BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] (125 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 255 bits (651), Expect = 2e-70, Method: Compositional matrix adjust. Identities = 125/125 (100%), Positives = 125/125 (100%) Query: 1 MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLK 60 MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLK Sbjct: 1 MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLK 60 Query: 61 EFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGYYR 120 EFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGYYR Sbjct: 61 EFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGYYR 120 Query: 121 NYRSQ 125 NYRSQ Sbjct: 121 NYRSQ 125 >gi|254781126|ref|YP_003065539.1| hypothetical protein CLIBASIA_05140 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 63.5 bits (153), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 30/49 (61%), Positives = 38/49 (77%) Query: 65 ITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYR 113 ITR + L +++KKAFF HEKKV +LNYNA DRK NI++ Y+AR KYR Sbjct: 18 ITRGVARLPKDQKKAFFRHEKKVADHLNYNAGDRKSNIDKLYKARCKYR 66 >gi|254780981|ref|YP_003065394.1| hypothetical protein CLIBASIA_04410 [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Score = 45.8 bits (107), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 13/90 (14%) Query: 1 MKKYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRLK 60 MKKY T+LT+L +S+ +N P E+ + + P + L L AENEK K Sbjct: 1 MKKYFTILTMLFVSSAIN---------PCGIEEDNLKSSPLPHIA--LESLSAENEK--K 47 Query: 61 EFDKITRELNTLSENEKKAFFEHEKKVTSN 90 E + +++ EN KK F EHEKK T + Sbjct: 48 ELSEHEKKVIESQENPKKQFSEHEKKETDD 77 >gi|254780661|ref|YP_003065074.1| exonuclease I [Candidatus Liberibacter asiaticus str. psy62] Length = 471 Score = 25.0 bits (53), Expect = 0.48, Method: Compositional matrix adjust. Identities = 10/20 (50%), Positives = 15/20 (75%) Query: 70 NTLSENEKKAFFEHEKKVTS 89 +TLSE EK+ + EH KK+ + Sbjct: 410 HTLSEKEKQDWLEHRKKMLT 429 >gi|254780545|ref|YP_003064958.1| metalloprotease [Candidatus Liberibacter asiaticus str. psy62] Length = 647 Score = 23.1 bits (48), Expect = 1.8, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 11/59 (18%) Query: 42 PGYS--------SRLAQLCAENEKRL---KEFDKITRELNTLSENEKKAFFEHEKKVTS 89 PG+S + A + A +RL +EF+ ++ +E A E EKK+T+ Sbjct: 350 PGFSGADLRNLVNEAALMAARRNRRLVTMQEFEDAKDKILMGAERRSTAMTEEEKKITA 408 >gi|254780873|ref|YP_003065286.1| aspartate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 411 Score = 21.9 bits (45), Expect = 4.2, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 31 GSEERIATCAKPGYSSRLAQLCAE 54 G E + A G + RLA+LC + Sbjct: 33 GQEVAMVVSAMSGETDRLAELCRQ 56 >gi|254781158|ref|YP_003065571.1| peptidyl prolyl cis-trans isomerase D signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] Length = 631 Score = 21.2 bits (43), Expect = 6.8, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 19/32 (59%) Query: 46 SRLAQLCAENEKRLKEFDKITRELNTLSENEK 77 ++ ++ E+ KRL+EF + ++ +S EK Sbjct: 378 TKASEKVKEDYKRLEEFLALGTSMDEISRREK 409 >gi|254781107|ref|YP_003065520.1| phosphoglucomutase [Candidatus Liberibacter asiaticus str. psy62] Length = 542 Score = 21.2 bits (43), Expect = 7.3, Method: Composition-based stats. Identities = 10/25 (40%), Positives = 13/25 (52%) Query: 73 SENEKKAFFEHEKKVTSNLNYNARD 97 SE + + FE KK+TS A D Sbjct: 135 SEQQTEDIFEESKKITSYQIIEAND 159 >gi|254780611|ref|YP_003065024.1| RNA polymerase factor sigma-32 [Candidatus Liberibacter asiaticus str. psy62] Length = 302 Score = 20.8 bits (42), Expect = 9.4, Method: Compositional matrix adjust. Identities = 9/31 (29%), Positives = 18/31 (58%) Query: 50 QLCAENEKRLKEFDKITRELNTLSENEKKAF 80 Q+ E E+R + +TR ++ L+ E++ F Sbjct: 213 QVLIEKEERKNRRNMLTRSMSVLNPRERRIF 243 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.132 0.375 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,097 Number of Sequences: 1233 Number of extensions: 2955 Number of successful extensions: 13 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 125 length of database: 328,796 effective HSP length: 64 effective length of query: 61 effective length of database: 249,884 effective search space: 15242924 effective search space used: 15242924 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 33 (17.3 bits)