HHsearch alignment for GI: 254780982 and conserved domain: COG0785

>COG0785 CcdA Cytochrome c biogenesis protein [Posttranslational modification, protein turnover, chaperones].
Probab=97.66  E-value=0.0022  Score=34.55  Aligned_cols=193  Identities=10%  Similarity=0.035  Sum_probs=101.3

Q ss_pred             HHHHHHHHHHHHHCCC-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CHHHHHHHHHHHH
Q ss_conf             9999999999994899-----479999999983102889999999997766999999997775530-7478886768999
Q gi|254780982|r    6 WIHFLIFTLIITSAPG-----PGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMGTKFLSQ-LAYTMLIIKFLGV   79 (202)
Q Consensus         6 ~l~~~~~~~~~~~~PG-----P~~~~~i~~~~~~G~~~~~~~~~G~~~g~~~~~~~~~~g~~~l~~-~~~~~~~l~~~G~   79 (202)
T Consensus        13 ~~~aflaGlls~lSPCilpllP~~l~~~~~~~~~~r~~~~~~~l~FvlG~~~vf~~lG~~~~~~~~~~~~~~~~l~~i~g   92 (220)
T COG0785          13 ILLAFLAGLLSFLSPCVLPLLPAYLSYLAGGSLGARKSVLLASLLFVLGFATVFVLLGIGASGLGAFLPLNRLYLRYIAG   92 (220)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999998999818266888899999996100105688999999999999999999999999999999998999999999


Q ss_pred             HHHHHHHHHHHHCCC---CCCC---CCCCCCCCHHHHHHHHHHHHHC-CCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             999999999741246---7787---1013567888999987898632-74257887866676524773339999999999
Q gi|254780982|r   80 AWLIYSAWSAWYSPF---NDLP---LGEIPLSSKSKLFVKGFITDIT-NGKAWAFFMAMVPAYLNMNHYILPQSLILSLT  152 (202)
Q Consensus        80 ~yL~~lg~~~~~~~~---~~~~---~~~~~~~~~~~~f~~G~~v~l~-NPka~~f~~~~~~~fi~~~~~~~~~~~~l~~~  152 (202)
T Consensus        93 i~li~~Gl~~l~~~~~~~~~~~~~~~~~~~~~~~~~~f~lGl~f~~~wtPC~gPil~sil~laa~-~~~-~~~g~~ll~~  170 (220)
T COG0785          93 ILLILLGLLFLGVLRLPLLLRFARFQLKGKSVTALGAFLLGLLFALGWTPCIGPILGSILALAAS-TGS-VVLGALLLAA  170 (220)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCC-HHHHHHHHHH
T ss_conf             99999999999986245665444535124676306788999999999855446799999999974-884-6899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHH--HHHCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999--960513899999999999999999996
Q gi|254780982|r  153 MVSVDAMVLMTFSLICSKLRT--LFSSSKFVKIQNRVSAVVFLLLALRIV  200 (202)
Q Consensus       153 ~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~in~i~g~~li~~ai~l~  200 (202)
T Consensus       171 Y~lGl~lP~~~~~~~~~~~~~~~~~~l~k~~~~i~~~~G~lli~~Gv~ll  220 (220)
T COG0785         171 YALGLALPFLLLALLSGRALKAFSRKLRRHSGAIEIVGGALLILLGLLLL  220 (220)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99998999999999999999988899999763999999999999999739