RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780982|ref|YP_003065395.1| putative homoserine/homoserine lactoneefflux protein [Candidatus Liberibacter asiaticus str. psy62] (202 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 39.5 bits (92), Expect = 5e-04 Identities = 38/204 (18%), Positives = 59/204 (28%), Gaps = 99/204 (48%) Query: 64 LSQLAYTMLIIKFLG---------------------VAWLIYSA--WSAWYS-------- 92 + QLA+ ++ K LG A I W +++ Sbjct: 243 VIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVAIAETDSWESFFVSVRKAITV 302 Query: 93 ------------PFNDLPL---------GE-IP---LSSKSKLFVKGFITDITNGKAWAF 127 P LP E +P LS I+++T Sbjct: 303 LFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPSPMLS----------ISNLT------- 345 Query: 128 FMAMVPAYLN-MNHYILPQSLILSLTMV-SVDAMVLM--TFSL--ICSKLRTL------- 174 V Y+N N + LP + +++V +V+ SL + LR Sbjct: 346 -QEQVQDYVNKTNSH-LPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLD 403 Query: 175 -----FSSSKFVKIQNRVSAVVFL 193 FS K +K NR FL Sbjct: 404 QSRIPFSERK-LKFSNR-----FL 421 >1jb3_A Agrin; neuromuscular junction, interaction coiled-DOIL proteins with globular proteins, OB-fold, TIMP, cell adhesion; 1.60A {Gallus gallus} SCOP: b.40.3.2 PDB: 1pxu_A 1jc7_A Length = 131 Score = 27.6 bits (61), Expect = 2.3 Identities = 15/68 (22%), Positives = 29/68 (42%), Gaps = 9/68 (13%) Query: 95 NDLPLGEIPLSSKSKLFVKGF------ITDITNGKAWAFFMAMVPAYLNMNHYILPQSLI 148 D+ EI L +K+ + GF ++ G FF+ P Y+ H L+ Sbjct: 47 KDIVTHEILLDGGNKVVIGGFGDPLICDNQVSTGDTRIFFVNPAPQYMWPAH---RNELM 103 Query: 149 LSLTMVSV 156 L+ +++ + Sbjct: 104 LNSSLMRI 111 >3g3l_A Putative uncharacterized membrane-associated protein; YP_211325.1, putative membrane-associated protein of unknown function; 2.20A {Bacteroides fragilis nctc 9343} Length = 327 Score = 25.7 bits (56), Expect = 8.4 Identities = 7/26 (26%), Positives = 15/26 (57%) Query: 98 PLGEIPLSSKSKLFVKGFITDITNGK 123 + + +++K ++ G ITD T G+ Sbjct: 3 EVDQATKPAEAKYYIAGTITDATTGQ 28 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.329 0.139 0.426 Gapped Lambda K H 0.267 0.0455 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,646,873 Number of extensions: 68417 Number of successful extensions: 249 Number of sequences better than 10.0: 1 Number of HSP's gapped: 249 Number of HSP's successfully gapped: 7 Length of query: 202 Length of database: 5,693,230 Length adjustment: 88 Effective length of query: 114 Effective length of database: 3,559,758 Effective search space: 405812412 Effective search space used: 405812412 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 54 (25.3 bits)