDVLQDPEIR 60 Query: 61 QSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILS 102 Q +KEYSNWPT PQLYV G+F+GGCDIV EM++SGEL +L Sbjct: 61 QGLKEYSNWPTFPQLYVNGEFVGGCDIVREMYQSGELQTLLK 102 >gnl|CDD|48577 cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins. The non-PICOT members of this family contain only the GRX-like domain, whereas PICOT contains an N-terminal TRX-like domain followed by one to three GRX-like domains. It is interesting to note that PICOT from plants contain three repeats of the GRX-like domain, metazoan proteins (except for insect) have two repeats, while fungal sequences contain only one copy of the domain. PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli. Both GRX and TRX domains of PICOT are required for its activity. Characterized non-PICOT members of this family include CXIP1, a CAX-interacting protein in Arabidopsis thaliana, and PfGLP-1, a GRX-like protein from Plasmodium falciparum.. Length = 90 Score = 153 bits (389), Expect = 8e-39 Identities = 59/89 (66%), Positives = 70/89 (78%) Query: 9 IQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSN 68 I+ IK+N VVLFMKGTP PRCGFS KVVQ+L+ LGV + D+L D+ +RQ +KEYSN Sbjct: 1 IKKLIKENPVVLFMKGTPEEPRCGFSRKVVQILNQLGVDFGTFDILEDEEVRQGLKEYSN 60 Query: 69 WPTIPQLYVKGDFIGGCDIVCEMFESGEL 97 WPT PQLYV G+ +GGCDIV EM ESGEL Sbjct: 61 WPTFPQLYVNGELVGGCDIVKEMHESGEL 89 >gnl|CDD|36129 KOG0911, KOG0911, KOG0911, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]. Length = 227 Score = 135 bits (340), Expect = 3e-33 Identities = 52/98 (53%), Positives = 70/98 (71%) Query: 4 SVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSI 63 +++ ++ +K V+LFMKGTP P+CGFS ++V +L S V+Y DVL D+ LRQ + Sbjct: 127 DLDNRLEKLVKAKPVMLFMKGTPEEPKCGFSRQLVGILQSHNVNYTIFDVLTDEELRQGL 186 Query: 64 KEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEIL 101 KE+S+WPT PQLYVKG+FIGG DI+ EM E GEL L Sbjct: 187 KEFSDWPTFPQLYVKGEFIGGLDILKEMHEKGELVYTL 224 >gnl|CDD|48495 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH -> GSH reductase -> GSH -> GRX -> protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known including human GRX1 and GRX2, as well as E. coli GRX1 and GRX3, which are members of this family. E. coli GRX2, however, is a 24-kDa protein that belongs to the GSH S-transferase (GST) family.. Length = 72 Score = 88.3 bits (219), Expect = 4e-19 Identities = 31/76 (40%), Positives = 50/76 (65%), Gaps = 5/76 (6%) Query: 18 VVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYV 77 VV+F K T C + + ++L+SLG+ ++ ID+L D LR+ +KE S WPT+PQ+++ Sbjct: 2 VVVFSKST-----CPYCKRAKRLLESLGIEFEEIDILEDGELREELKELSGWPTVPQIFI 56 Query: 78 KGDFIGGCDIVCEMFE 93 G+FIGG D + + E Sbjct: 57 NGEFIGGYDDLKALHE 72 >gnl|CDD|144161 pfam00462, Glutaredoxin, Glutaredoxin. Length = 60 Score = 82.1 bits (204), Expect = 3e-17 Identities = 27/65 (41%), Positives = 40/65 (61%), Gaps = 5/65 (7%) Query: 18 VVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYV 77 VVLF K P C F + ++L SLGV ++ IDV D +R+ +KE S W T+PQ+++ Sbjct: 1 VVLFTK-----PTCPFCKRAKRLLKSLGVKFEEIDVDEDPEIREELKELSGWRTVPQVFI 55 Query: 78 KGDFI 82 G+ I Sbjct: 56 DGEHI 60 >gnl|CDD|48634 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH -> GSH reductase -> GSH -> GRX -> protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known including human GRX1 and GRX2, which are members of this subfamily. Also included in this subfamily are the N-terminal GRX domains of proteins similar to human thioredoxin reductase 1 and 3.. Length = 82 Score = 53.2 bits (128), Expect = 2e-08 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 8/86 (9%) Query: 18 VVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYK--GIDVLAD-DALRQSIKEYSNWPTIPQ 74 VV+F K C + + +L LGV +D D ++ ++E + T+P Sbjct: 2 VVVFSKSY-----CPYCKRAKSLLKELGVKPAVVELDQHEDGSEIQDYLQELTGQRTVPN 56 Query: 75 LYVKGDFIGGCDIVCEMFESGELHEI 100 +++ G FIGGCD + + +SG+L ++ Sbjct: 57 VFIGGKFIGGCDDLMALHKSGKLVKL 82 >gnl|CDD|36963 KOG1752, KOG1752, KOG1752, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]. Length = 104 Score = 51.8 bits (124), Expect = 4e-08 Identities = 26/96 (27%), Positives = 54/96 (56%), Gaps = 8/96 (8%) Query: 9 IQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLAD---DALRQSIKE 65 ++ I +N VV+F K + C + + ++L LGV+ K +++ D +++++K+ Sbjct: 7 VRKMISENPVVIFSKSS-----CPYCHRAKELLSDLGVNPKVVELDEDEDGSEIQKALKK 61 Query: 66 YSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEIL 101 + T+P +++ G FIGG + + +SGEL +L Sbjct: 62 LTGQRTVPNVFIGGKFIGGASDLMALHKSGELVPLL 97 >gnl|CDD|48633 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH -> GSH reductase -> GSH -> GRX -> protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known including E. coli GRX1 and GRX3, which are members of this subfamily.. Length = 75 Score = 50.6 bits (121), Expect = 9e-08 Identities = 24/61 (39%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Query: 27 TSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSN-WPTIPQLYVKGDFIGGC 85 T P C + + +LD GV Y+ IDV D ALR+ + S T+PQ+++ IGGC Sbjct: 6 TKPNCPYCVRAKALLDKKGVDYEEIDVDGDPALREEMINRSGGRRTVPQIFIGDVHIGGC 65 Query: 86 D 86 D Sbjct: 66 D 66 >gnl|CDD|48580 cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs. This subfamily is predominantly composed of plant proteins. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins via a redox active CXXC motif using a similar dithiol mechanism employed by TRXs. GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. Proteins containing only the C-terminal cysteine are generally redox inactive.. Length = 147 Score = 50.2 bits (120), Expect = 1e-07 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 4/69 (5%) Query: 37 VVQVLDSLGVSYKGIDVLAD----DALRQSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMF 92 V +L+S V + DV D + LR+ + ++P+++V G ++GG + V + Sbjct: 22 VRAILESFRVKFDERDVSMDSGFREELRELLGAELKAVSLPRVFVDGRYLGGAEEVLRLN 81 Query: 93 ESGELHEIL 101 ESGEL ++L Sbjct: 82 ESGELRKLL 90 >gnl|CDD|38035 KOG2824, KOG2824, KOG2824, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]. Length = 281 Score = 45.4 bits (107), Expect = 3e-06 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 4/70 (5%) Query: 37 VVQVLDSLGVSYKGIDVLADDALRQSIKE----YSNWPTIPQLYVKGDFIGGCDIVCEMF 92 V +L+S V DV D R+ ++E ++P+++VKG +IGG + V + Sbjct: 153 VRAILESFRVKVDERDVSMDSEFREELQELLGEDEKAVSLPRVFVKGRYIGGAEEVVRLN 212 Query: 93 ESGELHEILS 102 E G+L ++L Sbjct: 213 EEGKLGKLLK 222 >gnl|CDD|31039 COG0695, GrxC, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]. Length = 80 Score = 43.8 bits (103), Expect = 1e-05 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 2/73 (2%) Query: 27 TSPRCGFSGKVVQVLDSLGVSYKGIDVLADD--ALRQSIKEYSNWPTIPQLYVKGDFIGG 84 T P C + + ++LD GV Y+ IDV D+ R+ +K T+PQ+++ G +GG Sbjct: 7 TKPGCPYCKRAKRLLDRKGVDYEEIDVDDDEPEEAREMVKRGKGQRTVPQIFIGGKHVGG 66 Query: 85 CDIVCEMFESGEL 97 CD + + G+L Sbjct: 67 CDDLDALEAKGKL 79 >gnl|CDD|48578 cd03029, GRX_hybridPRX5, Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria. PRXs are thiol-specific antioxidant (TSA) proteins that confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins. PRX-GRX hybrid proteins from Haemophilus influenza and Neisseria meningitis exhibit GSH-dependent peroxidase activity. The flow of reducing equivalents in the catalytic cycle of the hybrid protein goes from NADPH -> GSH reductase -> GSH -> GRX domain of hybrid -> PRX domain of hybrid -> peroxide substrate.. Length = 72 Score = 41.9 bits (98), Expect = 4e-05 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 6/75 (8%) Query: 18 VVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYV 77 V LF T P C F + L G+SY+ I L D +S++ + T+PQ+++ Sbjct: 3 VSLF-----TKPGCPFCARAKAALQENGISYEEI-PLGKDITGRSLRAVTGAMTVPQVFI 56 Query: 78 KGDFIGGCDIVCEMF 92 G+ IGG D + + F Sbjct: 57 DGELIGGSDDLEKYF 71 >gnl|CDD|48525 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile. In vitro, it displays protein disulfide reductase activity that is dependent on TRX reductase, not glutathione (GSH). It is part of the NrdHIEF operon, where NrdEF codes for class Ib ribonucleotide reductase (RNR-Ib), an efficient enzyme at low oxygen levels. Under these conditions when GSH is mostly conjugated to spermidine, NrdH can still function and act as a hydrogen donor for RNR-Ib. It has been suggested that the NrdHEF system may be the oldest RNR reducing system, capable of functioning in a microaerophilic environment, where GSH was not yet available. NrdH from Corynebacterium ammoniagenes can form domain-swapped dimers, although it is unknown if this happens in vivo. Domain-swapped dimerization, which results in the blocking of the TRX reductase binding site, could be a mechanism for regulating the oxidation state of the protein.. Length = 73 Score = 37.1 bits (86), Expect = 0.001 Identities = 15/75 (20%), Positives = 34/75 (45%), Gaps = 7/75 (9%) Query: 27 TSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYVKGDFIGGCD 86 T P C + + LD G+ ++ +DV D + +K+ + + ++P + + + + G Sbjct: 6 TKPDCPYCKATKRFLDERGIPFEEVDVDEDPEALEELKKLNGYRSVPVVVIGDEHLSG-- 63 Query: 87 IVCEMFESGELHEIL 101 F +L +L Sbjct: 64 -----FRPDKLRALL 73 >gnl|CDD|38239 KOG3029, KOG3029, KOG3029, Glutathione S-transferase-related protein [General function prediction only]. Length = 370 Score = 34.3 bits (78), Expect = 0.008 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 8/64 (12%) Query: 17 DVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLY 76 D+VL+ T C F KV LD G+SY ++V + LRQ IK +S++ +P L Sbjct: 90 DLVLYQYET-----CPFCCKVRAFLDYHGISYAVVEV--NPVLRQEIK-WSSYKKVPILL 141 Query: 77 VKGD 80 ++G+ Sbjct: 142 IRGE 145 >gnl|CDD|147198 pfam04908, SH3BGR, SH3-binding, glutamic acid-rich protein. Length = 92 Score = 32.1 bits (73), Expect = 0.031 Identities = 17/68 (25%), Positives = 35/68 (51%), Gaps = 2/68 (2%) Query: 36 KVVQVLDSLGVSYKGIDVLADDALRQSIKEYSN--WPTIPQLYVKGDFIGGCDIVCEMFE 93 +V+ +LD+ + + +D+ D+ R+ ++E P PQ++ + + G D E E Sbjct: 22 RVLMILDANKIPFDEVDITKDEEQRRWMRENPPNGAPLPPQIFNEDQYCGDYDAFFEAVE 81 Query: 94 SGELHEIL 101 + L+E L Sbjct: 82 ANTLYEFL 89 >gnl|CDD|48579 cd03030, GRX_SH3BGR, Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif. The SH3BGR gene was cloned in an effort to identify genes mapping to chromosome 21, which could be involved in the pathogenesis of congenital heart disease affecting Down syndrome newborns. Several human SH3BGR-like (SH3BGRL) genes have been identified since, mapping to different locations in the chromosome. Of these, SH3BGRL3 was identified as a tumor necrosis factor (TNF) alpha inhibitory protein and was also named TIP-B1. Upregulation of expression of SH3BGRL3 is associated with differentiation. It has been suggested that it functions as a regulator of differentiation-related signal transduction pathways.. Length = 92 Score = 30.6 bits (69), Expect = 0.11 Identities = 14/69 (20%), Positives = 32/69 (46%), Gaps = 4/69 (5%) Query: 37 VVQVLDSLGVSYKGIDVLADDALRQS----IKEYSNWPTIPQLYVKGDFIGGCDIVCEMF 92 V+ L++ + ++ +D+ ++ RQ + + P PQ++ ++ G + E Sbjct: 22 VLGFLEAKKIEFEEVDISMNEENRQWMRENVPNENGKPLPPQIFNGDEYCGDYEAFFEAK 81 Query: 93 ESGELHEIL 101 E+ L E L Sbjct: 82 ENNTLEEFL 90 >gnl|CDD|48589 cd03040, GST_N_mPGES2, GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2. Unlike cytosolic PGE synthase (cPGES) and microsomal PGES Type 1 (mPGES1), mPGES2 does not require glutathione (GSH) for its activity, although its catalytic rate is increased two- to four-fold in the presence of DTT, GSH or other thiol compounds. PGE2 is widely distributed in various tissues and is implicated in the sleep/wake cycle, relaxation/contraction of smooth muscle, excretion of sodium ions, maintenance of body temperature and mediation of inflammation. mPGES2 contains an N-terminal hydrophobic domain which is membrane associated, and a C-terminal soluble domain with a GST-like structure.. Length = 77 Score = 28.3 bits (63), Expect = 0.47 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Query: 31 CGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYVKGD 80 C F KV LD G+ Y+ ++V + R+ IK +S++ +P L V+ Sbjct: 10 CPFCCKVRAFLDYHGIPYEVVEV--NPVSRKEIK-WSSYKKVPILRVESG 56 >gnl|CDD|73373 cd02811, IDI-2_FMN, Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain. Two types of IDIs have been characterized at present. The long known IDI-1 is only dependent on divalent metals for activity, whereas IDI-2 requires a metal, FMN and NADPH. IDI-2 catalyzes the interconversion of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP) in the mevalonate pathway.. Length = 326 Score = 25.8 bits (57), Expect = 2.5 Identities = 8/23 (34%), Positives = 10/23 (43%), Gaps = 2/23 (8%) Query: 31 CGFSGKVVQVLDSLGVSYKGIDV 53 G S + + L GV IDV Sbjct: 188 FGISRETAKRLADAGVKA--IDV 208 >gnl|CDD|37640 KOG2429, KOG2429, KOG2429, Glycosyl hydrolase, family 47 [Carbohydrate transport and metabolism]. Length = 622 Score = 25.6 bits (56), Expect = 2.7 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 7/51 (13%) Query: 33 FSGKV-VQVLDSLGVSYKGIDVLA---DDALRQSIKEYSNWPT---IPQLY 76 SG V + DSL + G+ VLA DDA+R + +S W +P+ Y Sbjct: 306 DSGSVSLPWFDSLQAFWPGLQVLAGDVDDAIRTHLMYFSVWKKYGFLPERY 356 >gnl|CDD|146701 pfam04199, Cyclase, Putative cyclase. Proteins in this family are thought to be cyclase enzymes. They are found in proteins involved in antibiotic synthesis. However they are also found in organisms that do not make antibiotics pointing to a wider role for these proteins. The proteins contain a conserved motif HXGTHXDXPXH that is likely to form part of the active site. Length = 162 Score = 25.8 bits (57), Expect = 2.8 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 8/58 (13%) Query: 10 QNEIKKNDVVLF------MKGTPTSPR--CGFSGKVVQVLDSLGVSYKGIDVLADDAL 59 IK D+VL GTP R G S + Q L GV GID + D Sbjct: 104 GGTIKPGDIVLIRTGWDKRWGTPEYYRNHPGLSLEAAQWLVERGVKAVGIDTPSLDRP 161 >gnl|CDD|146541 pfam03960, ArsC, ArsC family. This family is related to glutaredoxins pfam00462. Length = 111 Score = 25.6 bits (57), Expect = 2.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Query: 27 TSPRCGFSGKVVQVLDSLGVSYKGIDVLAD 56 SP C K + L+ G+ Y+ ID L Sbjct: 2 GSPNCDTCRKALAWLEEHGIEYQEIDYLET 31 >gnl|CDD|48585 cd03036, ArsC_like, Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine.. Length = 111 Score = 25.6 bits (56), Expect = 3.2 Identities = 11/40 (27%), Positives = 21/40 (52%) Query: 29 PRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSN 68 P+C K + LD GV Y ID++ + ++ +K++ Sbjct: 7 PKCSTCRKAKKWLDEHGVDYTAIDIVEEPPSKEELKKWLE 46 >gnl|CDD|35411 KOG0190, KOG0190, KOG0190, Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones]. Length = 493 Score = 24.5 bits (53), Expect = 5.9 Identities = 17/78 (21%), Positives = 31/78 (39%), Gaps = 17/78 (21%) Query: 3 SSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKG--------IDVL 54 + + I+ +E K+ +V F +P CG + + + L YK +D Sbjct: 374 KNFDDIVLDE-GKDVLVEFY-----APWCGHCKALAPIYEELAEKYKDDENVVIAKMDAT 427 Query: 55 ADDALRQSIKEYSNWPTI 72 A+D + + PTI Sbjct: 428 ANDVPSLKVDGF---PTI 442 >gnl|CDD|48576 cd03027, GRX_DEP, Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions. GRX is a glutathione (GSH) dependent reductase containing a redox active CXXC motif in a TRX fold. It has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. By altering the redox state of target proteins, GRX is involved in many cellular functions.. Length = 73 Score = 24.4 bits (53), Expect = 6.7 Identities = 11/58 (18%), Positives = 23/58 (39%) Query: 27 TSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYVKGDFIGG 84 + C V L G+ Y I++ + ++E + +PQ++ +GG Sbjct: 7 SRLGCEDCTAVRLFLREKGLPYVEINIDIFPERKAELEERTGSSVVPQIFFNEKLVGG 64 >gnl|CDD|119416 cd00142, PI3Kc_like, Phosphoinositide 3-kinase (PI3K)-like family, catalytic domain; The PI3K-like catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members of the family include PI3K, phosphoinositide 4-kinase (PI4K), PI3K-related protein kinases (PIKKs), and TRansformation/tRanscription domain-Associated Protein (TRRAP). PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives, while PI4K catalyze the phosphorylation of the 4-hydroxyl of PtdIns. PIKKs are protein kinases that catalyze the phosphorylation of serine/threonine residues, especially those that are followed by a glutamine. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. PI4Ks produce PtdIns(4)P, the major precursor to important signaling phosphoinositides. PIKKs have diverse functions including cell-cycle checkpoints, genome surveillance, mRNA surveillance, and translation control.. Length = 219 Score = 24.5 bits (54), Expect = 6.9 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 12/63 (19%) Query: 5 VNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIK 64 +N I++ E+ + + P SPR G +++V+ G L DD L + +K Sbjct: 53 MNKILKKELGLDLFLTTYSVIPLSPRSG----LIEVV-------PGSVTLEDD-LSKWLK 100 Query: 65 EYS 67 S Sbjct: 101 RKS 103 >gnl|CDD|37903 KOG2692, KOG2692, KOG2692, Sialyltransferase [Carbohydrate transport and metabolism]. Length = 376 Score = 24.3 bits (52), Expect = 7.3 Identities = 12/39 (30%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Query: 1 MNSSV--NSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKV 37 NS + NS + EI +D V+ + PT G+ V Sbjct: 161 GNSGILLNSRLGREIDSHDFVIRLNLAPTK---GYEKDV 196 >gnl|CDD|30884 COG0538, Icd, Isocitrate dehydrogenases [Energy production and conversion]. Length = 407 Score = 24.0 bits (52), Expect = 8.3 Identities = 11/41 (26%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Query: 52 DVLADDALRQSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMF 92 D +ADD L+Q + + I + GD+I D + Sbjct: 268 DRIADDMLQQILLRPGEYDVIATKNLNGDYIS--DALAAQV 306 >gnl|CDD|34224 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 325 Score = 24.1 bits (52), Expect = 8.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 50 GIDVLADDALRQSIKEY 66 G+DV A +R+ +KEY Sbjct: 186 GLDVNAQANIREFLKEY 202 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.138 0.407 Gapped Lambda K H 0.267 0.0654 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,263,686 Number of extensions: 58789 Number of successful extensions: 168 Number of sequences better than 10.0: 1 Number of HSP's gapped: 164 Number of HSP's successfully gapped: 37 Length of query: 106 Length of database: 6,263,737 Length adjustment: 73 Effective length of query: 33 Effective length of database: 4,686,280 Effective search space: 154647240 Effective search space used: 154647240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.6 bits)