BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780977|ref|YP_003065390.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C protein [Candidatus Liberibacter asiaticus str. psy62] (95 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780977|ref|YP_003065390.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C protein [Candidatus Liberibacter asiaticus str. psy62] Length = 95 Score = 185 bits (470), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 95/95 (100%), Positives = 95/95 (100%) Query: 1 MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60 MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM Sbjct: 1 MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60 Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE Sbjct: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95 >gi|254780377|ref|YP_003064790.1| flagellar basal body P-ring biosynthesis protein FlgA [Candidatus Liberibacter asiaticus str. psy62] Length = 152 Score = 28.1 bits (61), Expect = 0.031, Method: Compositional matrix adjust. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 55 VVPMKMVHRPDVVCDGDKVESILSNA 80 V+P+ ++HRP V+ G KV IL+ Sbjct: 81 VIPLSVLHRPYVISRGAKVRIILTQG 106 >gi|255764477|ref|YP_003065232.2| dephospho-CoA kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Score = 25.0 bits (53), Expect = 0.27, Method: Compositional matrix adjust. Identities = 24/92 (26%), Positives = 36/92 (39%), Gaps = 41/92 (44%) Query: 35 LSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKV--------------------- 73 L +LEKI V PMV + K++H D+ C G+K+ Sbjct: 76 LEILEKI-------VHPMVRMHEKKILH--DLSCRGEKIVFFDTPLLFEKRKEYLFDAVV 126 Query: 74 ----------ESILSNAPHVEKNF-FVVPKAV 94 E +LS H E+NF F++ K + Sbjct: 127 VVTCSFETQRERVLSRKKHTEENFLFILSKQM 158 >gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Score = 21.9 bits (45), Expect = 2.3, Method: Composition-based stats. Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 56 VPMKMVHRPDVVCDGDKVES 75 +P+K+VH CDG ES Sbjct: 247 IPVKIVHHILASCDGKPGES 266 >gi|254781059|ref|YP_003065472.1| cysteine desulfurase activator complex subunit SufB [Candidatus Liberibacter asiaticus str. psy62] Length = 489 Score = 20.4 bits (41), Expect = 5.9, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 16/29 (55%) Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPKAV 94 VV GD + L++A + +F +PK V Sbjct: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGV 208 >gi|255764515|ref|YP_003065608.2| SNF2 related [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Score = 20.4 bits (41), Expect = 6.7, Method: Composition-based stats. Identities = 7/29 (24%), Positives = 19/29 (65%) Query: 34 TLSVLEKISEVNVEGVEPMVSVVPMKMVH 62 T+SVL +S +++ G + ++ + P+++ Sbjct: 31 TVSVLTALSYIHLWGEKSVLVIAPLRVAQ 59 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.138 0.383 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,498 Number of Sequences: 1233 Number of extensions: 2236 Number of successful extensions: 9 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 95 length of database: 328,796 effective HSP length: 60 effective length of query: 35 effective length of database: 254,816 effective search space: 8918560 effective search space used: 8918560 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 31 (16.5 bits)