RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780986|ref|YP_003065399.1| hypothetical protein CLIBASIA_04435 [Candidatus Liberibacter asiaticus str. psy62] (94 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 30.3 bits (68), Expect = 0.093 Identities = 20/99 (20%), Positives = 34/99 (34%), Gaps = 39/99 (39%) Query: 3 SLPLFGWMAGIGCLGISIALVYLYIHQHFKKRTKQKKVDIAFKKKGSMKKDPTLL--LL- 59 S PL IG + I +A H+ + K + P L L Sbjct: 237 SCPL------IG-V-IQLA--------HYV---------VTAK---LLGFTPGELRSYLK 268 Query: 60 ------QGIHDALWDIAKATSALVFLYGASLLCKTIIYW 92 QG+ A+ IA+ S F + + T++++ Sbjct: 269 GATGHSQGLVTAVA-IAETDSWESF-FVSVRKAITVLFF 305 >2jx0_A ARF GTPase-activating protein GIT1; paxillin binding domain homologue, ANK repeat, cytoplasm, GTPase activation, metal-binding; NMR {Rattus norvegicus} Length = 135 Score = 24.8 bits (54), Expect = 5.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Query: 57 LLLQGIHDALWDIAKATSALV 77 LL Q + +DIAKA LV Sbjct: 106 LLTQQVIQCAYDIAKAAKQLV 126 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.328 0.142 0.451 Gapped Lambda K H 0.267 0.0415 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 818,441 Number of extensions: 31082 Number of successful extensions: 101 Number of sequences better than 10.0: 1 Number of HSP's gapped: 100 Number of HSP's successfully gapped: 3 Length of query: 94 Length of database: 5,693,230 Length adjustment: 61 Effective length of query: 33 Effective length of database: 4,214,346 Effective search space: 139073418 Effective search space used: 139073418 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)