BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780976|ref|YP_003065389.1| Holliday junction resolvase YqgF [Candidatus Liberibacter asiaticus str. psy62] (160 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780976|ref|YP_003065389.1| Holliday junction resolvase YqgF [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Score = 323 bits (829), Expect = 7e-91, Method: Compositional matrix adjust. Identities = 160/160 (100%), Positives = 160/160 (100%) Query: 1 MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60 MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL Sbjct: 1 MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60 Query: 61 SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120 SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ Sbjct: 61 SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120 Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG Sbjct: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160 >gi|254780341|ref|YP_003064754.1| proline/glycine betaine ABC transporter, permease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 281 Score = 27.7 bits (60), Expect = 0.12, Method: Compositional matrix adjust. Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Query: 47 LVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHS-TRAFVHNM 97 ++++ Q E LS + + IG+PL + + PR +S R F+ +M Sbjct: 84 IIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSM 135 >gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Score = 24.3 bits (51), Expect = 1.1, Method: Compositional matrix adjust. Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 46 FLVRKKVTQTALELLSFIT 64 FL+ KK T A E++SFIT Sbjct: 280 FLMSKKGTSNAGEIMSFIT 298 >gi|254780448|ref|YP_003064861.1| hypothetical protein CLIBASIA_01665 [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 22.7 bits (47), Expect = 3.4, Method: Compositional matrix adjust. Identities = 13/53 (24%), Positives = 25/53 (47%) Query: 89 STRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAA 141 T N++D F+ +++ SAQ +L ++N K +KV I++ Sbjct: 172 GTNKVYKNLLDASRATEFIIDGKKINIDSAQNMLAELNKIFPKDFEKVQLISS 224 >gi|254780551|ref|YP_003064964.1| tolQ protein [Candidatus Liberibacter asiaticus str. psy62] Length = 230 Score = 21.9 bits (45), Expect = 5.7, Method: Compositional matrix adjust. Identities = 10/28 (35%), Positives = 19/28 (67%) Query: 130 KKRIQKVDSIAAALILQEVLDRISFLES 157 + RI ++ +A A L+E+ +++SFL S Sbjct: 110 QDRIDRMMDVAIARELEEITEKLSFLGS 137 >gi|254780527|ref|YP_003064940.1| hypothetical protein CLIBASIA_02070 [Candidatus Liberibacter asiaticus str. psy62] Length = 397 Score = 21.6 bits (44), Expect = 8.3, Method: Compositional matrix adjust. Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 132 RIQKVDSIAAALILQEVLDRISFL 155 R Q DS+ A + + VL++ SF+ Sbjct: 220 RYQSSDSLDALMSTESVLNQKSFM 243 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.138 0.385 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,411 Number of Sequences: 1233 Number of extensions: 3163 Number of successful extensions: 8 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 6 length of query: 160 length of database: 328,796 effective HSP length: 67 effective length of query: 93 effective length of database: 246,185 effective search space: 22895205 effective search space used: 22895205 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 35 (18.1 bits)