RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] (125 letters) >gnl|CDD|35465 KOG0244, KOG0244, KOG0244, Kinesin-like protein [Cytoskeleton]. Length = 913 Score = 29.2 bits (65), Expect = 0.32 Identities = 21/93 (22%), Positives = 33/93 (35%), Gaps = 3/93 (3%) Query: 12 LISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLKEFDKITRELNT 71 + L + RR E+ + AK Y S L AE E ++ ELN Sbjct: 478 ELEKRLAEKEPLTRRK---AYEKAEKSKAKEQYESDSGTLEAEKSPLESERSRLRNELNV 534 Query: 72 LSENEKKAFFEHEKKVTSNLNYNARDRKHNINQ 104 + K E +K+ S + +K +Q Sbjct: 535 FNRLAAKLGEERVQKLKSLETQISLLKKKLSSQ 567 >gnl|CDD|38556 KOG3346, KOG3346, KOG3346, Phosphatidylethanolamine binding protein [General function prediction only]. Length = 185 Score = 26.8 bits (59), Expect = 1.7 Identities = 6/36 (16%), Positives = 12/36 (33%), Gaps = 3/36 (8%) Query: 81 FEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGN 116 + ++ S+ N +F + KY G Sbjct: 128 YRQPGRLDSDEPSPLSRGNFNTRKFAK---KYELGT 160 >gnl|CDD|145378 pfam02191, OLF, Olfactomedin-like domain. Length = 250 Score = 26.4 bits (59), Expect = 2.0 Identities = 14/43 (32%), Positives = 17/43 (39%), Gaps = 11/43 (25%) Query: 81 FEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGYYRNYR 123 F + S L+YN RDRK Y + NGY Y Sbjct: 214 FPNRYGYISMLDYNPRDRK-----------LYAWDNGYQLTYD 245 >gnl|CDD|113603 pfam04837, MbeB_N, MbeB-like, N-term conserved region. This family represents an N-terminal conserved region of MbeB/MobB proteins. These proteins are essential for specific plasmid transfer. Length = 52 Score = 26.2 bits (58), Expect = 2.7 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 6/57 (10%) Query: 46 SRLAQLCAENEKRLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNI 102 S++ L E++ KE + + E K AF +HEK V L + ++ I Sbjct: 2 SKILDLAKTFEQKSKE------QAESTEEMVKSAFEKHEKSVREALKESEKNISDAI 52 >gnl|CDD|32136 COG1953, FUI1, Cytosine/uracil/thiamine/allantoin permeases [Nucleotide transport and metabolism / Coenzyme metabolism]. Length = 497 Score = 25.9 bits (57), Expect = 3.4 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Query: 92 NYNARDRKHNINQFYEARGKYRYGNGYYRNYR 123 + R + N+++ Y G+Y Y G+ N+R Sbjct: 409 YFLVRKGRLNLDELYTEPGEYYYYGGW--NWR 438 >gnl|CDD|38748 KOG3540, KOG3540, KOG3540, Beta amyloid precursor protein [General function prediction only]. Length = 615 Score = 25.8 bits (56), Expect = 3.4 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 6/60 (10%) Query: 56 EKRLKEFDKITRE---LNTLSEN---EKKAFFEHEKKVTSNLNYNARDRKHNINQFYEAR 109 EK K DK+ +E T ++N EK+A +H +K S+L A + + + +EAR Sbjct: 260 EKHRKRMDKVMKEWEEAETQAKNPKAEKQALNQHFQKTVSSLEEEAARERQQLVETHEAR 319 >gnl|CDD|100271 CHL00171, cpcB, phycocyanin beta subunit; Reviewed. Length = 172 Score = 25.7 bits (56), Expect = 3.8 Identities = 11/40 (27%), Positives = 22/40 (55%) Query: 48 LAQLCAENEKRLKEFDKITRELNTLSENEKKAFFEHEKKV 87 L+++ AE KRL +KI +T+ N ++ F + ++ Sbjct: 27 LSKMVAEGNKRLDAVNKINANASTIVTNAARSLFAEQPQL 66 >gnl|CDD|88581 cd05395, RasGAP_RASA4, Ras GTPase activating-like 4 protein (RASAL4), also known as Ca2+ -promoted Ras inactivator (CAPRI), is a member of the GAP1 family. Members of the GAP1 family are characterized by a conserved domain structure comprising N-terminal tandem C2 domains, a highly conserved central RasGAP domain, and a C-terminal pleckstrin-homology domain that is associated with a Bruton's tyrosine kinase motif. RASAL4, like RASAL, is a cytosolic protein that undergoes a rapid translocation to the plasma membrane in response to a receptor-mediated elevation in the concentration of intracellular free Ca2+ ([Ca2+]i). However, unlike RASAL, RASAL4 does not sense oscillations in [Ca2+]i.. Length = 337 Score = 25.4 bits (55), Expect = 4.8 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 24 ARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLKEFDKITRELNTLSENE 76 A+ T G+ + +A AK + L + +LK+F ITR +N E Sbjct: 238 AKAVQTVGNMDTLACRAKEPWMVPLQPAIQQGITQLKDF--ITRLVNCEESEE 288 >gnl|CDD|153278 cd07594, BAR_Endophilin_B, The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Endophilins play roles in synaptic vesicle formation, virus budding, mitochondrial morphology maintenance, receptor-mediated endocytosis inhibition, and endosomal sorting. Endophilins contain an N-terminal N-BAR domain (BAR domain with an additional N-terminal amphipathic helix), followed by a variable region containing proline clusters, and a C-terminal SH3 domain. They are classified into two types, A and B. Vertebrates contain two endophilin-B isoforms. Endophilin-B proteins are cytoplasmic proteins expressed mainly in the heart, placenta, and skeletal muscle. Length = 229 Score = 25.4 bits (56), Expect = 4.8 Identities = 18/77 (23%), Positives = 29/77 (37%), Gaps = 4/77 (5%) Query: 33 EERIATCAKPGYSSRLAQLCAENEKRLKEFDKITREL-NTLSENEKKAFFEHEKKVTSNL 91 EE++ T K Y + L +K +KI ++ L N E + L Sbjct: 4 EEKLGTAEKTEYDAHFENLLQRADKTKVWTEKILKQTEAVLQPN---PNVRVEDFIYEKL 60 Query: 92 NYNARDRKHNINQFYEA 108 + DR N+ Q +A Sbjct: 61 DRKKPDRLSNLEQLGQA 77 >gnl|CDD|35906 KOG0687, KOG0687, KOG0687, 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones]. Length = 393 Score = 25.2 bits (55), Expect = 5.1 Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 45 SSRLAQLCAENEKRLKEFD-KITRELNTLSENE 76 L + NE+++KE D KI L E+E Sbjct: 70 QDLLNSMKKANEEKIKELDEKIEDAEENLGESE 102 >gnl|CDD|31956 COG1770, PtrB, Protease II [Amino acid transport and metabolism]. Length = 682 Score = 25.2 bits (55), Expect = 5.2 Identities = 11/40 (27%), Positives = 17/40 (42%) Query: 58 RLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARD 97 L ++D T E L + E F+ E V+ + A D Sbjct: 389 TLFDYDMATGERTLLKQQEVPGGFDPEDYVSRRIWATADD 428 >gnl|CDD|177216 MTH00160, ND2, NADH dehydrogenase subunit 2; Provisional. Length = 335 Score = 25.2 bits (56), Expect = 5.5 Identities = 6/20 (30%), Positives = 12/20 (60%) Query: 1 MKKYITLLTVLLISNVLNLY 20 LL +L++S+++ LY Sbjct: 264 SNNMFFLLFILIMSSLITLY 283 >gnl|CDD|38845 KOG3639, KOG3639, KOG3639, C2 Ca2+-binding motif-containing protein [General function prediction only]. Length = 1239 Score = 25.1 bits (54), Expect = 5.8 Identities = 13/72 (18%), Positives = 25/72 (34%), Gaps = 5/72 (6%) Query: 54 ENEKRLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYR 113 E +L EF E +E +++A FE +++ +A + E + Sbjct: 192 EEMIKLGEFQLFANEPLKAAERDEEADFEADEE-----ASDAEIKAEIRELIEEHTEEVA 246 Query: 114 YGNGYYRNYRSQ 125 + R Q Sbjct: 247 QKHDELRKSLLQ 258 >gnl|CDD|37571 KOG2360, KOG2360, KOG2360, Proliferation-associated nucleolar protein (NOL1) [Cell cycle control, cell division, chromosome partitioning]. Length = 413 Score = 24.9 bits (54), Expect = 5.8 Identities = 12/44 (27%), Positives = 20/44 (45%) Query: 36 IATCAKPGYSSRLAQLCAENEKRLKEFDKITRELNTLSENEKKA 79 I TCA PG + N+ ++ F++ + TL + K A Sbjct: 218 IDTCAAPGNKTSHLAAIMRNQGKIYAFERDAKRAATLRKLLKIA 261 >gnl|CDD|34786 COG5187, RPN7, 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones]. Length = 412 Score = 25.0 bits (54), Expect = 5.8 Identities = 8/29 (27%), Positives = 16/29 (55%) Query: 45 SSRLAQLCAENEKRLKEFDKITRELNTLS 73 R+ L +NE++++E D+ RE + Sbjct: 81 RGRMNTLLKKNEEKIEELDERIREKEEDN 109 >gnl|CDD|31717 COG1528, Ftn, Ferritin-like protein [Inorganic ion transport and metabolism]. Length = 167 Score = 24.4 bits (53), Expect = 8.4 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 58 RLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLN 92 LK + + ++L E +K EHE+KVTS++N Sbjct: 69 ELKAIEAPPNKFSSLKELFEKTL-EHEQKVTSSIN 102 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.132 0.375 Gapped Lambda K H 0.267 0.0793 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,464,111 Number of extensions: 66162 Number of successful extensions: 260 Number of sequences better than 10.0: 1 Number of HSP's gapped: 260 Number of HSP's successfully gapped: 45 Length of query: 125 Length of database: 6,263,737 Length adjustment: 82 Effective length of query: 43 Effective length of database: 4,491,799 Effective search space: 193147357 Effective search space used: 193147357 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.3 bits)