BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780987|ref|YP_003065400.1| hypothetical protein CLIBASIA_04440 [Candidatus Liberibacter asiaticus str. psy62] (110 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780987|ref|YP_003065400.1| hypothetical protein CLIBASIA_04440 [Candidatus Liberibacter asiaticus str. psy62] gi|254040664|gb|ACT57460.1| hypothetical protein CLIBASIA_04440 [Candidatus Liberibacter asiaticus str. psy62] Length = 110 Score = 225 bits (573), Expect = 2e-57, Method: Compositional matrix adjust. Identities = 110/110 (100%), Positives = 110/110 (100%) Query: 1 MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR 60 MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR Sbjct: 1 MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR 60 Query: 61 KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR 110 KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR Sbjct: 61 KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR 110 >gi|315122913|ref|YP_004063402.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496315|gb|ADR52914.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 261 Score = 114 bits (286), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 58/103 (56%), Positives = 75/103 (72%), Gaps = 1/103 (0%) Query: 1 MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHE-SG 59 MESVLGVN +++PTPNN YYT T LG++L K S ++NK+L GFLL EHE SG Sbjct: 155 MESVLGVNPANTLDIPTPNNSQYYTATALGEQLPVKLSGREINKRLVRLGFLLVEHEPSG 214 Query: 60 RKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESL 102 ++R++LT KG + GGR FD+GKK SDG+IVQ IKW I++ L Sbjct: 215 KRRNILTTKGKELGGRVFDSGKKHSDGSIVQSIKWQENILDIL 257 >gi|315121946|ref|YP_004062435.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495348|gb|ADR51947.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Score = 114 bits (285), Expect = 5e-24, Method: Compositional matrix adjust. Identities = 58/103 (56%), Positives = 75/103 (72%), Gaps = 1/103 (0%) Query: 1 MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHE-SG 59 MESVLGVN +++PTPNN YYT T LG++L K S ++NK+L GFLL EHE SG Sbjct: 156 MESVLGVNPANTLDIPTPNNSQYYTATALGEQLPVKLSGREINKRLVRLGFLLVEHEPSG 215 Query: 60 RKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESL 102 ++R++LT KG + GGR FD+GKK SDG+IVQ IKW I++ L Sbjct: 216 KRRNILTTKGKELGGRVFDSGKKHSDGSIVQSIKWQENILDIL 258 >gi|70731106|ref|YP_260847.1| Sb46 [Pseudomonas fluorescens Pf-5] gi|68345405|gb|AAY93011.1| Sb46 [Pseudomonas fluorescens Pf-5] Length = 268 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 41/109 (37%), Positives = 58/109 (53%), Gaps = 11/109 (10%) Query: 1 MESVLGVNVLQDI---NLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEH- 56 ++S +GV++++ L + +TPT+LG K SA +NK L + G L+ H Sbjct: 145 VKSAIGVDLMEMAGVKRLVNESQEMNFTPTELGAKFGI--SAASMNKLLADCG--LQHHV 200 Query: 57 --ESGRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLA 103 + G+KR +TP G K DTGKK SDG VQQI W + E LA Sbjct: 201 IYKPGKKRWEVTPDG-KLFAVITDTGKKHSDGKPVQQILWKESVQEMLA 248 >gi|255957559|dbj|BAH96620.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957564|dbj|BAH96624.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957569|dbj|BAH96628.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957574|dbj|BAH96632.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957579|dbj|BAH96636.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957584|dbj|BAH96640.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957594|dbj|BAH96648.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 100 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 29/89 (32%), Positives = 49/89 (55%), Gaps = 4/89 (4%) Query: 14 NLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGG 73 +LP+ +N Y T T++G++L SA +NK L + GF + G + TPKG + G Sbjct: 5 HLPSSDNDEYLTVTEIGERLNPPFSARCLNKLLLQLGFQINNLLGGYRP---TPKGEERG 61 Query: 74 GRYFDTGKKRSDGTIVQQIKWHPPIVESL 102 G+ D + +G+ QQ+KW+ ++ S Sbjct: 62 GKMCDVPMQHVEGS-TQQLKWNSNLLVSF 89 >gi|168495146|ref|YP_001686884.1| hypothetical protein APCd_gp43 [Azospirillum phage Cd] gi|168148905|emb|CAO99369.1| hypothetical protein [Azospirillum phage Cd] Length = 325 Score = 43.5 bits (101), Expect = 0.009, Method: Compositional matrix adjust. Identities = 32/96 (33%), Positives = 44/96 (45%), Gaps = 1/96 (1%) Query: 15 LPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGG 74 L P +PT +G KL K S I VN L + GF +S + K Sbjct: 228 LVAPQQEDDLSPTDIGVKLGGK-SGIAVNNLLAQNGFQTGWRDSKNRPHWEPTDKGKPFA 286 Query: 75 RYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR 110 + DT KK SDGT V+Q++W I+ +L E G + Sbjct: 287 VWKDTAKKHSDGTPVRQLRWSAGIIRALETEIGNAK 322 >gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] gi|254039802|gb|ACT56598.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] gi|317120696|gb|ADV02519.1| putative Bro-N family phage antirepressor [Liberibacter phage SC1] gi|317120739|gb|ADV02561.1| putative Bro-N family phage antirepressor [Liberibacter phage SC2] gi|317120800|gb|ADV02621.1| putative Bro-N family phage antirepressor [Liberibacter phage SC2] gi|317120840|gb|ADV02661.1| putative Bro-N family phage antirepressor [Liberibacter phage SC1] Length = 262 Score = 42.7 bits (99), Expect = 0.017, Method: Compositional matrix adjust. Identities = 31/102 (30%), Positives = 55/102 (53%), Gaps = 7/102 (6%) Query: 4 VLGVNVLQDIN---LPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR 60 + GV+ L+ ++ LP+ +N Y T TQ+G++L A +NK L + G + + G Sbjct: 154 ITGVDQLEAMDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGY 213 Query: 61 KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESL 102 + TPKG + GG+ D + +G+ QQ+KW+ ++ S Sbjct: 214 RP---TPKGEERGGKMCDVPMQHVEGS-TQQLKWNSNLLVSF 251 >gi|158340951|ref|YP_001522118.1| KilA domain-containing protein [Acaryochloris marina MBIC11017] gi|158311192|gb|ABW32804.1| KilA-N domain family protein [Acaryochloris marina MBIC11017] Length = 282 Score = 42.0 bits (97), Expect = 0.029, Method: Compositional matrix adjust. Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 6/81 (7%) Query: 24 YTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR-KRDVLTPKGA-KGGGRYFDTGK 81 YTPT+LG+ L K SAI+VNK L G+ ES R R+VL K K G T + Sbjct: 193 YTPTELGQLLEPKLSAIRVNKLLEAAGY----QESYRTARNVLKWKPIDKAGDLAVITLE 248 Query: 82 KRSDGTIVQQIKWHPPIVESL 102 ++S+G ++ ++W +V+ L Sbjct: 249 EKSNGKPIESLRWKHSVVDVL 269 >gi|315122933|ref|YP_004063422.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496335|gb|ADR52934.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 264 Score = 41.6 bits (96), Expect = 0.037, Method: Compositional matrix adjust. Identities = 31/99 (31%), Positives = 53/99 (53%), Gaps = 6/99 (6%) Query: 4 VLGVNVLQ--DI-NLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR 60 + GV+ L+ DI +L +P+N Y TPT +G+ L A +N + G + +H Sbjct: 155 ITGVDQLEVMDIKHLLSPDNDEYLTPTAIGELLNPVIKAKALNSWMTYLGLQISKHTG-- 212 Query: 61 KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIV 99 K + TPKG + GG+ D + +G+ Q +KW+P ++ Sbjct: 213 KGYIPTPKGEELGGKMCDVPLQHVEGS-TQSLKWNPKVI 250 >gi|255957589|dbj|BAH96644.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957604|dbj|BAH96656.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 100 Score = 41.6 bits (96), Expect = 0.038, Method: Compositional matrix adjust. Identities = 28/89 (31%), Positives = 48/89 (53%), Gaps = 4/89 (4%) Query: 14 NLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGG 73 +LP+ +N Y T TQ+G++L A +NK L + G + + G + TPKG + G Sbjct: 5 HLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGY---IPTPKGEEYG 61 Query: 74 GRYFDTGKKRSDGTIVQQIKWHPPIVESL 102 G+ D + +G+ QQ+KW+ ++ S Sbjct: 62 GKMCDVPMQHVEGS-TQQLKWNSNLLVSF 89 >gi|299530348|ref|ZP_07043773.1| hypothetical protein CTS44_06218 [Comamonas testosteroni S44] gi|298721719|gb|EFI62651.1| hypothetical protein CTS44_06218 [Comamonas testosteroni S44] Length = 255 Score = 41.6 bits (96), Expect = 0.040, Method: Compositional matrix adjust. Identities = 28/77 (36%), Positives = 36/77 (46%), Gaps = 7/77 (9%) Query: 23 YYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTGKK 82 +YTPT+LGK + SA N L E G ++ E D K R FDTGKK Sbjct: 176 WYTPTELGKVIG--ASARGTNLLLAEAGLQMKLGEKWEATD-----AGKDFCRLFDTGKK 228 Query: 83 RSDGTIVQQIKWHPPIV 99 G V Q+KW ++ Sbjct: 229 HGSGVSVTQMKWSRTVI 245 >gi|315121965|ref|YP_004062454.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495367|gb|ADR51966.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 263 Score = 40.8 bits (94), Expect = 0.060, Method: Compositional matrix adjust. Identities = 31/99 (31%), Positives = 53/99 (53%), Gaps = 6/99 (6%) Query: 4 VLGVNVLQ--DI-NLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR 60 + GV+ L+ DI +L +P+N Y PT++GK L A +N L G + +H + Sbjct: 154 ITGVDQLEVMDIKHLLSPDNDEYLAPTEIGKSLNPVIKAKALNSWLTYLGLQIPKH--TK 211 Query: 61 KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIV 99 K + TPKG + GG+ D + +G+ +KW+P ++ Sbjct: 212 KGFLPTPKGEELGGKMCDVALQHVEGS-TPYLKWNPKVI 249 >gi|255957554|dbj|BAH96616.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957599|dbj|BAH96652.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957609|dbj|BAH96660.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957614|dbj|BAH96664.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957619|dbj|BAH96668.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957624|dbj|BAH96672.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957629|dbj|BAH96676.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957634|dbj|BAH96680.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957639|dbj|BAH96684.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957644|dbj|BAH96688.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957649|dbj|BAH96692.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957654|dbj|BAH96696.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957659|dbj|BAH96700.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957664|dbj|BAH96704.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957669|dbj|BAH96708.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957674|dbj|BAH96712.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957679|dbj|BAH96716.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957684|dbj|BAH96720.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 100 Score = 38.5 bits (88), Expect = 0.33, Method: Compositional matrix adjust. Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 5/94 (5%) Query: 14 NLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGG 73 +LP+ +N Y T TQ+G++L A +NK L + G + + G + TPKG + G Sbjct: 5 HLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGY---IPTPKGEEYG 61 Query: 74 GRYFDTGKKRSDGTIVQQIKWHPP-IVESLAPEF 106 G+ D +G+ Q +KW+ +V L EF Sbjct: 62 GKMCDVPMHHVEGS-TQSLKWNSSLLVPYLQNEF 94 >gi|262392599|ref|YP_003284453.1| lipid A biosynthesis lauroyl acyltransferase [Vibrio sp. Ex25] gi|262336193|gb|ACY49988.1| lipid A biosynthesis lauroyl acyltransferase [Vibrio sp. Ex25] Length = 316 Score = 33.9 bits (76), Expect = 7.6, Method: Compositional matrix adjust. Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Query: 4 VLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLR--EWGFLLEEHESGRK 61 V G + N P N + Y+ T G KL + K+ + LR E F L +H+ GRK Sbjct: 153 VAGYGAFRPHNNPAYNFIQYWGRTHNGNKLIDRKDVKKMIRVLRSGERLFYLPDHDYGRK 212 Query: 62 RDVLTP 67 + V P Sbjct: 213 KSVFVP 218 >gi|269965908|ref|ZP_06180001.1| lipid A biosynthesis lauroyl acyltransferase [Vibrio alginolyticus 40B] gi|269829461|gb|EEZ83702.1| lipid A biosynthesis lauroyl acyltransferase [Vibrio alginolyticus 40B] Length = 316 Score = 33.9 bits (76), Expect = 7.8, Method: Compositional matrix adjust. Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Query: 4 VLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLR--EWGFLLEEHESGRK 61 V G + N P N + Y+ T G KL + K+ + LR E F L +H+ GRK Sbjct: 153 VAGYGAFRPHNNPAYNFIQYWGRTHNGNKLIDRKDVKKMIRVLRSGERLFYLPDHDYGRK 212 Query: 62 RDVLTP 67 + V P Sbjct: 213 KSVFVP 218 >gi|91225017|ref|ZP_01260276.1| lipid A biosynthesis lauroyl acyltransferase [Vibrio alginolyticus 12G01] gi|91190263|gb|EAS76533.1| lipid A biosynthesis lauroyl acyltransferase [Vibrio alginolyticus 12G01] Length = 316 Score = 33.9 bits (76), Expect = 8.6, Method: Compositional matrix adjust. Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Query: 4 VLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLR--EWGFLLEEHESGRK 61 V G + N P N + Y+ T G KL + K+ + LR E F L +H+ GRK Sbjct: 153 VAGYGAFRPHNNPAYNFIQYWGRTHNGNKLIDRKDVKKMIRVLRSGERLFYLPDHDYGRK 212 Query: 62 RDVLTP 67 + V P Sbjct: 213 KSVFVP 218 Searching..................................................done Results from round 2 >gi|254780987|ref|YP_003065400.1| hypothetical protein CLIBASIA_04440 [Candidatus Liberibacter asiaticus str. psy62] gi|254040664|gb|ACT57460.1| hypothetical protein CLIBASIA_04440 [Candidatus Liberibacter asiaticus str. psy62] Length = 110 Score = 181 bits (460), Expect = 2e-44, Method: Composition-based stats. Identities = 110/110 (100%), Positives = 110/110 (100%) Query: 1 MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR 60 MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR Sbjct: 1 MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR 60 Query: 61 KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR 110 KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR Sbjct: 61 KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR 110 >gi|315122913|ref|YP_004063402.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496315|gb|ADR52914.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 261 Score = 161 bits (407), Expect = 3e-38, Method: Composition-based stats. Identities = 57/103 (55%), Positives = 74/103 (71%), Gaps = 1/103 (0%) Query: 1 MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHES-G 59 MESVLGVN +++PTPNN YYT T LG++L K S ++NK+L GFLL EHE G Sbjct: 155 MESVLGVNPANTLDIPTPNNSQYYTATALGEQLPVKLSGREINKRLVRLGFLLVEHEPSG 214 Query: 60 RKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESL 102 ++R++LT KG + GGR FD+GKK SDG+IVQ IKW I++ L Sbjct: 215 KRRNILTTKGKELGGRVFDSGKKHSDGSIVQSIKWQENILDIL 257 >gi|315121946|ref|YP_004062435.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495348|gb|ADR51947.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Score = 160 bits (405), Expect = 5e-38, Method: Composition-based stats. Identities = 57/103 (55%), Positives = 74/103 (71%), Gaps = 1/103 (0%) Query: 1 MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHES-G 59 MESVLGVN +++PTPNN YYT T LG++L K S ++NK+L GFLL EHE G Sbjct: 156 MESVLGVNPANTLDIPTPNNSQYYTATALGEQLPVKLSGREINKRLVRLGFLLVEHEPSG 215 Query: 60 RKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESL 102 ++R++LT KG + GGR FD+GKK SDG+IVQ IKW I++ L Sbjct: 216 KRRNILTTKGKELGGRVFDSGKKHSDGSIVQSIKWQENILDIL 258 >gi|70731106|ref|YP_260847.1| Sb46 [Pseudomonas fluorescens Pf-5] gi|68345405|gb|AAY93011.1| Sb46 [Pseudomonas fluorescens Pf-5] Length = 268 Score = 138 bits (347), Expect = 3e-31, Method: Composition-based stats. Identities = 41/109 (37%), Positives = 58/109 (53%), Gaps = 11/109 (10%) Query: 1 MESVLGVNVLQDI---NLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEH- 56 ++S +GV++++ L + +TPT+LG K SA +NK L + G L+ H Sbjct: 145 VKSAIGVDLMEMAGVKRLVNESQEMNFTPTELGAKFGI--SAASMNKLLADCG--LQHHV 200 Query: 57 --ESGRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLA 103 + G+KR +TP G K DTGKK SDG VQQI W + E LA Sbjct: 201 IYKPGKKRWEVTPDG-KLFAVITDTGKKHSDGKPVQQILWKESVQEMLA 248 >gi|168495146|ref|YP_001686884.1| hypothetical protein APCd_gp43 [Azospirillum phage Cd] gi|168148905|emb|CAO99369.1| hypothetical protein [Azospirillum phage Cd] Length = 325 Score = 71.3 bits (173), Expect = 4e-11, Method: Composition-based stats. Identities = 37/109 (33%), Positives = 53/109 (48%), Gaps = 6/109 (5%) Query: 6 GVNVLQDI---NLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRK- 61 G++ L+ + L P +PT +G KL K S I VN L + GF +S + Sbjct: 216 GIDPLEMLGAQQLVAPQQEDDLSPTDIGVKLGGK-SGIAVNNLLAQNGFQTGWRDSKNRP 274 Query: 62 RDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR 110 T KG K + DT KK SDGT V+Q++W I+ +L E G + Sbjct: 275 HWEPTDKG-KPFAVWKDTAKKHSDGTPVRQLRWSAGIIRALETEIGNAK 322 >gi|299530348|ref|ZP_07043773.1| hypothetical protein CTS44_06218 [Comamonas testosteroni S44] gi|298721719|gb|EFI62651.1| hypothetical protein CTS44_06218 [Comamonas testosteroni S44] Length = 255 Score = 60.1 bits (144), Expect = 9e-08, Method: Composition-based stats. Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 11/101 (10%) Query: 7 VNVLQDI---NLPTPNNL-PYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKR 62 +N++Q + +L + +YTPT+LGK + SA N L E G ++ E + Sbjct: 156 INLMQQLGHTHLEAESQEGQWYTPTELGKVIGA--SARGTNLLLAEAGLQMKLGE----K 209 Query: 63 DVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLA 103 T G R FDTGKK G V Q+KW ++ L Sbjct: 210 WEATDAGKD-FCRLFDTGKKHGSGVSVTQMKWSRTVIPLLG 249 >gi|315122933|ref|YP_004063422.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496335|gb|ADR52934.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 264 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 29/102 (28%), Positives = 53/102 (51%), Gaps = 6/102 (5%) Query: 1 MESVLGVNVLQDIN---LPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHE 57 + + GV+ L+ ++ L +P+N Y TPT +G+ L A +N + G + +H Sbjct: 152 VTKITGVDQLEVMDIKHLLSPDNDEYLTPTAIGELLNPVIKAKALNSWMTYLGLQISKHT 211 Query: 58 SGRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIV 99 K + TPKG + GG+ D + +G+ Q +KW+P ++ Sbjct: 212 G--KGYIPTPKGEELGGKMCDVPLQHVEGS-TQSLKWNPKVI 250 >gi|255957559|dbj|BAH96620.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957564|dbj|BAH96624.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957569|dbj|BAH96628.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957574|dbj|BAH96632.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957579|dbj|BAH96636.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957584|dbj|BAH96640.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957594|dbj|BAH96648.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 100 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 4/90 (4%) Query: 10 LQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKG 69 + +LP+ +N Y T T++G++L SA +NK L + GF + G + TPKG Sbjct: 1 MDIKHLPSSDNDEYLTVTEIGERLNPPFSARCLNKLLLQLGFQINNLLGGYRP---TPKG 57 Query: 70 AKGGGRYFDTGKKRSDGTIVQQIKWHPPIV 99 + GG+ D + +G+ QQ+KW+ ++ Sbjct: 58 EERGGKMCDVPMQHVEGS-TQQLKWNSNLL 86 >gi|315121965|ref|YP_004062454.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495367|gb|ADR51966.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 263 Score = 56.6 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 29/102 (28%), Positives = 53/102 (51%), Gaps = 6/102 (5%) Query: 1 MESVLGVNVLQDIN---LPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHE 57 + + GV+ L+ ++ L +P+N Y PT++GK L A +N L G + +H Sbjct: 151 VTKITGVDQLEVMDIKHLLSPDNDEYLAPTEIGKSLNPVIKAKALNSWLTYLGLQIPKHT 210 Query: 58 SGRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIV 99 +K + TPKG + GG+ D + +G+ +KW+P ++ Sbjct: 211 --KKGFLPTPKGEELGGKMCDVALQHVEGS-TPYLKWNPKVI 249 >gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] gi|254039802|gb|ACT56598.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] gi|317120696|gb|ADV02519.1| putative Bro-N family phage antirepressor [Liberibacter phage SC1] gi|317120739|gb|ADV02561.1| putative Bro-N family phage antirepressor [Liberibacter phage SC2] gi|317120800|gb|ADV02621.1| putative Bro-N family phage antirepressor [Liberibacter phage SC2] gi|317120840|gb|ADV02661.1| putative Bro-N family phage antirepressor [Liberibacter phage SC1] Length = 262 Score = 56.3 bits (134), Expect = 1e-06, Method: Composition-based stats. Identities = 30/102 (29%), Positives = 55/102 (53%), Gaps = 7/102 (6%) Query: 1 MESVLGVNVLQDIN---LPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHE 57 + + GV+ L+ ++ LP+ +N Y T TQ+G++L A +NK L + G + + Sbjct: 151 VTKITGVDQLEAMDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVS 210 Query: 58 SGRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIV 99 G + TPKG + GG+ D + +G+ QQ+KW+ ++ Sbjct: 211 GGYRP---TPKGEERGGKMCDVPMQHVEGS-TQQLKWNSNLL 248 >gi|255957589|dbj|BAH96644.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957604|dbj|BAH96656.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 100 Score = 53.2 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 4/90 (4%) Query: 10 LQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKG 69 + +LP+ +N Y T TQ+G++L A +NK L + G + + G + TPKG Sbjct: 1 MDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGG---YIPTPKG 57 Query: 70 AKGGGRYFDTGKKRSDGTIVQQIKWHPPIV 99 + GG+ D + +G+ QQ+KW+ ++ Sbjct: 58 EEYGGKMCDVPMQHVEGS-TQQLKWNSNLL 86 >gi|158340951|ref|YP_001522118.1| KilA domain-containing protein [Acaryochloris marina MBIC11017] gi|158311192|gb|ABW32804.1| KilA-N domain family protein [Acaryochloris marina MBIC11017] Length = 282 Score = 52.8 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 32/87 (36%), Positives = 47/87 (54%), Gaps = 6/87 (6%) Query: 18 PNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRK-RDVLTPKG-AKGGGR 75 P YTPT+LG+ L K SAI+VNK L G+ ES R R+VL K K G Sbjct: 187 PPEEQTYTPTELGQLLEPKLSAIRVNKLLEAAGY----QESYRTARNVLKWKPIDKAGDL 242 Query: 76 YFDTGKKRSDGTIVQQIKWHPPIVESL 102 T +++S+G ++ ++W +V+ L Sbjct: 243 AVITLEEKSNGKPIESLRWKHSVVDVL 269 >gi|255957554|dbj|BAH96616.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957599|dbj|BAH96652.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957609|dbj|BAH96660.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957614|dbj|BAH96664.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957619|dbj|BAH96668.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957624|dbj|BAH96672.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957629|dbj|BAH96676.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957634|dbj|BAH96680.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957639|dbj|BAH96684.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957644|dbj|BAH96688.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957649|dbj|BAH96692.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957654|dbj|BAH96696.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957659|dbj|BAH96700.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957664|dbj|BAH96704.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957669|dbj|BAH96708.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957674|dbj|BAH96712.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957679|dbj|BAH96716.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|255957684|dbj|BAH96720.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 100 Score = 51.2 bits (121), Expect = 4e-05, Method: Composition-based stats. Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 4/90 (4%) Query: 10 LQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKG 69 + +LP+ +N Y T TQ+G++L A +NK L + G + + G + TPKG Sbjct: 1 MDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGG---YIPTPKG 57 Query: 70 AKGGGRYFDTGKKRSDGTIVQQIKWHPPIV 99 + GG+ D +G+ Q +KW+ ++ Sbjct: 58 EEYGGKMCDVPMHHVEGS-TQSLKWNSSLL 86 >gi|148747758|ref|YP_001285837.1| hypothetical protein GBVE2_gp031 [Geobacillus virus E2] gi|113715700|gb|ABI36849.1| hypothetical protein [Geobacillus virus E2] Length = 274 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 28/96 (29%), Positives = 40/96 (41%), Gaps = 7/96 (7%) Query: 14 NLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGG 73 L + TPTQ+GK S +VNK L+ G L+ G V T +G K Sbjct: 184 RLTEEFEMQLVTPTQIGKMFEPAISGKEVNKLLQRAG--LQWRVGGE--WVPTAEGKKYS 239 Query: 74 GRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGV 109 + G +V Q+KW + E + E GG+ Sbjct: 240 S---SEPIQLESGKMVYQLKWQRRVKEIIQAEMGGI 272 >gi|261418075|ref|YP_003251757.1| phage regulatory protein, Rha family [Geobacillus sp. Y412MC61] gi|319767966|ref|YP_004133467.1| phage regulatory protein, Rha family [Geobacillus sp. Y412MC52] gi|261374532|gb|ACX77275.1| phage regulatory protein, Rha family [Geobacillus sp. Y412MC61] gi|317112832|gb|ADU95324.1| phage regulatory protein, Rha family [Geobacillus sp. Y412MC52] Length = 259 Score = 43.9 bits (102), Expect = 0.006, Method: Composition-based stats. Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 7/92 (7%) Query: 14 NLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGG 73 + + TPTQ+GK S +VNK L++ G L+ G V T +G K Sbjct: 169 RMTEEFEMQLVTPTQIGKMFEPALSGKEVNKLLQKAG--LQWRVGGE--WVATVEGKKYS 224 Query: 74 GRYFDTGKKRSDGTIVQQIKWHPPIVESLAPE 105 + G +V Q+KW + + + E Sbjct: 225 S---SEPIQLESGKMVYQLKWQRRVKDIIQAE 253 >gi|304436872|ref|ZP_07396836.1| phage antirepressor protein [Selenomonas sp. oral taxon 149 str. 67H29BP] gi|304370071|gb|EFM23732.1| phage antirepressor protein [Selenomonas sp. oral taxon 149 str. 67H29BP] Length = 250 Score = 42.8 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 27/104 (25%), Positives = 43/104 (41%), Gaps = 12/104 (11%) Query: 1 MESVLGVNVLQDINL--PTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHES 58 +E GV + + L P ++ + PT +G KL SA N L+ G + + Sbjct: 156 IERAYGVEMPEVKELIPPAEHDTGFLNPTAIGAKLGI--SAKDTNLLLKNAGLQM---KI 210 Query: 59 GRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESL 102 G++ +T KG G S QI+W+ +VE L Sbjct: 211 GKE-WRITNKGKNYGEEMPYERNGHSG----YQIRWNESVVEVL 249 >gi|255021965|ref|ZP_05293973.1| Phage antirepressor protein [Acidithiobacillus caldus ATCC 51756] gi|254968601|gb|EET26155.1| Phage antirepressor protein [Acidithiobacillus caldus ATCC 51756] Length = 307 Score = 41.6 bits (96), Expect = 0.036, Method: Composition-based stats. Identities = 20/98 (20%), Positives = 35/98 (35%), Gaps = 8/98 (8%) Query: 9 VLQDINLPTPNNLPYYTPTQLGKKLAT-----KPSAIKVNKKLREWGFLLEEHESGRK-R 62 + + LP P+ PT + ++ K VN+ L + GF + H G Sbjct: 179 PPEALALPCPHQEVELRPTDIARRFGVVYASGKEDGATVNRILADLGF--QTHTKGEPLD 236 Query: 63 DVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVE 100 T KG + G ++Q+ W ++E Sbjct: 237 WTPTDKGWPFAVVKEVPNRSLKAGRTIRQLFWRIGLIE 274 >gi|91222966|ref|ZP_01258232.1| hypothetical protein V12G01_03966 [Vibrio alginolyticus 12G01] gi|269964775|ref|ZP_06179012.1| hypothetical protein VMC_04420 [Vibrio alginolyticus 40B] gi|91191779|gb|EAS78042.1| hypothetical protein V12G01_03966 [Vibrio alginolyticus 12G01] gi|269830435|gb|EEZ84657.1| hypothetical protein VMC_04420 [Vibrio alginolyticus 40B] Length = 288 Score = 38.9 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 13/84 (15%) Query: 17 TPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRY 76 TP++ + TQLG+KL K +A ++N+ L E G+L + E +T G + G Sbjct: 72 TPSSGKTLSATQLGEKL--KLNAKRMNQLLSELGWLTKSEEG----WSVTEAGVRAG--- 122 Query: 77 FDTGKKRSDGTIVQQ-IKWHPPIV 99 G++R+D + WH ++ Sbjct: 123 ---GQQRTDKETQNTFVVWHDVVL 143 >gi|163841473|ref|YP_001625878.1| transcriptional regulator, ArsR family protein [Renibacterium salmoninarum ATCC 33209] gi|162954949|gb|ABY24464.1| transcriptional regulator, ArsR family protein [Renibacterium salmoninarum ATCC 33209] Length = 189 Score = 37.0 bits (84), Expect = 0.82, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Query: 24 YTPTQLGKKLATKPSAIKVN-KKLREWGFLLE--EHESGR-KRDVLTPKGAKGGGRYFDT 79 YT T+L + PSA+ + + L +WG+L E E GR +R GG Y + Sbjct: 39 YTATELANRFGGTPSAMSYHLRALEKWGYLKRSSESEDGRERRWRAAADSLNVGGNYDEA 98 Query: 80 G 80 G Sbjct: 99 G 99 >gi|156978198|ref|YP_001449104.1| hypothetical protein VIBHAR_07003 [Vibrio harveyi ATCC BAA-1116] gi|156529792|gb|ABU74877.1| hypothetical protein VIBHAR_07003 [Vibrio harveyi ATCC BAA-1116] Length = 276 Score = 36.6 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 11/76 (14%) Query: 24 YTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTGKKR 83 Y+ TQLG+KL K +A ++N+ L E G++ + E LT G + GG+ K Sbjct: 67 YSATQLGEKL--KLNAKRMNQLLSELGWISKSEEG----WSLTEAGIRAGGQ--QRTDKE 118 Query: 84 SDGTIVQQIKWHPPIV 99 S T V WH ++ Sbjct: 119 SQNTFV---VWHDVVL 131 >gi|269959510|ref|ZP_06173892.1| conserved hypothetical protein [Vibrio harveyi 1DA3] gi|269835697|gb|EEZ89774.1| conserved hypothetical protein [Vibrio harveyi 1DA3] Length = 276 Score = 36.2 bits (82), Expect = 1.3, Method: Composition-based stats. Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 11/76 (14%) Query: 24 YTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTGKKR 83 Y+ TQLG+KL K +A ++N+ L E G++ + E LT G + GG+ K Sbjct: 67 YSATQLGEKL--KLNAKRMNQLLSELGWISKSEEG----WSLTEAGIRAGGQ--QRTDKE 118 Query: 84 SDGTIVQQIKWHPPIV 99 S T V WH ++ Sbjct: 119 SQNTFV---VWHDVVL 131 >gi|153835450|ref|ZP_01988117.1| conserved hypothetical protein [Vibrio harveyi HY01] gi|148867994|gb|EDL67187.1| conserved hypothetical protein [Vibrio harveyi HY01] Length = 288 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 11/76 (14%) Query: 24 YTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTGKKR 83 Y+ TQLG+KL K +A ++N+ L E G++ + E LT G + GG+ K Sbjct: 79 YSATQLGEKL--KLNAKRMNQLLSELGWISKSEEG----WSLTEAGVRAGGQ--QRTDKE 130 Query: 84 SDGTIVQQIKWHPPIV 99 S T V WH ++ Sbjct: 131 SQNTFV---VWHDVVL 143 >gi|315121947|ref|YP_004062436.1| hypothetical protein CKC_00985 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|315122914|ref|YP_004063403.1| hypothetical protein CKC_05850 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495349|gb|ADR51948.1| hypothetical protein CKC_00985 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496316|gb|ADR52915.1| hypothetical protein CKC_05850 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 84 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query: 20 NLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLE--EHESGRKRD 63 L YYTPT++G+ L K + +VN L + GF LE + + Sbjct: 5 KLKYYTPTEIGEMLTPKLTVPQVNYMLVQDGFQLEDKHDDPHKPMW 50 >gi|254227475|ref|ZP_04920907.1| Glycerol kinase [Vibrio sp. Ex25] gi|262396260|ref|YP_003288113.1| hypothetical protein VEA_000963 [Vibrio sp. Ex25] gi|151940087|gb|EDN58913.1| Glycerol kinase [Vibrio sp. Ex25] gi|262339854|gb|ACY53648.1| hypothetical protein VEA_000963 [Vibrio sp. Ex25] Length = 288 Score = 35.1 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 13/84 (15%) Query: 17 TPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGRY 76 T ++ + TQLG+KL K +A ++N+ L E G++ + E +T G + G Sbjct: 72 TSSSGKTLSATQLGEKL--KLNAKRMNQLLSELGWIAKSEEG----WSVTEAGIRAG--- 122 Query: 77 FDTGKKRSDGTIVQQ-IKWHPPIV 99 G++R+D + WH ++ Sbjct: 123 ---GQQRTDKETQNTFVVWHDVVL 143 >gi|256376583|ref|YP_003100243.1| extracellular solute-binding protein family 5 [Actinosynnema mirum DSM 43827] gi|255920886|gb|ACU36397.1| extracellular solute-binding protein family 5 [Actinosynnema mirum DSM 43827] Length = 562 Score = 34.7 bits (78), Expect = 4.3, Method: Composition-based stats. Identities = 24/106 (22%), Positives = 40/106 (37%), Gaps = 19/106 (17%) Query: 13 INLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVL------- 65 + + + + P + L S V+++L W +E G+ V+ Sbjct: 47 LRILGESQSLNFDPAK-SSSLPIT-SLALVHRRLTGW-----LNEPGQDAKVVPDLGDTG 99 Query: 66 -TPKGAKGGGRYFDTGKKRSDGTIVQQ--IKWHPPIVESLAPEFGG 108 T G K G K +DGT ++ +KW + S AP F G Sbjct: 100 KTDDGGKTWTFTLKEGLKYADGTPIKADDVKW--GVERSYAPAFSG 143 >gi|320094845|ref|ZP_08026586.1| hypothetical protein HMPREF9005_1198 [Actinomyces sp. oral taxon 178 str. F0338] gi|319978237|gb|EFW09839.1| hypothetical protein HMPREF9005_1198 [Actinomyces sp. oral taxon 178 str. F0338] Length = 564 Score = 34.7 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 10/105 (9%) Query: 4 VLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGRKRD 63 V GV + Q L P N+ + P L + ++ +KK RE ++ +HE GR Sbjct: 287 VTGVVLAQGDKL-APQNMQRFEPMSLWRY------SMPQSKKFREHTYMPRKHEPGRALW 339 Query: 64 VLTPKGAKGGGRY--FDTGKKRSDGTIVQQIKWHPPIVESLAPEF 106 P G G FD GK+R + Q + +H I + E+ Sbjct: 340 RNLPGILPGLGVIEGFDKGKQR-EFLPAQTLGFHEGIEQGPGAEY 383 >gi|322373330|ref|ZP_08047866.1| putative YSIRK type signal peptide [Streptococcus sp. C150] gi|321278372|gb|EFX55441.1| putative YSIRK type signal peptide [Streptococcus sp. C150] Length = 5075 Score = 34.3 bits (77), Expect = 5.7, Method: Composition-based stats. Identities = 21/85 (24%), Positives = 34/85 (40%), Gaps = 6/85 (7%) Query: 6 GVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR--KRD 63 GV++ + YY PT + KP+ +VN E GF + GR K + Sbjct: 4197 GVDIENTADQVV----HYYDPTHKSVEKPNKPTEKRVNSVPVEVGFNFTKRLEGRELKAN 4252 Query: 64 VLTPKGAKGGGRYFDTGKKRSDGTI 88 T + G+ +T K + G + Sbjct: 4253 EFTFELKDAAGKVVETVKNDAAGNV 4277 >gi|89093903|ref|ZP_01166848.1| hypothetical protein MED92_01364 [Oceanospirillum sp. MED92] gi|89081789|gb|EAR61016.1| hypothetical protein MED92_01364 [Oceanospirillum sp. MED92] Length = 276 Score = 33.9 bits (76), Expect = 6.5, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 9/60 (15%) Query: 44 KKLREWGFLLEEHESGRKRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLA 103 + + E G++ + RK VLTPKG GG + K T V + W I+++ A Sbjct: 102 RLISELGWI----KPERKGWVLTPKGESTGGLLREDSK-----TGVPYVLWPEDILDNKA 152 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.311 0.132 0.351 Lambda K H 0.267 0.0404 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,028,590,312 Number of Sequences: 14124377 Number of extensions: 74888965 Number of successful extensions: 128101 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 30 Number of HSP's that attempted gapping in prelim test: 128058 Number of HSP's gapped (non-prelim): 56 length of query: 110 length of database: 4,842,793,630 effective HSP length: 78 effective length of query: 32 effective length of database: 3,741,092,224 effective search space: 119714951168 effective search space used: 119714951168 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 75 (33.5 bits)