BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780975|ref|YP_003065388.1| D-ribulose-5 phosphate 3-epimerase protein [Candidatus Liberibacter asiaticus str. psy62] (224 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780975|ref|YP_003065388.1| D-ribulose-5 phosphate 3-epimerase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 224 Score = 451 bits (1161), Expect = e-129, Method: Compositional matrix adjust. Identities = 224/224 (100%), Positives = 224/224 (100%) Query: 1 MTPSIQIVPSILAADFSRLGEEISNITKAGAKQIHFDVMDGCFVPNISFGADVIRSLRSY 60 MTPSIQIVPSILAADFSRLGEEISNITKAGAKQIHFDVMDGCFVPNISFGADVIRSLRSY Sbjct: 1 MTPSIQIVPSILAADFSRLGEEISNITKAGAKQIHFDVMDGCFVPNISFGADVIRSLRSY 60 Query: 61 SDSVFDCHLMISSIDSHINIIADAGCDIITFHPESSPHIRRSLRTIHAMGKKTGVAINPE 120 SDSVFDCHLMISSIDSHINIIADAGCDIITFHPESSPHIRRSLRTIHAMGKKTGVAINPE Sbjct: 61 SDSVFDCHLMISSIDSHINIIADAGCDIITFHPESSPHIRRSLRTIHAMGKKTGVAINPE 120 Query: 121 TPVAILEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTS 180 TPVAILEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTS Sbjct: 121 TPVAILEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTS 180 Query: 181 RNIKSLVQAGADLLVVGSSFFNQKGEISYAKRLNDLKKSALAID 224 RNIKSLVQAGADLLVVGSSFFNQKGEISYAKRLNDLKKSALAID Sbjct: 181 RNIKSLVQAGADLLVVGSSFFNQKGEISYAKRLNDLKKSALAID 224 >gi|254780821|ref|YP_003065234.1| FolC bifunctional protein [Candidatus Liberibacter asiaticus str. psy62] Length = 429 Score = 25.4 bits (54), Expect = 0.73, Method: Compositional matrix adjust. Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 7/94 (7%) Query: 49 FGADVIRSLRSYSDSVFDCHL----MISSIDSHINIIADAGCDIITFHPESSPHIRRSLR 104 F + +L +S DC + + S+D+ NII +IT S H + Sbjct: 104 FELSIATALVLFSKYPADCAIIEVGLGGSLDA-TNIIEKVAVSVIT--SISLDHEKILGN 160 Query: 105 TIHAMGKKTGVAINPETPVAILEDVIDEIDMILI 138 T+ A+ K I P PV I V DE+ IL+ Sbjct: 161 TVSAIAKDKSGIIKPGCPVVIGHQVYDEVREILV 194 >gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 869 Score = 23.9 bits (50), Expect = 2.7, Method: Compositional matrix adjust. Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Query: 107 HAMGKKTGVAINPETPVAILEDVIDEIDMILIMTVNP 143 + +G+ G+ I E I+ + ID+I+ IL+ T P Sbjct: 223 NWIGRSEGMEIRWE----IVSNTIDQIEEILVYTTRP 255 >gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Score = 23.5 bits (49), Expect = 2.9, Method: Compositional matrix adjust. Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 200 FFNQKGEISYAKRLND 215 F+N+KGEI K +ND Sbjct: 509 FYNEKGEILLDKAIND 524 >gi|254780161|ref|YP_003064574.1| phytoene synthase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 299 Score = 23.1 bits (48), Expect = 4.2, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Query: 44 VPNISFGADVIRS--LRSYSDSVFDC 67 +PN F D+I + SY+DS+FDC Sbjct: 112 LPNQYF-LDMIEAHFFDSYNDSIFDC 136 >gi|254780659|ref|YP_003065072.1| hypothetical protein CLIBASIA_02730 [Candidatus Liberibacter asiaticus str. psy62] Length = 274 Score = 23.1 bits (48), Expect = 4.4, Method: Compositional matrix adjust. Identities = 6/36 (16%), Positives = 22/36 (61%) Query: 177 GVTSRNIKSLVQAGADLLVVGSSFFNQKGEISYAKR 212 G+T + +++ G D++ G+ ++++ + +++R Sbjct: 46 GITEKIFCEMMETGIDVITTGNHVWDKREALVFSQR 81 >gi|254780847|ref|YP_003065260.1| hypothetical protein CLIBASIA_03710 [Candidatus Liberibacter asiaticus str. psy62] Length = 282 Score = 22.3 bits (46), Expect = 6.6, Method: Compositional matrix adjust. Identities = 10/37 (27%), Positives = 19/37 (51%) Query: 126 LEDVIDEIDMILIMTVNPGFGGQQLIESTIPKIRQAK 162 L ++ D+IL GQ+ + TIP +++A+ Sbjct: 8 LRTILPYYDVILCDVWGVLHNGQKFLPGTIPALKEAR 44 >gi|254780762|ref|YP_003065175.1| recombination protein RecR [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 21.9 bits (45), Expect = 9.4, Method: Compositional matrix adjust. Identities = 9/33 (27%), Positives = 20/33 (60%) Query: 134 DMILIMTVNPGFGGQQLIESTIPKIRQAKALIG 166 ++I I+ PGFG + +T+ +++ + L+G Sbjct: 12 NLIKILARIPGFGPRSARRATLHLVKKKEQLLG 44 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.137 0.383 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 138,166 Number of Sequences: 1233 Number of extensions: 5612 Number of successful extensions: 28 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 19 Number of HSP's gapped (non-prelim): 13 length of query: 224 length of database: 328,796 effective HSP length: 71 effective length of query: 153 effective length of database: 241,253 effective search space: 36911709 effective search space used: 36911709 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 37 (18.9 bits)