RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780981|ref|YP_003065394.1| hypothetical protein CLIBASIA_04410 [Candidatus Liberibacter asiaticus str. psy62] (122 letters) >gnl|CDD|151681 pfam11239, DUF3040, Protein of unknown function (DUF3040). Some members in this family of proteins with unknown function are annotated as membrane proteins however this cannot be confirmed. Length = 82 Score = 29.9 bits (68), Expect = 0.19 Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 9/34 (26%) Query: 49 LSEHEKKVIESQENPKKQFSEHEKKETDDPKSAR 82 LSEHE++ +E E + +DPK A Sbjct: 3 LSEHEQRRLEEIE---RALYA------EDPKFAA 27 >gnl|CDD|179754 PRK04156, gltX, glutamyl-tRNA synthetase; Provisional. Length = 567 Score = 27.5 bits (62), Expect = 0.80 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Query: 38 ESLSAENEKKELSEHEKKVIESQENPKKQFSEHEKKETDDPKSARKENIVM 88 SLS E +++ L E +++E +E K+ EKK +A K +VM Sbjct: 59 NSLSLEEQRERLEELAPELLEEEEEKKE-----EKKGLPPLPNAEKGKVVM 104 >gnl|CDD|179778 PRK04195, PRK04195, replication factor C large subunit; Provisional. Length = 482 Score = 26.8 bits (60), Expect = 1.4 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query: 42 AENEKKELSEHEKKVIESQENPKKQFSEHEKKETDDPKSARKENIVMKKTFSQKSKKYTP 101 + ++E E +KK ++ +++ E EKKE + + +E K+ +K KK Sbjct: 420 EKKREEEKKEKKKKAFAGKKKEEEEEEEKEKKEEEK-EEEEEEAEEEKEEEEEKKKKQAT 478 Query: 102 YFD 104 FD Sbjct: 479 LFD 481 >gnl|CDD|150408 pfam09729, Gti1_Pac2, Gti1/Pac2 family. In S. pombe the gti1 protein promotes the onset of gluconate uptake upon glucose starvation. In S. pombe the Pac2 protein controls the onset of sexual development, by inhibiting the expression of ste11, in a pathway that is independent of the cAMP cascade. Length = 150 Score = 26.5 bits (59), Expect = 1.6 Identities = 13/55 (23%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Query: 40 LSAENEKKELSEHEKKVIESQENPKKQFSEHEKKETDDPKSAR-KENIVMKKTFS 93 L N E +K S + S R KE+ ++KKT S Sbjct: 79 LEKPNNPGEKKRSSRKRSLDGSRKAAVGSPNSTLVGSLVDSYRFKEDGLIKKTIS 133 >gnl|CDD|183692 PRK12704, PRK12704, phosphodiesterase; Provisional. Length = 520 Score = 26.3 bits (59), Expect = 2.2 Identities = 12/54 (22%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Query: 46 KKELSEHEKKVIESQENPKKQFSEHEKKETDDPKSARKENIVMKKTFSQKSKKY 99 + EL + EK++++ +EN ++ EK+E ++ + KE ++ +K ++ Sbjct: 81 RNELQKLEKRLLQKEENLDRKLELLEKRE-EELEKKEKELEQKQQELEKKEEEL 133 >gnl|CDD|70841 pfam07390, P30, Mycoplasma P30 protein. This family consists of several P30 proteins which seem to be specific to Mycoplasma agalactiae. P30 is a 30-kDa immunodominant antigen and is known to be a transmembrane protein. Length = 266 Score = 25.9 bits (56), Expect = 2.9 Identities = 30/109 (27%), Positives = 43/109 (39%), Gaps = 20/109 (18%) Query: 24 EDNLKSSPLPHIALESLSAENEKKELSEHEKKVIESQENPKKQ----------------F 67 E N K SP AL L +EN + ++EK + ES E K + F Sbjct: 82 ETNAKESP----ALNDLYSENPATPIFKNEKGIKESSEGSKNEGDKVIAGKEAIYKDIDF 137 Query: 68 SEHEKKETDDPKSARKENIVMKKTFSQKSKKYTPYFDHYMTNGHLNLPQ 116 + K T D K + E+++ K S K + Y D +G L Q Sbjct: 138 DISKVKITIDKKDLKDEDLISPKKGSHKQLFFNTYKDKTKVSGKLEKDQ 186 >gnl|CDD|138835 PRK12279, PRK12279, 50S ribosomal protein L22/unknown domain fusion protein; Provisional. Length = 311 Score = 25.4 bits (55), Expect = 3.4 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 6/70 (8%) Query: 37 LESLSAENEKKELSEHEKKVIESQENPK---KQFSEHEKKETDDPKSARKENIVMK---K 90 L ++ A+ KK L K +E+++ K + EK E DP+ ++E V+K K Sbjct: 119 LAAIKAKKSKKPLPVEPKAKVETKKVAKPSKVEVKPVEKDENVDPELLKREQQVLKVVEK 178 Query: 91 TFSQKSKKYT 100 T SQK ++ T Sbjct: 179 TASQKEEETT 188 >gnl|CDD|178442 PLN02850, PLN02850, aspartate-tRNA ligase. Length = 530 Score = 25.4 bits (56), Expect = 3.5 Identities = 10/70 (14%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Query: 33 PHIALESLSAENEKKELSEHEKKVIESQENPKKQFSEHEKKETDDPKSARKENIVMKKTF 92 A+E + KK + K + + + + ++ DDP ++ ++ +++ Sbjct: 2 SQEAVEESGEKISKKAAKKAAAKAEKLRREATAKAAAASLEDEDDPLASNYGDVPLEELQ 61 Query: 93 SQKS-KKYTP 101 S+ + +++T Sbjct: 62 SKVTGREWTD 71 >gnl|CDD|130874 TIGR01815, TrpE-clade3, anthranilate synthase, alpha proteobacterial clade. This model represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium). This enzyme is the first step in the pathway for the biosynthesis of tryprophan from chorismate. Length = 717 Score = 25.2 bits (55), Expect = 4.3 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Query: 32 LPHIALESLSAENEKKELSEHEKKVIESQENPKKQFSEHEK 72 LP IA E+L L E +V S +P F E E+ Sbjct: 81 LPAIA-EALRGLEALAGLEEAPSRVTASSASPPAPFPEEER 120 >gnl|CDD|181502 PRK08611, PRK08611, pyruvate oxidase; Provisional. Length = 576 Score = 25.0 bits (55), Expect = 4.8 Identities = 11/52 (21%), Positives = 22/52 (42%) Query: 36 ALESLSAENEKKELSEHEKKVIESQENPKKQFSEHEKKETDDPKSARKENIV 87 A ++L E + E + + QEN K + E+ E + + E ++ Sbjct: 314 AKKALHQLTENIKHVEDRRFLEACQENMAKWWKWMEEDENNASTPIKPERVM 365 >gnl|CDD|163068 TIGR02907, spore_VI_D, stage VI sporulation protein D. SpoVID, the stage VI sporulation protein D, is restricted to endospore-forming members of the bacteria, all of which are found among the Firmicutes. It is widely distributed but not quite universal in this group. Between well-conserved N-terminal and C-terminal domains is a poorly conserved, low-complexity region of variable length, rich enough in glutamic acid to cause spurious BLAST search results unless a filter is used. The seed alignment for this model was trimmed, in effect, by choosing member sequences in which these regions are relatively short. SpoVID is involved in spore coat assembly by the mother cell compartment late in the process of sporulation. Length = 338 Score = 25.2 bits (55), Expect = 4.9 Identities = 17/82 (20%), Positives = 33/82 (40%), Gaps = 5/82 (6%) Query: 23 EEDNLKSSPLPHIALESLSAENEKKELSEHEKKVIESQENPKKQFSEHEKKETDDPKSAR 82 EE+ S+ H A E + E E+ + + E + E E P ++ + E ++ Sbjct: 152 EEEESFSAEFEHPAQEETAGEEERTDEPKVEHEAHEQHEQP----ADDDPDEWKI-SASE 206 Query: 83 KENIVMKKTFSQKSKKYTPYFD 104 + + S + + Y Y D Sbjct: 207 PFQLESEVEASPEEENYEEYED 228 >gnl|CDD|149519 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal. This domain is found to the N-terminus of bacterial signal peptidases of the S49 family (pfam01343). Length = 154 Score = 24.8 bits (55), Expect = 6.0 Identities = 15/54 (27%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 49 LSEHEKKVIESQEN---PKKQFSEHEKKETDDPKSARKENIVMKKTFSQKSKKY 99 L+E K + ES E KK+ EK E K+ K K K + + Sbjct: 47 LNEEYKDLKESLEAALLDKKELKAWEKAEKKAEKAKAKAEKKKAKKEEPKPRLF 100 >gnl|CDD|177918 PLN02279, PLN02279, ent-kaur-16-ene synthase. Length = 784 Score = 24.5 bits (53), Expect = 6.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 96 SKKYTPYFDHYMTNGHLN 113 S K TP D YMTN +++ Sbjct: 614 SNKSTPTLDEYMTNAYVS 631 >gnl|CDD|178764 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional. Length = 566 Score = 24.4 bits (53), Expect = 7.8 Identities = 7/23 (30%), Positives = 11/23 (47%) Query: 72 KKETDDPKSARKENIVMKKTFSQ 94 K D PK +EN +++ Q Sbjct: 241 GKVQDLPKGLERENKIIQTIMRQ 263 >gnl|CDD|162113 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger. Length = 1096 Score = 24.2 bits (52), Expect = 7.8 Identities = 11/47 (23%), Positives = 26/47 (55%) Query: 42 AENEKKELSEHEKKVIESQENPKKQFSEHEKKETDDPKSARKENIVM 88 +E E++E E E++ E +E +++ E + P++ +K+ I + Sbjct: 863 SEEEEEEEEEEEEEEEEEEEEEEEEEENEEPLSLEWPETRQKQAIYL 909 >gnl|CDD|129001 smart00762, Cog4, COG4 transport protein. This region is found in yeast oligomeric golgi complex component 4 which is involved in ER to Golgi and intra Golgi transport. Length = 324 Score = 24.2 bits (53), Expect = 8.0 Identities = 6/47 (12%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Query: 66 QFSEHEKKETDDPKSARKENIVMKKTFSQKSKKYTPYFD----HYMT 108 +F+E + ++ + ++ FS K ++ + +Y Sbjct: 205 EFTERSQDPEEEKQEIELPKLLRDSKFSTKIQELLGTYVPLETYYFR 251 >gnl|CDD|150489 pfam09825, BPL_N, Biotin-protein ligase, N terminal. The function of this structural domain is unknown. It is found to the N terminus of the biotin protein ligase catalytic domain. Length = 364 Score = 24.2 bits (53), Expect = 9.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Query: 96 SKKYTPYFDH 105 S K TPYFDH Sbjct: 348 SSKLTPYFDH 357 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.308 0.126 0.350 Gapped Lambda K H 0.267 0.0623 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,851,605 Number of extensions: 97693 Number of successful extensions: 286 Number of sequences better than 10.0: 1 Number of HSP's gapped: 278 Number of HSP's successfully gapped: 74 Length of query: 122 Length of database: 5,994,473 Length adjustment: 82 Effective length of query: 40 Effective length of database: 4,222,617 Effective search space: 168904680 Effective search space used: 168904680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 51 (23.7 bits)