RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780987|ref|YP_003065400.1| hypothetical protein CLIBASIA_04440 [Candidatus Liberibacter asiaticus str. psy62] (110 letters) >gnl|CDD|33878 COG4121, COG4121, Uncharacterized conserved protein [Function unknown]. Length = 252 Score = 26.9 bits (59), Expect = 1.3 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 30 GKKLATKPSAIKVNKKLREWGFLLEEHES-GRKRDVL 65 LAT +AI V ++L + GF +E+ G+KR++L Sbjct: 201 DPTLATFAAAIAVRRRLEQAGFTVEKRTGRGKKRELL 237 >gnl|CDD|147556 pfam05430, DUF752, Protein of unknown function (DUF752). This family contains several uncharacterized bacterial proteins with no known function. Length = 124 Score = 26.1 bits (58), Expect = 1.9 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 30 GKKLATKPSAIKVNKKLREWGFLLEEHES-GRKRDVL 65 G LAT SA V + L GF + + GRKR++L Sbjct: 83 GGTLATYSSAGFVRRGLIAAGFHVGKRPGFGRKREML 119 >gnl|CDD|143564 cd07455, CRD_Collagen_XVIII, Cysteine-rich domain of the variant 3 of collagen XVIII (V3C18 ). The cysteine-rich domain (CRD) is an essential part of the variant 3 of collagen XVIII (V3C18), which regulates major cellular functions such as the differential epithelial morphogenesis of early lung and kidney development. V3C18 is a 170 kD protein, which is proteolotically processed into the CRD-containing 50 kD glucoprotein precursor that binds Wnt3a through its CRD domain and suppresses the Wnt3a-induced stabilization of beta catenin. Full-length V3C18 is unable to inhibit Wnt signaling. Length = 123 Score = 24.4 bits (53), Expect = 7.7 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 8/48 (16%) Query: 15 LPTPNNLPYYTPTQLGKKLATKP------SAIKVNKKLREWGFLLEEH 56 LP P++LP+ + +LG + P S +V L EW +LLE Sbjct: 6 LPVPSSLPFCS--RLGIRSFWLPNFLNHTSVEEVRAVLAEWAWLLESG 51 >gnl|CDD|38321 KOG3111, KOG3111, KOG3111, D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism]. Length = 224 Score = 24.1 bits (52), Expect = 8.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Query: 85 DGTIVQQIKWHPPIVESLAPEFG 107 DG V I + PP+VESL G Sbjct: 40 DGHFVPNITFGPPVVESLRKHTG 62 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.137 0.412 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,380,974 Number of extensions: 63312 Number of successful extensions: 110 Number of sequences better than 10.0: 1 Number of HSP's gapped: 110 Number of HSP's successfully gapped: 7 Length of query: 110 Length of database: 6,263,737 Length adjustment: 76 Effective length of query: 34 Effective length of database: 4,621,453 Effective search space: 157129402 Effective search space used: 157129402 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (23.4 bits)