RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780972|ref|YP_003065385.1| phosphoribosylformylglycinamidine synthase, PurS protein [Candidatus Liberibacter asiaticus str. psy62] (84 letters) >d1vq3a_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Thermotoga maritima [TaxId: 2336]} Length = 86 Score = 96.7 bits (241), Expect = 4e-22 Identities = 21/79 (26%), Positives = 45/79 (56%) Query: 1 MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE 60 + K + V+ + +V DP+G+ ++ L + ++R GK +E++ + A E ++ Sbjct: 7 LFKFAIDVQYRSNVRDPRGETIERVLREEKGLPVKKLRLGKSIHLEVEAENKEKAYEIVK 66 Query: 61 SICQNLLANPVIEDYDIKV 79 C+ LL NPV+E+Y+++ Sbjct: 67 KACEELLVNPVVEEYEVRE 85 >d1t4aa_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Bacillus subtilis [TaxId: 1423]} Length = 80 Score = 96.6 bits (241), Expect = 5e-22 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 1/81 (1%) Query: 1 MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE 60 M K V V LK+ VLDPQG A++ AL ++ ++ + +R GK ++ ++++ D + ++ Sbjct: 1 MYKVKVYVSLKESVLDPQGSAVQHALHSMTYNEVQDVRIGKYMELTIEKSDRD-LDVLVK 59 Query: 61 SICQNLLANPVIEDYDIKVQK 81 +C+ LLAN VIEDY +V++ Sbjct: 60 EMCEKLLANTVIEDYRYEVEE 80 >d1gtda_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 82 Score = 89.3 bits (222), Expect = 8e-20 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Query: 3 KANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESI 62 V ++LKK +L+P+ ++ AL+ +G+ + + MDE + E E+E + Sbjct: 3 MVEVRIRLKKGMLNPEAATIERALALLGY-EVEDTDTTDVITFTMDEDSLEAVEREVEDM 61 Query: 63 CQNLLANPVIEDYDIKVQKSS 83 CQ LL NPVI DYD+ + + S Sbjct: 62 CQRLLCNPVIHDYDVSINEMS 82 >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Score = 31.2 bits (69), Expect = 0.022 Identities = 8/48 (16%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Query: 29 IGFHNINQIRQ-GKIFDIEMDETLSDIAEEELESICQNLLANPVIEDY 75 G Q+ +I L+ ++++ +I +N +++PV ++ Sbjct: 279 WGARKPGQLEALSEITGWT----LNSEDQKDINTILENTISDPVGPEF 322 >d1w5ra1 d.3.1.5 (A:3-275) Arylamine N-acetyltransferase {Mycobacterium smegmatis [TaxId: 1772]} Length = 273 Score = 23.8 bits (51), Expect = 4.1 Identities = 9/57 (15%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Query: 26 LSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESIC--QNLLANPVIEDYDIKVQ 80 +I F N++ + + D+ + + + + N L V+E+ +V+ Sbjct: 31 NRSIPFENLDPLLGIPVADLSAEALFAKLVDRRRGGYQYEHNGLLGYVLEELGFEVE 87 >d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 219 Score = 23.2 bits (50), Expect = 5.5 Identities = 8/33 (24%), Positives = 14/33 (42%) Query: 29 IGFHNINQIRQGKIFDIEMDETLSDIAEEELES 61 + + Q + FD+ +DE + A E L Sbjct: 163 VAADKLAQCPPQESFDVILDENQLEDACEHLAD 195 >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Score = 23.1 bits (49), Expect = 6.5 Identities = 8/29 (27%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Query: 45 IEMDETLSDIAEEELE-SICQNLLANPVI 72 +E + + + ++ LE IC L+ PV Sbjct: 8 VEEVQNVINAMQKILECPICLELIKEPVS 36 >d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Score = 23.2 bits (49), Expect = 6.7 Identities = 12/51 (23%), Positives = 18/51 (35%) Query: 24 TALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIED 74 ++ I NI+ DI E + Q +LA+PV D Sbjct: 81 KFVTKIWHPNISSQTGAICLDILKHEWSPALTIRTALLSIQAMLADPVPTD 131 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.313 0.132 0.349 Gapped Lambda K H 0.267 0.0486 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 309,396 Number of extensions: 12105 Number of successful extensions: 40 Number of sequences better than 10.0: 1 Number of HSP's gapped: 38 Number of HSP's successfully gapped: 11 Length of query: 84 Length of database: 2,407,596 Length adjustment: 49 Effective length of query: 35 Effective length of database: 1,734,826 Effective search space: 60718910 Effective search space used: 60718910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.5 bits)