RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780983|ref|YP_003065396.1| hypothetical protein CLIBASIA_04420 [Candidatus Liberibacter asiaticus str. psy62] (55 letters) >gnl|CDD|146339 pfam03646, FlaG, FlaG protein. Although important for flagella the exact function of this protein is unknown. Length = 108 Score = 25.3 bits (56), Expect = 3.6 Identities = 8/37 (21%), Positives = 17/37 (45%), Gaps = 11/37 (29%) Query: 18 IAEFMKMMFIKNPYSFKNYQARLEFSIPKDSNDLYIK 54 + +F++ + LEFS+ +DS + +K Sbjct: 47 LNKFLQSL-----------NTNLEFSVDEDSGRVVVK 72 >gnl|CDD|34009 COG4287, PqaA, PhoPQ-activated pathogenicity-related protein [General function prediction only]. Length = 507 Score = 24.6 bits (53), Expect = 6.3 Identities = 11/47 (23%), Positives = 23/47 (48%), Gaps = 13/47 (27%) Query: 20 EFMKMMFIKNPYSFKNYQARLEFSIPK-------------DSNDLYI 53 F +++ I +P +++N + +L ++PK DS +LY Sbjct: 306 LFKQLLEIIDPLAYRNTRYQLRLALPKYIVNASGDDFFVPDSANLYY 352 >gnl|CDD|39283 KOG4080, KOG4080, KOG4080, Mitochondrial ribosomal protein L32 [Translation, ribosomal structure and biogenesis]. Length = 176 Score = 24.2 bits (52), Expect = 7.3 Identities = 10/29 (34%), Positives = 14/29 (48%) Query: 6 LCKFCTQTVIGYIAEFMKMMFIKNPYSFK 34 LC +C V +E K M I+ PY + Sbjct: 108 LCDYCYAKVHKETSEIKKKMMIQEPYVGE 136 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.329 0.140 0.420 Gapped Lambda K H 0.267 0.0768 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 662,318 Number of extensions: 23671 Number of successful extensions: 59 Number of sequences better than 10.0: 1 Number of HSP's gapped: 59 Number of HSP's successfully gapped: 6 Length of query: 55 Length of database: 6,263,737 Length adjustment: 28 Effective length of query: 27 Effective length of database: 5,658,685 Effective search space: 152784495 Effective search space used: 152784495 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.0 bits)