RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780980|ref|YP_003065393.1| hypothetical protein CLIBASIA_04405 [Candidatus Liberibacter asiaticus str. psy62] (121 letters) >d1afra_ a.25.1.2 (A:) delta 9-stearoyl-acyl carrier protein desaturase {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 345 Score = 26.4 bits (58), Expect = 0.84 Identities = 10/31 (32%), Positives = 16/31 (51%) Query: 50 ISETHRLAQERVEAAEKRVKEVEERATASRK 80 +S + AQ+ V R++ +EERA K Sbjct: 298 LSAEGQKAQDYVCRLPPRIRRLEERAQGRAK 328 >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 297 Score = 25.9 bits (55), Expect = 1.1 Identities = 13/65 (20%), Positives = 23/65 (35%) Query: 41 QMIKEANFKISETHRLAQERVEAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNA 100 Q I+ A + + + ++ A + L+ DE+ NA L +A Sbjct: 214 QNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASA 273 Query: 101 FTGNV 105 TG Sbjct: 274 ITGAT 278 >d1mjta_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Staphylococcus aureus [TaxId: 1280]} Length = 346 Score = 25.8 bits (57), Expect = 1.2 Identities = 10/49 (20%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Query: 41 QMIKEANFKISETHRLAQERVEAAEKRVKEVEE--RATASRKLSVDELA 87 + KEA I ++ + KR+ ++E + T + + +EL Sbjct: 1 HLFKEAQAFIENMYKECHYETQIINKRLHDIELEIKETGTYTHTEEELI 49 >d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 329 Score = 24.1 bits (50), Expect = 3.5 Identities = 12/88 (13%), Positives = 28/88 (31%) Query: 18 IGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQERVEAAEKRVKEVEERATA 77 I + + ++ I + + E A + + ++ E+ A Sbjct: 228 INKLNNTYENNTNQNKNRNRHDVHNIMNNSGEKEEKKISASQNYTFIDYAIEYSEKYAPL 287 Query: 78 SRKLSVDELANAFWDLSDEDKNAFTGNV 105 +KL ++ + L + A TG Sbjct: 288 RQKLLSTDIGSVASFLLSRESRAITGQT 315 >d1k9xa_ d.92.1.5 (A:) Thermostable carboxypeptidase 1 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 497 Score = 23.8 bits (51), Expect = 4.9 Identities = 5/25 (20%), Positives = 10/25 (40%) Query: 73 ERATASRKLSVDELANAFWDLSDED 97 ER S ++ +L + D + Sbjct: 368 ERLMVSEEIKAKDLPEMWNDEMERL 392 >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Score = 23.0 bits (49), Expect = 6.6 Identities = 8/48 (16%), Positives = 23/48 (47%) Query: 58 QERVEAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNAFTGNV 105 ++V A + ++++ER + V+++ N+ L + + +G Sbjct: 185 GKKVSADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGG 232 >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Score = 22.7 bits (48), Expect = 8.2 Identities = 6/54 (11%), Positives = 17/54 (31%) Query: 52 ETHRLAQERVEAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNAFTGNV 105 + + + + ++ A R +E+++ L + TG Sbjct: 199 YSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQS 252 >d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Length = 251 Score = 22.6 bits (48), Expect = 8.7 Identities = 6/34 (17%), Positives = 15/34 (44%) Query: 54 HRLAQERVEAAEKRVKEVEERATASRKLSVDELA 87 H + + R+E A + +E E ++++ Sbjct: 3 HHMIEYRIEEAVAKYREFYEFKPVRESAGIEDVK 36 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.312 0.126 0.337 Gapped Lambda K H 0.267 0.0625 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 406,652 Number of extensions: 15967 Number of successful extensions: 59 Number of sequences better than 10.0: 1 Number of HSP's gapped: 59 Number of HSP's successfully gapped: 21 Length of query: 121 Length of database: 2,407,596 Length adjustment: 75 Effective length of query: 46 Effective length of database: 1,377,846 Effective search space: 63380916 Effective search space used: 63380916 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.1 bits)