RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780987|ref|YP_003065400.1| hypothetical protein
CLIBASIA_04440 [Candidatus Liberibacter asiaticus str. psy62]
         (110 letters)



>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2,
          protein structure initiative; 2.20A {Thermoplasma
          acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2
          Length = 230

 Score = 26.9 bits (59), Expect = 1.1
 Identities = 9/49 (18%), Positives = 19/49 (38%), Gaps = 3/49 (6%)

Query: 25 TPTQLGKKLATKPSAI-KVNKKLREWGFLLEEHESGRKRD-VLTPKGAK 71
          T ++L   L     +  ++   L + G  +    + R +   +T KG  
Sbjct: 29 TSSKLADMLGISQQSASRIIIDLEKNG-YITRTVTKRGQILNITEKGLD 76



 Score = 24.6 bits (53), Expect = 5.6
 Identities = 11/91 (12%), Positives = 28/91 (30%), Gaps = 6/91 (6%)

Query: 21  LPYYTPTQLGKKLATKPSAIKVNKKLREWGFL----LEEHESGRKRDVLTPKGAKGGGRY 76
              Y   Q  +KL   P    +N K+ +        +            T     G  + 
Sbjct: 114 RKQYII-QFQEKLGIIPYLGTLNIKVDQASLPELRKIRGFRGIHIEGFKTEDRTFGSVKA 172

Query: 77  FDTGKKRSDGTIV-QQIKWHPPIVESLAPEF 106
           F    +     ++  +   +  ++E ++ ++
Sbjct: 173 FPAKIQNIPCFVIMPERTVYTDVIEIISDKY 203


>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase,
           immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3
           PDB: 2p6b_A 1tco_A* 1mf8_A* 1m63_A* 2jog_A
          Length = 521

 Score = 26.5 bits (58), Expect = 1.7
 Identities = 14/45 (31%), Positives = 18/45 (40%), Gaps = 5/45 (11%)

Query: 31  KKLATKPSAIKVNKKLREWGFLLEEHESGRKRDVLTPKGAKGGGR 75
           +K   +     + K  R +  L EE ES     VLT KG    G 
Sbjct: 392 RKEVIRNKIRAIGKMARVFSVLREESES-----VLTLKGLTPTGM 431


>1sr3_A APO-CCME; OB fold, beta barrel, flexible C-terminal domain,
          chaperone; NMR {Escherichia coli} SCOP: b.40.9.1
          Length = 136

 Score = 26.1 bits (57), Expect = 1.9
 Identities = 8/38 (21%), Positives = 16/38 (42%)

Query: 19 NNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEH 56
          N   +YTP ++           +V ++LR  G ++   
Sbjct: 4  NIDLFYTPGEILYGKRETQQMPEVGQRLRVGGMVMPGS 41


>1j6q_A Cytochrome C maturation protein E; all-beta protein, heme
          delivery,cytochrome C maturation, OB- (oligonucleotide
          binding)fold; NMR {Shewanella putrefaciens} SCOP:
          b.40.9.1 PDB: 1lm0_A
          Length = 136

 Score = 26.0 bits (57), Expect = 2.0
 Identities = 5/33 (15%), Positives = 14/33 (42%)

Query: 23 YYTPTQLGKKLATKPSAIKVNKKLREWGFLLEE 55
          +YTP+++           +  +++R  G +   
Sbjct: 12 FYTPSEIVNGKTDTGVKPEAGQRIRVGGMVTVG 44


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
            acyl-carrier-protein, beta-ketoacyl reductase,
            beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces
            cerevisiae}
          Length = 2006

 Score = 26.1 bits (57), Expect = 2.2
 Identities = 16/63 (25%), Positives = 27/63 (42%), Gaps = 15/63 (23%)

Query: 6    GVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSA----------IKVNKKLREWGFLLEE 55
            G ++L DI +  P NL  +   + GK++    SA          +K  K  +E    + E
Sbjct: 1658 GFSIL-DIVINNPVNLTIHFGGEKGKRIRENYSAMIFETIVDGKLKTEKIFKE----INE 1712

Query: 56   HES 58
            H +
Sbjct: 1713 HST 1715



 Score = 25.3 bits (55), Expect = 3.9
 Identities = 10/67 (14%), Positives = 23/67 (34%), Gaps = 18/67 (26%)

Query: 15 LPTPNNLPYYTPTQLGKK-LAT------------KPSAIKVNKKLREWGFL---LEEHES 58
          L  P    ++  +QL ++                +P+        +  G++   +E  + 
Sbjct: 20 LLVPTAS-FFIASQLQEQFNKILPEPTEGFAADDEPTT-PAELVGKFLGYVSSLVEPSKV 77

Query: 59 GRKRDVL 65
          G+   VL
Sbjct: 78 GQFDQVL 84


>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle
          virus, winged helix, fusellovirus, viral protein; 2.70A
          {Sulfolobus virus 1} SCOP: a.4.5.48
          Length = 99

 Score = 24.6 bits (53), Expect = 5.5
 Identities = 13/26 (50%), Positives = 15/26 (57%)

Query: 44 KKLREWGFLLEEHESGRKRDVLTPKG 69
          K L + GF+ E  E G KR  LT KG
Sbjct: 48 KFLIQEGFVKERQERGEKRLYLTEKG 73


>1vgy_A Succinyl-diaminopimelate desuccinylase; structural genomics,
          unknown function; HET: MSE; 1.90A {Neisseria
          meningitidis MC58} SCOP: c.56.5.4 d.58.19.1
          Length = 393

 Score = 24.5 bits (52), Expect = 5.6
 Identities = 8/29 (27%), Positives = 15/29 (51%)

Query: 44 KKLREWGFLLEEHESGRKRDVLTPKGAKG 72
          ++L + GF  EE   G  +++   +G K 
Sbjct: 34 ERLHKIGFAAEEMHFGNTKNIWLRRGTKA 62


>1tke_A Threonyl-tRNA synthetase; ligase; 1.46A {Escherichia coli} SCOP:
          d.15.10.1 d.67.1.1 PDB: 1tje_A 1tkg_A* 1tky_A*
          Length = 224

 Score = 24.3 bits (52), Expect = 7.6
 Identities = 9/29 (31%), Positives = 14/29 (48%)

Query: 28 QLGKKLATKPSAIKVNKKLREWGFLLEEH 56
           +G  LA    A +VN +L +   L+E  
Sbjct: 26 DIGPGLAKACIAGRVNGELVDACDLIEND 54


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.314    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0492    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 993,733
Number of extensions: 42517
Number of successful extensions: 63
Number of sequences better than 10.0: 1
Number of HSP's gapped: 63
Number of HSP's successfully gapped: 12
Length of query: 110
Length of database: 5,693,230
Length adjustment: 74
Effective length of query: 36
Effective length of database: 3,899,174
Effective search space: 140370264
Effective search space used: 140370264
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 50 (23.6 bits)