RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780977|ref|YP_003065390.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C protein [Candidatus Liberibacter asiaticus str. psy62] (95 letters) >gnl|CDD|178810 PRK00034, gatC, aspartyl/glutamyl-tRNA amidotransferase subunit C; Reviewed. Length = 95 Score = 94.9 bits (237), Expect = 5e-21 Identities = 38/95 (40%), Positives = 55/95 (57%) Query: 1 MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60 M I +VK +A +R+ + EE++ F +LN L +E+++EV+ EGVEP + MK Sbjct: 1 MAITREEVKHLAKLARLELSEEELEKFAGQLNKILDFVEQLNEVDTEGVEPTTHPLDMKN 60 Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95 V R DVV + E L NAP E +F VPK +E Sbjct: 61 VLREDVVTESLPREEALKNAPESEDGYFKVPKVIE 95 >gnl|CDD|129241 TIGR00135, gatC, glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C subunit. This model has been revised to remove the candidate sequence from Methanococcus jannaschii, now part of a related model. Length = 93 Score = 79.6 bits (197), Expect = 2e-16 Identities = 32/93 (34%), Positives = 49/93 (52%) Query: 3 IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62 I +VK +A +R+ + EE+ F L+ L +E+++EV+ E VEPM + + V Sbjct: 1 ISDEEVKHLAKLARLELSEEEAESFAGDLDKILGFVEQLNEVDTENVEPMTHPLEISNVL 60 Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95 R D + + IL NAP E F VPK +E Sbjct: 61 REDEPEEPLSRDDILKNAPEKEDGFIKVPKIIE 93 >gnl|CDD|162010 TIGR00722, ttdA_fumA_fumB, hydro-lyases, Fe-S type, tartrate/fumarate subfamily, alpha region. A number of Fe-S cluster-containing hydro-lyases share a conserved motif, including argininosuccinate lyase, adenylosuccinate lyase, aspartase, class I fumarate hydratase (fumarase), and tartrate dehydratase. This model represents a subset of closely related proteins or modules, including the E. coli tartrate dehydratase alpha chain and the N-terminal region of the class I fumarase (where the C-terminal region is homologous to the tartrate dehydratase beta chain). The activity of archaeal proteins in this subfamily has not been established. Length = 273 Score = 27.8 bits (62), Expect = 0.56 Identities = 12/52 (23%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Query: 24 IPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVES 75 +P+F +++ + ++ K+ E +GVE VP+ RP+ V + + Sbjct: 63 VPIFFVKVGSRFVLIGKLYEAIKQGVEEATEEVPL----RPNAVHPLTRENT 110 >gnl|CDD|105955 PRK12820, PRK12820, bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional. Length = 706 Score = 27.6 bits (61), Expect = 0.73 Identities = 19/84 (22%), Positives = 35/84 (41%), Gaps = 4/84 (4%) Query: 15 SRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPM--KMVHRPDVV-CDGD 71 SRI E + L + + ++ ++ + EP+ S P +M + C Sbjct: 624 SRIGFAEAERAAIESALADAEELAAQLEDIACD-EEPLFSPAPAANRMGEGLEARECSFA 682 Query: 72 KVESILSNAPHVEKNFFVVPKAVE 95 IL NAP V+ ++F V ++ Sbjct: 683 ATGEILKNAPAVKGDYFKVAGILD 706 >gnl|CDD|181933 PRK09532, PRK09532, DNA polymerase III subunit alpha; Reviewed. Length = 874 Score = 25.1 bits (55), Expect = 4.2 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 31 LNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD 65 + NTL V +KI N+ G EP + P+ H PD Sbjct: 267 IANTLEVADKIEPYNILG-EPRIPNYPVPSGHTPD 300 >gnl|CDD|131686 TIGR02638, lactal_redase, lactaldehyde reductase. This clade of genes encoding iron-containing alcohol dehydrogenase (pfam00465) proteins is generally found in apparent operons for the catabolism of rhamnose or fucose. Catabolism of both of these monosaccharides results in lactaldehyde which is reduced by this enzyme to 1,2 propanediol. This protein is alternatively known by the name 1,2 propanediol oxidoreductase. This enzyme is active under anaerobic conditions in E. coli while being inactivated by reactive oxygen species under aerobic conditions. Under aerobic conditions the lactaldehyde product of rhamnose and fucose catabolism is believed to be oxidized to lactate by a separate enzyme, lactaldehyde dehydrogenase. Length = 379 Score = 24.3 bits (53), Expect = 6.6 Identities = 7/17 (41%), Positives = 9/17 (52%) Query: 12 AHFSRISIKEEDIPLFL 28 S + +KEEDIP Sbjct: 338 EGLSELGVKEEDIPALA 354 >gnl|CDD|178151 PLN02536, PLN02536, diaminopimelate epimerase. Length = 267 Score = 24.0 bits (52), Expect = 8.0 Identities = 12/54 (22%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 23 DIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESI 76 ++P L +V++ +E++V+G +V+ V M H KV+ + Sbjct: 113 EVP-TKLAATKDGAVVQ--AELDVDGKTWLVTCVSMGNPHCVTFGEKELKVDDL 163 >gnl|CDD|178529 PLN02941, PLN02941, inositol-tetrakisphosphate 1-kinase. Length = 328 Score = 24.1 bits (53), Expect = 8.6 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Query: 23 DIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKV 73 D P + RL+N S+L+ ++++ + V VP ++V D D V Sbjct: 97 DPPDAIQRLHNRQSMLQVVADLKLSDGYGSVG-VPKQLVVYDDESSIPDAV 146 >gnl|CDD|182595 PRK10624, PRK10624, L-1,2-propanediol oxidoreductase; Provisional. Length = 382 Score = 24.2 bits (53), Expect = 8.8 Identities = 9/20 (45%), Positives = 11/20 (55%) Query: 6 VDVKRIAHFSRISIKEEDIP 25 DV H + +KEEDIP Sbjct: 331 RDVGIPPHLRDVGVKEEDIP 350 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.138 0.383 Gapped Lambda K H 0.267 0.0819 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,524,467 Number of extensions: 81653 Number of successful extensions: 158 Number of sequences better than 10.0: 1 Number of HSP's gapped: 158 Number of HSP's successfully gapped: 25 Length of query: 95 Length of database: 5,994,473 Length adjustment: 63 Effective length of query: 32 Effective length of database: 4,633,169 Effective search space: 148261408 Effective search space used: 148261408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (22.9 bits)