BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780987|ref|YP_003065400.1| hypothetical protein CLIBASIA_04440 [Candidatus Liberibacter asiaticus str. psy62] (110 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780987|ref|YP_003065400.1| hypothetical protein CLIBASIA_04440 [Candidatus Liberibacter asiaticus str. psy62] Length = 110 Score = 225 bits (573), Expect = 2e-61, Method: Compositional matrix adjust. Identities = 110/110 (100%), Positives = 110/110 (100%) Query: 1 MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR 60 MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR Sbjct: 1 MESVLGVNVLQDINLPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR 60 Query: 61 KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR 110 KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR Sbjct: 61 KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESLAPEFGGVR 110 >gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Score = 42.7 bits (99), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 31/102 (30%), Positives = 55/102 (53%), Gaps = 7/102 (6%) Query: 4 VLGVNVLQDIN---LPTPNNLPYYTPTQLGKKLATKPSAIKVNKKLREWGFLLEEHESGR 60 + GV+ L+ ++ LP+ +N Y T TQ+G++L A +NK L + G + + G Sbjct: 154 ITGVDQLEAMDIKHLPSSDNDEYLTITQIGERLNPPQRARFLNKLLLKRGLQVSKVSGGY 213 Query: 61 KRDVLTPKGAKGGGRYFDTGKKRSDGTIVQQIKWHPPIVESL 102 + TPKG + GG+ D + +G+ QQ+KW+ ++ S Sbjct: 214 RP---TPKGEERGGKMCDVPMQHVEGS-TQQLKWNSNLLVSF 251 >gi|254780191|ref|YP_003064604.1| alanyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 898 Score = 29.6 bits (65), Expect = 0.015, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Query: 44 KKLREWGFLLEEHESGRKRDVL---TPKGAKGGGRYFDTGKKRSDGTIVQ 90 K + + G ++EE SG+K +V+ TP A+ GG+ DTG DG +Q Sbjct: 493 KAIVQQGEIVEEAVSGQKVEVVFDQTPFYAEAGGQLGDTGCAIGDGIRLQ 542 >gi|254780661|ref|YP_003065074.1| exonuclease I [Candidatus Liberibacter asiaticus str. psy62] Length = 471 Score = 22.3 bits (46), Expect = 2.0, Method: Composition-based stats. Identities = 7/23 (30%), Positives = 13/23 (56%) Query: 80 GKKRSDGTIVQQIKWHPPIVESL 102 G RS+ ++ + WHP +S+ Sbjct: 231 GASRSNTALIAPVAWHPRYKDSV 253 >gi|254780435|ref|YP_003064848.1| peptidase S11, D-alanyl-D-alanine carboxypeptidase 1 [Candidatus Liberibacter asiaticus str. psy62] Length = 336 Score = 20.8 bits (42), Expect = 6.0, Method: Composition-based stats. Identities = 7/18 (38%), Positives = 11/18 (61%) Query: 8 NVLQDINLPTPNNLPYYT 25 N+ +++ N LPYYT Sbjct: 15 NIFPFLSIAETNKLPYYT 32 >gi|254780662|ref|YP_003065075.1| NAD-glutamate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 1576 Score = 20.4 bits (41), Expect = 8.1, Method: Composition-based stats. Identities = 8/13 (61%), Positives = 9/13 (69%) Query: 61 KRDVLTPKGAKGG 73 K V+ P GAKGG Sbjct: 812 KNAVIVPVGAKGG 824 >gi|254780573|ref|YP_003064986.1| cysteinyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 20.4 bits (41), Expect = 8.1, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 17/27 (62%) Query: 32 KLATKPSAIKVNKKLREWGFLLEEHES 58 K+ SA + K+L GF+LE++++ Sbjct: 421 KMKKFSSADYIRKQLESKGFILEDYKN 447 >gi|254781160|ref|YP_003065573.1| 16S rRNA m3U1498 methyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 245 Score = 20.4 bits (41), Expect = 8.7, Method: Compositional matrix adjust. Identities = 8/23 (34%), Positives = 14/23 (60%) Query: 17 TPNNLPYYTPTQLGKKLATKPSA 39 T ++LP+ TP LG ++ +A Sbjct: 207 TLHSLPFVTPLSLGPRILRSDTA 229 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.314 0.137 0.412 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,617 Number of Sequences: 1233 Number of extensions: 2869 Number of successful extensions: 10 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 110 length of database: 328,796 effective HSP length: 63 effective length of query: 47 effective length of database: 251,117 effective search space: 11802499 effective search space used: 11802499 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.4 bits) S2: 32 (16.9 bits)