RPSBLAST alignment for GI: 254780974 and conserved domain: TIGR00979

>gnl|CDD|130052 TIGR00979, fumC_II, fumarate hydratase, class II. Putative fumarases from several species (Mycobacterium tuberculosis, Streptomyces coelicolor, Pseudomonas aeruginosa) branch deeply, although within the same branch of a phylogenetic tree rooted by aspartate ammonia-lyase sequences, and score between the trusted and noise cutoffs. Length = 458
 Score = 65.1 bits (159), Expect = 3e-11
 Identities = 63/252 (25%), Positives = 111/252 (44%), Gaps = 28/252 (11%)

Query: 48  IWEKGRNAVFNVDRIMELDSIIKHDVIAFLTHLAEIIGPDARFIH------QGMTSSDIL 101
           +W+ G     N    M ++ +I +  I     L   +G   + +H      +  +S+D  
Sbjct: 90  VWQTGSGTQSN----MNVNEVIANRAIE---LLGGKLG-SKQPVHPNDHVNKSQSSNDTF 141

Query: 102 DTCFSIQLMRST-DILLEDIDQLLESLKKRAFEYKDTLTIGRSHGIHAEPTTFGLKLAMA 160
            T   I  + +  + L+  ++ L ++L  ++ E+   + IGR+H   A P T G + +  
Sbjct: 142 PTAMHIAAVLAIKNQLIPALENLKKTLDAKSKEFAHIVKIGRTHLQDATPLTLGQEFSGY 201

Query: 161 YAEFSRSRKRLLTAREEIAVCAISGS-VGTFSNIHP-YVE---QHVADAMGLKTDPISSQ 215
            A+     +R+  +   +   AI G+ VGT  N HP + E   + +A   GL      ++
Sbjct: 202 VAQLEHGLERIAYSLPHLYELAIGGTAVGTGLNTHPGFDEKVAEEIAKETGLPFVTAPNK 261

Query: 216 VIARDRH--AMYFS-VLGVIASSIERVATEIRHL---QRTEILEVEEFFHPGQKGSSSMP 269
             A   H   +     L  +A+S+ ++A +IR L    R  + E+  F    + GSS MP
Sbjct: 262 FEALAAHDAIVEAHGALKTLAASLMKIANDIRWLGSGPRCGLGEL--FIPENEPGSSIMP 319

Query: 270 HKRNPILTENLT 281
            K NP   E LT
Sbjct: 320 GKVNPTQCEALT 331