RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780977|ref|YP_003065390.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C protein [Candidatus Liberibacter asiaticus str. psy62] (95 letters) >gnl|CDD|31065 COG0721, GatC, Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Translation, ribosomal structure and biogenesis]. Length = 96 Score = 77.6 bits (191), Expect = 7e-16 Identities = 37/95 (38%), Positives = 57/95 (60%) Query: 1 MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60 M ID +VK +A +R+ + EE++ F +L + L +E+++EV+ EGVEP + + Sbjct: 1 MAIDREEVKHLAKLARLELSEEELEKFATQLEDILGYVEQLNEVDTEGVEPTTHPLEVSN 60 Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95 V R D V +G E +L+NAP E FF VPK +E Sbjct: 61 VLREDEVTEGLDREELLANAPESEDGFFKVPKIIE 95 >gnl|CDD|145703 pfam02686, Glu-tRNAGln, Glu-tRNAGln amidotransferase C subunit. This is a family of Glu-tRNAGln amidotransferase C subunits. The Glu-tRNA Gln amidotransferase enzyme itself is an important translational fidelity mechanism replacing incorrectly charged Glu-tRNAGln with the correct Gln-tRANGln via transmidation of the misacylated Glu-tRNAGln. This activity supplements the lack of glutaminyl-tRNA synthetase activity in gram-positive eubacterteria, cyanobacteria, Archaea, and organelles. Length = 72 Score = 70.6 bits (174), Expect = 8e-14 Identities = 28/72 (38%), Positives = 40/72 (55%) Query: 19 IKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILS 78 + EE++ F +LN L +E+++EV+ EGVEP + + V R D V E IL+ Sbjct: 1 LSEEELEKFTGQLNKILDYVEQLNEVDTEGVEPTSHPLDLTNVLREDEVTPSLDREEILA 60 Query: 79 NAPHVEKNFFVV 90 NAP E FF V Sbjct: 61 NAPESEDGFFKV 72 >gnl|CDD|39448 KOG4247, KOG4247, KOG4247, Mitochondrial DNA polymerase accessory subunit [Replication, recombination and repair]. Length = 175 Score = 36.6 bits (84), Expect = 0.001 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 1/87 (1%) Query: 6 VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSV-VPMKMVHRP 64 +D K I H R+S+ D + L +++ V +++ V+VEGVEPM +V + Sbjct: 48 IDAKLINHLERLSLVRFDSEQAVANLRSSIRVAKRLELVDVEGVEPMHTVWEDQECPTFE 107 Query: 65 DVVCDGDKVESILSNAPHVEKNFFVVP 91 DV D +E + NA +FFV P Sbjct: 108 DVEEDPLPIEEVFRNASLRFDDFFVTP 134 >gnl|CDD|147562 pfam05443, ROS_MUCR, ROS/MUCR transcriptional regulator protein. This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti. This gene encodes a 15.5-kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid and is necessary for succinoglycan production. Sinorhizobium meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of alfalfa nodules. MucR from Sinorhizobium meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan. Length = 130 Score = 35.6 bits (83), Expect = 0.003 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Query: 12 AHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD-VVC-- 68 A+ S S+ E++P + ++ L+ L + E VP+K PD ++C Sbjct: 16 AYVSNNSVPAEELPGLIQSVHAALAGLGAPAAAPAAEEEKPTPAVPIKKSVTPDYIICLE 75 Query: 69 DGDK 72 DG K Sbjct: 76 DGKK 79 >gnl|CDD|36394 KOG1179, KOG1179, KOG1179, Very long-chain acyl-CoA synthetase/fatty acid transporter [Lipid transport and metabolism]. Length = 649 Score = 26.4 bits (58), Expect = 1.8 Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 13/53 (24%) Query: 34 TLSVLEKISEVNVEGVE-P-------MVSVVPMKMVHRPDVVCDGDKVESILS 78 LS L+ + +VNV GV P M ++ V P D +K+ L Sbjct: 529 VLSALDFLQDVNVYGVTVPGYEGRAGMAAI-----VLDPTTEKDLEKLYQHLR 576 >gnl|CDD|176973 CHL00032, ndhA, NADH dehydrogenase subunit 1. Length = 363 Score = 24.9 bits (55), Expect = 4.7 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 7/45 (15%) Query: 1 MLIDVVDVKRIAHFSRI-SIKEED------IPLFLLRLNNTLSVL 38 M+ID +V+ I FSR+ S+KE +P+ L L T+ VL Sbjct: 1 MIIDTTEVQAINSFSRLESLKEVYGLIWILVPILTLVLGITIGVL 45 >gnl|CDD|34803 COG5206, GPI8, Glycosylphosphatidylinositol transamidase (GPIT), subunit GPI8 [Posttranslational modification, protein turnover, chaperones]. Length = 382 Score = 25.0 bits (54), Expect = 5.0 Identities = 16/96 (16%), Positives = 37/96 (38%), Gaps = 9/96 (9%) Query: 6 VDVKRIAHFSRISIKEEDI---PLFLLR------LNNTLSVLEKISEVNVEGVEPMVSVV 56 + +H S I I F L+ + + L++ + ++ +N E + V V Sbjct: 212 IGQSSYSHHSDSLIGVAVIDRFTYFFLKFLEKIDIGSKLTLQDLLASLNKEPIHSHVGVR 271 Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92 + RP D ++ ++A + K+ + + Sbjct: 272 ELVFDRRPSDFLITDFFANVQNSALELLKSHYHHFR 307 >gnl|CDD|36330 KOG1114, KOG1114, KOG1114, Tripeptidyl peptidase II [Posttranslational modification, protein turnover, chaperones]. Length = 1304 Score = 24.9 bits (54), Expect = 5.2 Identities = 9/56 (16%), Positives = 21/56 (37%) Query: 36 SVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91 S+LEK+ E+ + + + + + + + C G + P V + Sbjct: 950 SLLEKLKELTLRVSKKLGNPITLDLYANHSDACLGKTKFERENLPPGVVSFVYGTN 1005 >gnl|CDD|33715 COG3933, COG3933, Transcriptional antiterminator [Transcription]. Length = 470 Score = 24.1 bits (52), Expect = 9.8 Identities = 12/46 (26%), Positives = 25/46 (54%) Query: 2 LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVE 47 L+ +VD+ + F I +E IP+ ++ +T VLE ++++ Sbjct: 168 LLLLVDMGSLTSFGSIISEEFGIPVKVIPNVSTSMVLEAGRKISLG 213 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.138 0.383 Gapped Lambda K H 0.267 0.0809 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,104,802 Number of extensions: 47223 Number of successful extensions: 104 Number of sequences better than 10.0: 1 Number of HSP's gapped: 104 Number of HSP's successfully gapped: 13 Length of query: 95 Length of database: 6,263,737 Length adjustment: 63 Effective length of query: 32 Effective length of database: 4,902,370 Effective search space: 156875840 Effective search space used: 156875840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.3 bits)