>gi|254780972|ref|YP_003065385.1| phosphoribosylformylglycinamidine synthase, PurS protein [Candidatus Liberibacter asiaticus str. psy62]
MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQKSSS