HHsearch alignment for GI: 254780974 and conserved domain: PRK02186

>PRK02186 argininosuccinate lyase; Provisional.
Probab=100.00  E-value=0  Score=541.44  Aligned_cols=397  Identities=18%  Similarity=0.187  Sum_probs=347.1

Q ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHC-CCCHHHHHHHHHHHCCCHHHHHHHHHHHCCHH-HC
Q ss_conf             72795889999999999999997776899989999999830012-78989999887463785479999999867934-32
Q gi|254780974|r   12 TLWSLETKFRIWFEIEAHACDALAKLGVIPEKSSKNIWEKGRNA-VFNVDRIMELDSIIKHDVIAFLTHLAEIIGPD-AR   89 (435)
Q Consensus        12 ~ifs~~~~~~~~l~ve~A~a~a~~e~G~ip~~aa~~I~~~~~~~-~~d~~~~~~~~~~~~~~v~a~~~~l~~~~g~~-~~   89 (435)
T Consensus       435 ~~~~~~~~~~~~~~i~~ahl~ml~~~gi~~~~~~~~l~~~~~~l~~~~~~~l~~~~~~rg-~Yf~yE~~Lier~G~D~gG  513 (892)
T PRK02186        435 ASEAPLAELDHLAAIDEAHLVMLGDTGIVAPERARPLLDAHRRLRDAGFAPLLARPAPRG-LYMLYEAYLIERLGEDVGG  513 (892)
T ss_pred             CCCCCHHHHHHHHCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCHHHCCCCCCCC-HHHHHHHHHHHHHCHHHCC
T ss_conf             333634555545221266757877627877788899999999877468344306878863-0137899999982801126


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25567770778778999998511024678888889999873332010021012321025542223334455431000148
Q gi|254780974|r   90 FIHQGMTSSDILDTCFSIQLMRSTDILLEDIDQLLESLKKRAFEYKDTLTIGRSHGIHAEPTTFGLKLAMAYAEFSRSRK  169 (435)
Q Consensus        90 ~iH~G~Ts~Di~~Ta~~l~~r~~l~~l~~~l~~l~~~L~~~a~~~~~~~m~grTh~Q~A~P~T~G~~~~~~~~~l~r~~~  169 (435)
T Consensus       514 ~LhtgRSRNDqvAT~~rl~lRd~~~~~~~~l~~L~~aL~~~Ae~~~~tvmPgyTHlQ~AQP~t~gH~Lla~~~~l~RD~~  593 (892)
T PRK02186        514 VLQTARSRNDINATTTKLHLREATSRAFDALWRLRRALVFKASANVDCALPIYSQYQPALPGSLGHYLLAVDGALARETH  593 (892)
T ss_pred             EEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             25205334468999999999999999999999999999999986338652364457656741299999999999985999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             899986431010011122222466466788655422578766352--023333345677888776446889999999951
Q gi|254780974|r  170 RLLTAREEIAVCAISGSVGTFSNIHPYVEQHVADAMGLKTDPISS--QVIARDRHAMYFSVLGVIASSIERVATEIRHLQ  247 (435)
Q Consensus       170 rl~~~~~~~~~~~lgGAvGt~~~~~~~~~~~~a~~LGl~~~~~~~--~~~~rd~~~e~~~~l~~~~~~l~kia~Dl~~l~  247 (435)
T Consensus       594 Rl~~~~~r~n~~PLGa~Al-aGT~~piDr~~tA~lLGF~~~~~NSlDavs~RDf~~e~~~~~a~~~~~lsRlaeel~lws  672 (892)
T PRK02186        594 ALFALFEHIDVCPLGAGAG-GGTTFPIDPEFVARLLGFEQPAPNSLDAVASRDGVLHFLSAMAAISTVLSRLAQDLQLWT  672 (892)
T ss_pred             HHHHHHHCCCCCCCCCCCC-CCCCCCCCHHHHHHHCCCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999983236698520002-589898698999998199875555312332118999999999999998889999999972


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHCCHHHHHHHHHHHHHHHHHCCHHHH---HHHHHHCCCCCCCHHHHHCCCCHHHHHH
Q ss_conf             6787600025644654201232102415678775211233431002354---3114313543210155541720457899
Q gi|254780974|r  248 RTEILEVEEFFHPGQKGSSSMPHKRNPILTENLTGLSRLIRSHVIPAME---NVALWHERDISHSSVERVIGPDATIHLD  324 (435)
Q Consensus       248 ~~eigei~ep~~~~~~GSS~MP~K~NP~~~E~i~~~a~~~~g~~~~~~~---~~~~~~erd~~~~~~~~~~l~~~~~~~~  324 (435)
T Consensus       673 s~efgfi~l~D~-~~tgSSiMPQKkNPdvlElvRgKaGrviG~L~~lLt~lKglP~~yn~D~~~e~~~--~~~da~d~~~  749 (892)
T PRK02186        673 TREFALVSLPDA-LTGGSSMLPQKKNPFLLEFVKGRAGVVAGALASASAALGKTPFSNSFEAGSPMNG--PIAQACAAIE  749 (892)
T ss_pred             CCCCCEEECCCC-CCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCH--HHHHHHHHHH
T ss_conf             325574876754-5445666786769718999732000038899999998635876334431222002--6899999999


Q ss_pred             HHHHHHHHHHHHCEECHHHHHHHHHHHCCHHHHHHHHHHHH-HCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHC-CHHH
Q ss_conf             99999874231004373579999864458378999999998-729998999999999999999819998999850-7432
Q gi|254780974|r  325 FALNRLKNVIEELVVYPENMKDNLEQLKGLIHSQRILLALT-QAGVSREEAYQLVQRNAMKVWKNGAIFLDVLLA-DVDI  402 (435)
Q Consensus       325 ~~l~~~~~ll~~L~vn~erm~~nl~~s~g~i~se~i~~~L~-~~Gig~~~Ah~~v~~~a~~a~~~~~~l~e~l~~-d~~i  402 (435)
T Consensus       750 ~~L~l~~~~v~~~~~~~~rM~~aa--~~gfstATdlAD~LVr~~GipFR~AH~iVG~~Vr~al~~g~~~~~~~~~~~~~~  827 (892)
T PRK02186        750 DAAAVLVLLIDGLEADQARMRAHL--EDGGVSATAVAESLVVRRSISFRSAHTQVGQAIRQSLDQGRSSADALAALDPQF  827 (892)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHH--HCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCC
T ss_conf             999999999844850899999986--538716999999999864998789999999999999855998667898735242


Q ss_pred             HCCCCHHHHHHHCC
Q ss_conf             30599899998518
Q gi|254780974|r  403 RKVLSEKEICDKFD  416 (435)
Q Consensus       403 ~~~l~~~eL~~~ld  416 (435)
T Consensus       828 ~~~~~~-e~~~~~~  840 (892)
T PRK02186        828 VSRAPL-EWARSHR  840 (892)
T ss_pred             CCCCCH-HHHHHHH
T ss_conf             224876-7888865