RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780980|ref|YP_003065393.1| hypothetical protein CLIBASIA_04405 [Candidatus Liberibacter asiaticus str. psy62] (121 letters) >gnl|CDD|130083 TIGR01010, BexC_CtrB_KpsE, polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family. This family contains gamma proteobacterial proteins involved in capsule polysaccharide export. Length = 362 Score = 33.9 bits (78), Expect = 0.010 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Query: 36 QKNSTQMIKEANFKISE-THRLAQERVEAAEKRVKEVEERATASR-KLSVDELANAFWDL 93 QK + +++KE I+ R ++ + AE VKE E+R A++ +L ++ N +D Sbjct: 146 QKINQRLLKEGERLINRLNERARKDTIAFAENEVKEAEQRLNATKAELLKYQIKNKVFDP 205 >gnl|CDD|182956 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional. Length = 779 Score = 30.3 bits (69), Expect = 0.12 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 6/57 (10%) Query: 27 RTEDL-LN-KLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERATASRKL 81 R DL LN +L+ N I + N +I+E + + R EA E+ E++ER +L Sbjct: 98 RERDLELNVQLKDN----IAQLNQEIAEREKAEEARQEAFEQLKNEIKEREETQIEL 150 >gnl|CDD|178527 PLN02939, PLN02939, transferase, transferring glycosyl groups. Length = 977 Score = 29.9 bits (67), Expect = 0.19 Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 6/56 (10%) Query: 23 IVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERATAS 78 +V+ + +DL +K+ K EA+ K + + + +VE ++++K +EER AS Sbjct: 321 LVLDQNQDLRDKVDK------LEASLKEANVSKFSSYKVELLQQKLKLLEERLQAS 370 >gnl|CDD|182386 PRK10334, PRK10334, mechanosensitive channel MscS; Provisional. Length = 286 Score = 28.0 bits (62), Expect = 0.67 Identities = 24/120 (20%), Positives = 46/120 (38%), Gaps = 20/120 (16%) Query: 5 ILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAA 64 +L FSTT+ T G IVI + + + S + ++ F I + ++V+ Sbjct: 145 VLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQI 204 Query: 65 EKRVKEVEERATASRKLSV--------------------DELANAFWDLSDEDKNAFTGN 104 + + E+R R+++V +L N +WD+ + K F Sbjct: 205 LTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAA 264 >gnl|CDD|161812 TIGR00308, TRM1, tRNA(guanine-26,N2-N2) methyltransferase. This enzyme is responsible for two methylations of a characteristic guanine of most tRNA molecules. The activity has been demonstrated for eukaryotic and archaeal proteins, which are active when expressed in E. coli, a species that lacks this enzyme. At least one Eubacterium, Aquifex aeolicus, has an ortholog, as do all completed archaeal genomes. Length = 374 Score = 27.5 bits (61), Expect = 0.83 Identities = 12/58 (20%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Query: 62 EAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNAFTGNVKQEVCKVKKITVPP 119 E E+ ++ EE+ +RK V ++ + + + ++ + + V K++VPP Sbjct: 277 EFIEEVLRIAEEKEYGTRK-RVLKMLSLIKNELSDPPGYYSPH---HIASVLKLSVPP 330 >gnl|CDD|180652 PRK06667, motB, flagellar motor protein MotB; Validated. Length = 252 Score = 27.5 bits (61), Expect = 0.90 Identities = 17/91 (18%), Positives = 40/91 (43%), Gaps = 13/91 (14%) Query: 6 LMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQ----ERV 61 +++++F+ T GG + G+ +L N + + E ++S+ + A + Sbjct: 49 IISASFTGTGFFKGGQTLSKGKLSELGNSIMSLPST---EKGKQLSQAKKNASSLFKPEI 105 Query: 62 EAAEKRVKEVEERATASRKLSVDELANAFWD 92 ++ + V E E R L + ++AF+ Sbjct: 106 QSNKVAVTEDE------RGLVISLASDAFFY 130 >gnl|CDD|163537 TIGR03825, FliH_bacil, flagellar assembly protein FliH. This bacillus clade of FliH proteins is not found by the Pfam FliH model pfam02108, but is closely related to the sequences identified by that model. Sequences identified by this model are observed in flagellar operons in an analogous position relative to other flagellar operon genes. Length = 255 Score = 25.9 bits (57), Expect = 2.4 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 17/83 (20%) Query: 43 IKEANFKISETHRLAQERVEAAEKRVKEVEERATASRKLSVDELANAFWDLS-DEDKNAF 101 I EAN + E +E++E+A+ + E+ LA +S EDKNAF Sbjct: 113 IDEANAIVEEAKDDYEEKIESAQPLIIEL-----------ACALAEKVIGVSLAEDKNAF 161 Query: 102 TGNVKQEVCKVK-----KITVPP 119 V+Q + +V+ I V P Sbjct: 162 QALVRQVLSEVREFDEVSIYVHP 184 >gnl|CDD|161889 TIGR00462, genX, lysyl-tRNA synthetase-like protein GenX. Many Gram-negative bacteria have a protein closely homologous to the C-terminal region of lysyl-tRNA synthetase (LysS). Multiple sequence alignment of these proteins with the homologous regions of collected LysS proteins shows that these proteins form a distinct set rather than just similar truncations of LysS. The protein is termed GenX after its designation in E. coli. Interestingly, genX often is located near a homolog of lysine-2,3-aminomutase. Its function is unknown. Length = 304 Score = 25.6 bits (57), Expect = 3.2 Identities = 7/11 (63%), Positives = 9/11 (81%) Query: 85 ELANAFWDLSD 95 ELAN F +L+D Sbjct: 228 ELANGFHELTD 238 >gnl|CDD|179675 PRK03918, PRK03918, chromosome segregation protein; Provisional. Length = 880 Score = 25.8 bits (57), Expect = 3.2 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Query: 29 EDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERA 75 E+L+ + +K ++++E N +IS +E +E EK VKE+EE Sbjct: 192 EELIKEKEKELEEVLREIN-EISSELPELREELEKLEKEVKELEELK 237 >gnl|CDD|184422 PRK13962, PRK13962, bifunctional phosphoglycerate kinase/triosephosphate isomerase; Provisional. Length = 645 Score = 25.5 bits (56), Expect = 3.7 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 18/83 (21%) Query: 37 KNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEER--------ATASRKLSVDELA- 87 KN + I N+K+++T A+E V +K VK+ + A S K +VD Sbjct: 394 KNPRKPIIAGNWKMNKTPAEAKEFVNELKKYVKDAQAEVVVCPPFTALPSVKEAVDGSNI 453 Query: 88 -----NAFWDLSDEDKNAFTGNV 105 N F+ E+K A+TG + Sbjct: 454 KLGAQNVFY----EEKGAYTGEI 472 >gnl|CDD|149170 pfam07946, DUF1682, Protein of unknown function (DUF1682). The members of this family are all hypothetical eukaryotic proteins of unknown function. One member is described as being an adipocyte-specific protein, but no evidence of this was found. Length = 322 Score = 25.3 bits (56), Expect = 3.8 Identities = 14/59 (23%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Query: 28 TEDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERATASRKLSVDEL 86 + ++L K+ K + ++ QE +K K+ EER KLS +E Sbjct: 254 SPEVLRKVDKTREEEEEKIL---KAAEEERQE-EAQEKKEEKKKEEREAKLAKLSPEEQ 308 >gnl|CDD|177394 PHA02562, 46, endonuclease subunit; Provisional. Length = 562 Score = 25.4 bits (56), Expect = 4.1 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Query: 22 DIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERATASRKL 81 D I E+++++ + S + + E KIS + V+ A K+VK E A Sbjct: 319 DTAIDELEEIMDEFNEQSKK-LLELKNKISTNKQSLITLVDKA-KKVKAAIEELQAEFVD 376 Query: 82 SVDELA 87 + +ELA Sbjct: 377 NAEELA 382 >gnl|CDD|181030 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated. Length = 859 Score = 25.1 bits (56), Expect = 4.1 Identities = 12/41 (29%), Positives = 15/41 (36%), Gaps = 16/41 (39%) Query: 57 AQERVEAAEKRVKEVEERAT----------------ASRKL 81 A +E A V VE++ T ASRKL Sbjct: 244 AVAALEGARYSVASVEDKPTTRKPSAPFTTSTLQQEASRKL 284 >gnl|CDD|148033 pfam06188, HrpE, HrpE protein. This family consists of several bacterial HrpE proteins. The exact function of this family is unknown but it is thought that HrpE is involved in the secretion of HrpZ (harpinPss). Length = 191 Score = 25.1 bits (55), Expect = 4.5 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Query: 56 LAQERVEAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNAFTGNVKQE 108 L R +A E+ + EE+A A ++ + ++ AFW + NA +Q+ Sbjct: 36 LEDARQQA-EQILDLAEEKAEALQQRAEEQAEAAFW----QQANALLQEWQQQ 83 >gnl|CDD|184480 PRK14056, PRK14056, phenylalanine 4-monooxygenase; Provisional. Length = 578 Score = 25.0 bits (55), Expect = 4.7 Identities = 10/37 (27%), Positives = 15/37 (40%) Query: 43 IKEANFKISETHRLAQERVEAAEKRVKEVEERATASR 79 +KE+ E A+ RV + V + E SR Sbjct: 169 VKESPTSTPEEVAAAENRVIEKQNLVSGLSEAEQISR 205 >gnl|CDD|152881 pfam12447, DUF3683, Protein of unknown function (DUF3683). This domain family is found in bacteria, and is approximately 120 amino acids in length. The family is found in association with pfam02754, pfam01565, pfam02913. Length = 117 Score = 25.2 bits (56), Expect = 4.9 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Query: 61 VEAAEKRVKEVEERATASRKLSVDELANA 89 EA R+ E+E+RA + + V EL A Sbjct: 80 FEALRHRLDEIEKRANGNER--VLELVAA 106 >gnl|CDD|179009 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed. Length = 782 Score = 24.8 bits (55), Expect = 5.8 Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Query: 27 RTEDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERATASRKL 81 E L +L++ ++ +E + + E + AQ+ ++ A+ KE +E R+L Sbjct: 545 EAEKLKEELEEKKEKLQEEEDKLLEEAEKEAQQAIKEAK---KEADEIIKELRQL 596 >gnl|CDD|129130 TIGR00019, prfA, peptide chain release factor 1. This model describes peptide chain release factor 1 (PrfA, RF-1), and excludes the related peptide chain release factor 2 (PrfB, RF-2). RF-1 helps recognize and terminate translation at UAA and UAG stop codons. The mitochondrial release factors are prfA-like, although not included above the trusted cutoff for this model. RF-1 does not have a translational frameshift. Length = 360 Score = 24.7 bits (54), Expect = 6.7 Identities = 10/39 (25%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Query: 36 QKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEER 74 + I E + E +A+E +E E++++E+EE+ Sbjct: 61 DIKEAKEILEESDP--EMREMAKEELEELEEKIEELEEQ 97 >gnl|CDD|115824 pfam07195, FliD_C, Flagellar hook-associated protein 2 C-terminus. The flagellar hook-associated protein 2 (HAP2 or FliD) forms the distal end of the flagella, and plays a role in mucin specific adhesion of the bacteria. This alignment covers the C-terminal region of this family of proteins. Length = 230 Score = 24.6 bits (54), Expect = 6.9 Identities = 8/54 (14%), Positives = 24/54 (44%) Query: 24 VIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERATA 77 + R +D L + ++ +++ + +++E ++R+ +E R A Sbjct: 163 LAKRLDDSLKPYTGSGNGILASREDSLNKQIKRLNKQIEDLDRRLDTLEARLKA 216 >gnl|CDD|150781 pfam10147, CR6_interact, Growth arrest and DNA-damage-inducible proteins-interacting protein 1. Members of this family of proteins act as negative regulators of G1 to S cell cycle phase progression by inhibiting cyclin-dependent kinases. Inhibitory effects are additive with GADD45 proteins but occur also in the absence of GADD45 proteins. Furthermore, they act as a repressor of the orphan nuclear receptor NR4A1 by inhibiting AB domain-mediated transcriptional activity. Length = 217 Score = 24.4 bits (53), Expect = 7.2 Identities = 11/46 (23%), Positives = 18/46 (39%) Query: 29 EDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEER 74 E + K QMI + + + + A+ E E+ V E E Sbjct: 123 EAEIAKNMAKMPQMIADWRAQKRKREQKARAAKERKERLVAEAREH 168 >gnl|CDD|179068 PRK00566, PRK00566, DNA-directed RNA polymerase subunit beta'; Provisional. Length = 1156 Score = 24.3 bits (54), Expect = 8.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 58 QERVEAAEKRVKEVEE 73 +E +E AEK V E+E+ Sbjct: 629 KEIIEEAEKEVAEIEK 644 >gnl|CDD|185576 PTZ00362, PTZ00362, hypothetical protein; Provisional. Length = 479 Score = 24.3 bits (53), Expect = 8.2 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Query: 22 DIVIGRTEDLLNKL--QKNSTQMIKEANFKISETH 54 DI R + ++N L Q + +I N +ISET+ Sbjct: 408 DIRYKRLKKIMNHLENQDVHSSIIYIDNLQISETY 442 >gnl|CDD|130214 TIGR01144, ATP_synt_b, ATP synthase, F0 subunit b. This model describes the F1/F0 ATP synthase b subunit in bacteria only. Scoring just below the trusted cutoff are the N-terminal domains of Mycobacterial b/delta fusion proteins and a subunit from an archaeon, Methanosarcina barkeri, in which the ATP synthase homolog differs in architecture and is not experimentally confirmed. This model helps resolve b from the related b' subunit. Within the family is an example from a sodium-translocating rather than proton-translocating ATP synthase. Length = 147 Score = 24.3 bits (53), Expect = 8.5 Identities = 14/39 (35%), Positives = 19/39 (48%) Query: 37 KNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERA 75 K + K+A + E AQE +E A KR E+ E A Sbjct: 43 KEAALAQKKAQVILKEAKDEAQEIIENANKRGSEILEEA 81 >gnl|CDD|148887 pfam07529, HSA, HSA. This domain is predicted to bind DNA and is often found associated with helicases. Length = 72 Score = 24.2 bits (53), Expect = 8.7 Identities = 10/52 (19%), Positives = 24/52 (46%), Gaps = 7/52 (13%) Query: 30 DLLNKLQKNSTQMIKEANFKISETHRLAQ-------ERVEAAEKRVKEVEER 74 LL +++ S +E +KI++ +LA+ + ++R + +R Sbjct: 15 HLLEEMKWMSKDFREERKWKIAKAKKLARAVAQYHKYIEKEEQRRKEREAQR 66 >gnl|CDD|162382 TIGR01479, GMP_PMI, mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase. This enzyme is known to be bifunctional, as both mannose-6-phosphate isomerase (EC 5.3.1.8) (PMI) and mannose-1-phosphate guanylyltransferase (EC 2.7.7.22) in Pseudomonas aeruginosa, Xanthomonas campestris, and Gluconacetobacter xylinus. The literature on the enzyme from E. coli attributes mannose-6-phosphate isomerase activity to an adjacent gene, but the present sequence has not been shown to lack the activity. The PMI domain is C-terminal. Length = 468 Score = 24.2 bits (53), Expect = 8.9 Identities = 10/37 (27%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Query: 11 FSTTLL--TIGGCDIVIGRTEDLLNKLQKNSTQMIKE 45 +S + L +G D+V+ T+D + K+ Q +K+ Sbjct: 305 YSESRLVAVVGVEDLVVVETKDAVLVAHKDRVQDVKK 341 >gnl|CDD|180077 PRK05431, PRK05431, seryl-tRNA synthetase; Provisional. Length = 425 Score = 24.3 bits (54), Expect = 9.0 Identities = 12/56 (21%), Positives = 23/56 (41%), Gaps = 7/56 (12%) Query: 25 IGRTEDLLNKLQKNSTQMIK------EANFKISETHRLAQERVEAAEKRVKEVEER 74 E+L + S ++ + +A I+E L E ++A E + E+E Sbjct: 41 QTELEELQAERNALSKEIGQAKRKGEDAEALIAEVKELK-EEIKALEAELDELEAE 95 >gnl|CDD|184697 PRK14475, PRK14475, F0F1 ATP synthase subunit B; Provisional. Length = 167 Score = 24.1 bits (52), Expect = 9.5 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Query: 41 QMIKEANFKISETHRLAQERVEAAEKRVKEVEERATASRKLSVDELA 87 +M EA K+ E + R E AE+++ + E +A A K + +LA Sbjct: 91 RMEAEAKEKLEEQ---IKRRAEMAERKIAQAEAQAAADVKAAAVDLA 134 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.312 0.126 0.337 Gapped Lambda K H 0.267 0.0640 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,799,740 Number of extensions: 100337 Number of successful extensions: 343 Number of sequences better than 10.0: 1 Number of HSP's gapped: 339 Number of HSP's successfully gapped: 76 Length of query: 121 Length of database: 5,994,473 Length adjustment: 81 Effective length of query: 40 Effective length of database: 4,244,225 Effective search space: 169769000 Effective search space used: 169769000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (23.6 bits)