BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780981|ref|YP_003065394.1| hypothetical protein CLIBASIA_04410 [Candidatus Liberibacter asiaticus str. psy62] (122 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780981|ref|YP_003065394.1| hypothetical protein CLIBASIA_04410 [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Score = 250 bits (638), Expect = 7e-69, Method: Compositional matrix adjust. Identities = 122/122 (100%), Positives = 122/122 (100%) Query: 1 MKKYFTILTMLFVSSAINPCGIEEDNLKSSPLPHIALESLSAENEKKELSEHEKKVIESQ 60 MKKYFTILTMLFVSSAINPCGIEEDNLKSSPLPHIALESLSAENEKKELSEHEKKVIESQ Sbjct: 1 MKKYFTILTMLFVSSAINPCGIEEDNLKSSPLPHIALESLSAENEKKELSEHEKKVIESQ 60 Query: 61 ENPKKQFSEHEKKETDDPKSARKENIVMKKTFSQKSKKYTPYFDHYMTNGHLNLPQNNGH 120 ENPKKQFSEHEKKETDDPKSARKENIVMKKTFSQKSKKYTPYFDHYMTNGHLNLPQNNGH Sbjct: 61 ENPKKQFSEHEKKETDDPKSARKENIVMKKTFSQKSKKYTPYFDHYMTNGHLNLPQNNGH 120 Query: 121 RY 122 RY Sbjct: 121 RY 122 >gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 45.8 bits (107), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 13/90 (14%) Query: 1 MKKYFTILTMLFVSSAIN---------PCGIEEDNLKSSPLPHIA--LESLSAENEK--K 47 MKKY T+LT+L +S+ +N P E+ + + P + L L AENEK K Sbjct: 1 MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLK 60 Query: 48 ELSEHEKKVIESQENPKKQFSEHEKKETDD 77 E + +++ EN KK F EHEKK T + Sbjct: 61 EFDKITRELNTLSENEKKAFFEHEKKVTSN 90 >gi|254780537|ref|YP_003064950.1| periplasmic solute binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 294 Score = 30.4 bits (67), Expect = 0.011, Method: Compositional matrix adjust. Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 9/76 (11%) Query: 3 KYFTILT----MLFVSSAINPCGIEED-NLKSSPLPHIALESLSA----ENEKKELSEHE 53 KYFT L ++ V+ INP G+ ED ++ S P PH + +A EN +K L+ + Sbjct: 89 KYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTALD 148 Query: 54 KKVIESQENPKKQFSE 69 + E +++SE Sbjct: 149 PSNAKKYELNAREYSE 164 >gi|254780264|ref|YP_003064677.1| elongation factor G [Candidatus Liberibacter asiaticus str. psy62] Length = 701 Score = 22.3 bits (46), Expect = 2.8, Method: Composition-based stats. Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 90 KTFSQKSKKYTPYFDHY 106 ++ SQ +YT FDHY Sbjct: 664 RSMSQGRGQYTMIFDHY 680 >gi|254780316|ref|YP_003064729.1| phenylalanyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 805 Score = 22.3 bits (46), Expect = 2.8, Method: Composition-based stats. Identities = 10/36 (27%), Positives = 20/36 (55%) Query: 25 DNLKSSPLPHIALESLSAENEKKELSEHEKKVIESQ 60 D +KS PLP +E + ++ + + K+V+ S+ Sbjct: 470 DQIKSEPLPLTQVEDKRNLSLQQSRTRYVKRVLASR 505 >gi|254780612|ref|YP_003065025.1| putative transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 503 Score = 21.2 bits (43), Expect = 6.2, Method: Compositional matrix adjust. Identities = 13/45 (28%), Positives = 28/45 (62%), Gaps = 3/45 (6%) Query: 47 KELSEHEKKVIESQ-ENPKKQFSEHEKKETDDPKSA--RKENIVM 88 ++ ++ E+ +++ + +N K + + KE+D PKS+ KENI + Sbjct: 52 RQFNKLEQAILQVEKQNQKSLHTSKQDKESDIPKSSVTSKENIFL 96 >gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter asiaticus str. psy62] Length = 884 Score = 21.2 bits (43), Expect = 6.3, Method: Composition-based stats. Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 77 DPKSARKENIVMKKTFSQKS 96 D K +K N+V KKT + K+ Sbjct: 3 DNKDNKKSNVVEKKTLTLKT 22 >gi|254780383|ref|YP_003064796.1| endonuclease III [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 20.8 bits (42), Expect = 7.1, Method: Compositional matrix adjust. Identities = 11/39 (28%), Positives = 20/39 (51%) Query: 35 IALESLSAENEKKELSEHEKKVIESQENPKKQFSEHEKK 73 I LSA++ +++ K + E + P+K + EKK Sbjct: 52 IVAVLLSAQSTDVNVNKATKHLFEIADTPQKMLAIGEKK 90 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.308 0.126 0.350 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,151 Number of Sequences: 1233 Number of extensions: 3136 Number of successful extensions: 18 Number of sequences better than 100.0: 14 Number of HSP's better than 100.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of query: 122 length of database: 328,796 effective HSP length: 64 effective length of query: 58 effective length of database: 249,884 effective search space: 14493272 effective search space used: 14493272 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 33 (17.3 bits)