RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780969|ref|YP_003065382.1| hypothetical protein CLIBASIA_04350 [Candidatus Liberibacter asiaticus str. psy62] (79 letters) >gnl|CDD|183243 PRK11628, PRK11628, transcriptional regulator BolA; Provisional. Length = 105 Score = 37.8 bits (88), Expect = 7e-04 Identities = 14/47 (29%), Positives = 30/47 (63%) Query: 27 AGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKT 73 AG +H+ ++S+ F G+ + +H+M+Y +L ++ +HAL++ T Sbjct: 33 AGSESHFKVVLVSDRFTGERFLNRHRMIYSTLAEELSTTVHALALHT 79 >gnl|CDD|183414 PRK12296, obgE, GTPase CgtA; Reviewed. Length = 500 Score = 26.0 bits (58), Expect = 2.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 21 VTIHDLAGDGNHYAAEIISEEFR 43 V +H AGDG + A + E+F+ Sbjct: 8 VVLHVKAGDGGNGCASVHREKFK 30 >gnl|CDD|181197 PRK08013, PRK08013, oxidoreductase; Provisional. Length = 400 Score = 25.8 bits (57), Expect = 2.4 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 9/38 (23%) Query: 22 TIHDLAGDGNHY----AAEIISEEFR----GKNRIQQH 51 TIH LAG G + AAE+I+E R GK+ I QH Sbjct: 293 TIHPLAGQGVNLGFMDAAELIAELRRLHRQGKD-IGQH 329 >gnl|CDD|185539 PTZ00286, PTZ00286, 6-phospho-1-fructokinase; Provisional. Length = 459 Score = 25.8 bits (57), Expect = 2.9 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 5/44 (11%) Query: 4 NPHEI-EKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKN 46 +P + + +I+ GI L GDG H A I +E R + Sbjct: 164 DPKVMVDTLIRHGINILFT----LGGDGTHRGALAIYKELRRRK 203 >gnl|CDD|148912 pfam07559, FlaE, Flagellar basal body protein FlaE. This family consists of several bacterial FlaE flagellar proteins. These proteins are part of the flageller basal body rod complex. Length = 117 Score = 25.1 bits (55), Expect = 4.8 Identities = 8/8 (100%), Positives = 8/8 (100%) Query: 54 VYDSLGNK 61 VYDSLGNK Sbjct: 17 VYDSLGNK 24 >gnl|CDD|180736 PRK06860, PRK06860, lipid A biosynthesis lauroyl acyltransferase; Provisional. Length = 309 Score = 24.5 bits (54), Expect = 6.5 Identities = 6/16 (37%), Positives = 7/16 (43%), Gaps = 1/16 (6%) Query: 3 MNPHEIEKMIKKGIPQ 18 MN +EK I Q Sbjct: 275 MN-KVVEKCILMAPEQ 289 >gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase. Members of this protein family are 1-pyrroline dehydrogenase (1.5.1.35), also called gamma-aminobutyraldehyde dehydrogenase. This enzyme can follow putrescine transaminase (EC 2.6.1.82) for a two-step conversion of putrescine to gamma-aminobutyric acid (GABA). The member from Escherichia coli is characterized as a homotetramer that binds one NADH per momomer. This enzyme belongs to the medium-chain aldehyde dehydrogenases, and is quite similar in sequence to the betaine aldehyde dehydrogenase (EC 1.2.1.8) family. Length = 472 Score = 24.2 bits (52), Expect = 7.7 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Query: 47 RIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79 RI + +YD+L K+G A+ L K+ PD + Sbjct: 284 RIYAQRGIYDTLVEKLGAAVATL--KSGAPDDE 314 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.267 0.0559 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,265,206 Number of extensions: 65303 Number of successful extensions: 147 Number of sequences better than 10.0: 1 Number of HSP's gapped: 147 Number of HSP's successfully gapped: 21 Length of query: 79 Length of database: 5,994,473 Length adjustment: 49 Effective length of query: 30 Effective length of database: 4,935,681 Effective search space: 148070430 Effective search space used: 148070430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.4 bits)