RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780986|ref|YP_003065399.1| hypothetical protein CLIBASIA_04435 [Candidatus Liberibacter asiaticus str. psy62] (94 letters) >gnl|CDD|34047 COG4325, COG4325, Predicted membrane protein [Function unknown]. Length = 464 Score = 29.2 bits (65), Expect = 0.24 Identities = 7/43 (16%), Positives = 14/43 (32%) Query: 43 AFKKKGSMKKDPTLLLLQGIHDALWDIAKATSALVFLYGASLL 85 A+ + +L + A+W I + +G L Sbjct: 15 AYSVTATSMLVRRKAILDYLQGAVWVIPAFGVVIALGFGFVLS 57 >gnl|CDD|112292 pfam03467, Smg4_UPF3, Smg-4/UPF3 family. This family contains proteins that are involved in nonsense mediated mRNA decay. A process that is triggered by premature stop codons in mRNA. The family includes Smg-4 and UPF3. Length = 176 Score = 26.0 bits (57), Expect = 2.3 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Query: 18 ISIALVYLYIHQHFKKRTKQKKVDIAFKKKGSMKKDPTLL 57 A+V L +Q K +K K D ++GS+++DP + Sbjct: 87 TYPAIVELAPYQKIPKPSK-VKKD---AREGSIEQDPEFM 122 >gnl|CDD|38762 KOG3554, KOG3554, KOG3554, Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics]. Length = 693 Score = 25.8 bits (56), Expect = 2.5 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Query: 62 IHDALWDIAKATSALVFLYGASLLCK 87 +H +D++KA S LV L G +LC+ Sbjct: 258 LHRNNYDLSKAISYLVPL-GGPVLCR 282 >gnl|CDD|36844 KOG1631, KOG1631, KOG1631, Translocon-associated complex TRAP, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]. Length = 261 Score = 25.7 bits (56), Expect = 3.2 Identities = 7/39 (17%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Query: 1 MNSLPLFGWMAGIGCLGISIALVYLYIHQHFKKRTKQKK 39 ++ L+ + G+ L + + Q K +K+ K Sbjct: 182 GETVFLYILLIGLSLLLL------VLSQQFLSKLSKKTK 214 >gnl|CDD|35172 COG5613, COG5613, Uncharacterized conserved protein [Function unknown]. Length = 400 Score = 25.4 bits (55), Expect = 3.9 Identities = 6/18 (33%), Positives = 13/18 (72%) Query: 6 LFGWMAGIGCLGISIALV 23 +FGW++ G L +++ +V Sbjct: 175 IFGWVSAFGSLIVALIMV 192 >gnl|CDD|48387 cd02140, Nitroreductase_4, Nitroreductase-like family 4. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase.. Length = 192 Score = 24.0 bits (52), Expect = 8.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 56 LLLLQGIHDALWDIAKAT 73 ++L H+ LWDI K T Sbjct: 48 VILFGEEHEKLWDIVKDT 65 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.328 0.142 0.451 Gapped Lambda K H 0.267 0.0689 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,162,094 Number of extensions: 50324 Number of successful extensions: 226 Number of sequences better than 10.0: 1 Number of HSP's gapped: 223 Number of HSP's successfully gapped: 20 Length of query: 94 Length of database: 6,263,737 Length adjustment: 62 Effective length of query: 32 Effective length of database: 4,923,979 Effective search space: 157567328 Effective search space used: 157567328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (23.5 bits)