>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain. A subgroup of AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain. AraC regulators are defined by a AraC-type helix-turn-helix DNA binding domain at their C-terminal. AraC family transcriptional regulators are widespread among bacteria and are involved in regulating diverse and important biological functions, including carbon metabolism, stress responses and virulence in different microorganisms. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with typical GATase1domains a reactive cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.

Probab=97.14 E-value=0.00014 Score=50.06 Aligned_cols=61 Identities=30% Similarity=0.535 Sum_probs=44.4 Q ss_pred CCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHEECCCHHHH Q ss_conf 4456478997287345431140677520021212233220597178606403101000001011 Q gi|254780971|r 38 DIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGI 101 (219) Q Consensus 38 ~l~~~d~lvipGGFSygD~l~aG~i~~~~~~~~~i~~~~~~g~~vLGICNGfQiL~elGLlPg~ 101 (219) T Consensus 66 ~~~~~D~livpg~~~~~~~~---~~~~~~~l~~~L~~~~~~g~~i~sictGa~~LA~aGLL~g~ 126 (195) T cd03138 66 DVPAPDLVIVPGLGGDPDEL---LLADNPALIAWLRRQHANGATVAAACTGVFLLAEAGLLDGR 126 (195) T ss_pred HCCCCCEEEECCCCCCCCCC---CCCCCHHHHHHHHHHHHHCCEEECCCHHHHHHHHCCCCCCC T ss_conf 56656889975766786301---23369999999998665271784165899999973663799

HHsearch alignment for GI: 254780971 and conserved domain: cd03138