RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780969|ref|YP_003065382.1| hypothetical protein CLIBASIA_04350 [Candidatus Liberibacter asiaticus str. psy62] (79 letters) >d1ny8a_ d.52.6.1 (A:) Hypothetical protein YrbA {Escherichia coli [TaxId: 562]} Length = 97 Score = 76.0 bits (187), Expect = 7e-16 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 4/78 (5%) Query: 1 MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60 M +EI+ ++ + V + GDG+H+ + E F G +R+++ Q VY L Sbjct: 4 DPMENNEIQSVLMNALSLQEVHVS---GDGSHFQVIAVGELFDGMSRVKKQQTVYGPLME 60 Query: 61 KMG-NALHALSIKTSVPD 77 + N +HA+SIK P Sbjct: 61 YIADNRIHAVSIKAYTPA 78 >d1v9ja_ d.52.6.1 (A:) BolA-like protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Score = 66.8 bits (163), Expect = 5e-13 Identities = 17/79 (21%), Positives = 40/79 (50%), Gaps = 3/79 (3%) Query: 1 MSMNPHEIEKMIKKGIPQSIVTIHD--LAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSL 58 M ++ + + +++ + V + D L + ++S +F GK +Q+H++V + L Sbjct: 28 MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLLQRHRLVNECL 87 Query: 59 GNKMGNALHALSIKTSVPD 77 ++ + +HA KT P+ Sbjct: 88 AEELPH-IHAFEQKTLTPE 105 >d1uf2a_ e.28.1.2 (A:) RDV p3 {Rice dwarf virus [TaxId: 10991]} Length = 967 Score = 23.4 bits (50), Expect = 5.9 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Query: 36 EIISEEFRGKNRI---QQHQMVYDSLGNKMGN 64 E + + F G I Q + VYD+L NK+G Sbjct: 608 EAVPDFFAGGEDILILQLIRAVYDTLSNKLGR 639 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.267 0.0667 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 288,917 Number of extensions: 11384 Number of successful extensions: 31 Number of sequences better than 10.0: 1 Number of HSP's gapped: 27 Number of HSP's successfully gapped: 9 Length of query: 79 Length of database: 2,407,596 Length adjustment: 45 Effective length of query: 34 Effective length of database: 1,789,746 Effective search space: 60851364 Effective search space used: 60851364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.0 bits)