BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780968|ref|YP_003065381.1| hypothetical protein CLIBASIA_04345 [Candidatus Liberibacter asiaticus str. psy62] (106 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780968|ref|YP_003065381.1| hypothetical protein CLIBASIA_04345 [Candidatus Liberibacter asiaticus str. psy62] Length = 106 Score = 218 bits (554), Expect = 2e-59, Method: Compositional matrix adjust. Identities = 106/106 (100%), Positives = 106/106 (100%) Query: 1 MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALR 60 MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALR Sbjct: 1 MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALR 60 Query: 61 QSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSIDRI 106 QSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSIDRI Sbjct: 61 QSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSIDRI 106 >gi|254780750|ref|YP_003065163.1| DNA mismatch repair protein [Candidatus Liberibacter asiaticus str. psy62] Length = 920 Score = 25.0 bits (53), Expect = 0.35, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 4 SVNSIIQNEIKKNDVVLFMKGTPTSPR 30 S+N IQN I N + +K +P PR Sbjct: 350 SINFFIQNPILINPIQKILKSSPDVPR 376 >gi|254780567|ref|YP_003064980.1| hypothetical protein CLIBASIA_02270 [Candidatus Liberibacter asiaticus str. psy62] Length = 246 Score = 23.9 bits (50), Expect = 0.73, Method: Compositional matrix adjust. Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 14/49 (28%) Query: 29 PRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYV 77 PRC LG+S D+L A+ Q+++ +WP+ P V Sbjct: 33 PRC------------LGISRD--DLLVHSAIEQAVRLIDSWPSWPSRVV 67 >gi|254780872|ref|YP_003065285.1| 3-demethylubiquinone-9 3-methyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Score = 23.5 bits (49), Expect = 1.1, Method: Compositional matrix adjust. Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 26 PTSPRCGFSGKVVQVLDSLGVSY 48 PT C + V+++D +GV Y Sbjct: 203 PTEMECFLAANKVKIIDRVGVVY 225 >gi|254781017|ref|YP_003065430.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 324 Score = 22.7 bits (47), Expect = 1.7, Method: Compositional matrix adjust. Identities = 9/15 (60%), Positives = 10/15 (66%) Query: 29 PRCGFSGKVVQVLDS 43 P CGF KV+ LDS Sbjct: 85 PSCGFDLKVISQLDS 99 >gi|254780280|ref|YP_003064693.1| glucokinase [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 22.7 bits (47), Expect = 1.8, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 45 GVSYKGIDVLADDALRQSIKEYS 67 G+ YK ID+L + + R+S + S Sbjct: 277 GIPYKIIDLLRNSSFRESFENKS 299 >gi|254780848|ref|YP_003065261.1| co-chaperonin GroES [Candidatus Liberibacter asiaticus str. psy62] Length = 111 Score = 22.3 bits (46), Expect = 2.3, Method: Compositional matrix adjust. Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Query: 8 IIQNEIKKNDVVLFMK--GTPTSPRCGFSGKVVQVLDSLGV 46 +I+ E+ K D+VLF K GT G V+Q D +G+ Sbjct: 63 VIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGI 103 >gi|254781144|ref|YP_003065557.1| hypothetical protein CLIBASIA_05240 [Candidatus Liberibacter asiaticus str. psy62] Length = 76 Score = 21.9 bits (45), Expect = 2.8, Method: Compositional matrix adjust. Identities = 11/27 (40%), Positives = 14/27 (51%) Query: 48 YKGIDVLADDALRQSIKEYSNWPTIPQ 74 Y GI LA+ Q++ EY N P Q Sbjct: 48 YNGIARLAEAVGVQNVNEYFNNPDSEQ 74 >gi|254780674|ref|YP_003065087.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Score = 21.6 bits (44), Expect = 3.8, Method: Compositional matrix adjust. Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 78 KGDFIGGCDIVCEMFESGELHEILSID 104 +GD I DI+CE+ + E S+D Sbjct: 27 EGDKISPGDILCEIETDKAIMEFESVD 53 >gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter asiaticus str. psy62] Length = 750 Score = 20.4 bits (41), Expect = 7.6, Method: Compositional matrix adjust. Identities = 11/46 (23%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Query: 21 FMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEY 66 F + +S + ++ ++LD + K +L DD ++ IK+Y Sbjct: 318 FHRDNSSSTKIQQDSQIQKMLD---LYKKNCQILHDDKMQSLIKDY 360 >gi|255764512|ref|YP_003065529.2| preprotein tranlocase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 108 Score = 20.0 bits (40), Expect = 9.5, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 12/22 (54%) Query: 23 KGTPTSPRCGFSGKVVQVLDSL 44 +G G GKVV+V+D L Sbjct: 58 RGDSIVTAAGIVGKVVRVIDDL 79 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.138 0.407 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,374 Number of Sequences: 1233 Number of extensions: 2831 Number of successful extensions: 13 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of query: 106 length of database: 328,796 effective HSP length: 62 effective length of query: 44 effective length of database: 252,350 effective search space: 11103400 effective search space used: 11103400 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)