RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780988|ref|YP_003065401.1| hypothetical protein CLIBASIA_04445 [Candidatus Liberibacter asiaticus str. psy62] (151 letters) >gnl|CDD|34246 COG4626, COG4626, Phage terminase-like protein, large subunit [General function prediction only]. Length = 546 Score = 27.2 bits (60), Expect = 1.8 Identities = 8/24 (33%), Positives = 15/24 (62%) Query: 124 LAPFTQDIIACILGFWFTDTIVQR 147 L P+ + I+A + GF+ T ++R Sbjct: 62 LEPWQKFIVAALFGFYDKQTGIRR 85 >gnl|CDD|35451 KOG0230, KOG0230, KOG0230, Phosphatidylinositol-4-phosphate 5-kinase and related FYVE finger-containing proteins [Signal transduction mechanisms]. Length = 1598 Score = 27.3 bits (60), Expect = 1.9 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 7/53 (13%) Query: 13 FIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRL 65 FIKF P+ F L E SI +AKI QV +K+ +S ++ Sbjct: 1392 FIKFAPAYFKYLTE------SISQKSPTC-LAKILGIYQVSVKSPKSGKETKM 1437 >gnl|CDD|37704 KOG2493, KOG2493, KOG2493, Na+/Pi symporter [Inorganic ion transport and metabolism]. Length = 512 Score = 26.8 bits (59), Expect = 2.4 Identities = 22/138 (15%), Positives = 42/138 (30%), Gaps = 12/138 (8%) Query: 1 MISFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESE 60 +IS G IA F + F + + I + K + E++ E Sbjct: 236 LISVGLGVIAAFIVYFF--VRPFMRRKINRGKETDEAPPVSEVSGSS-------ARRELG 286 Query: 61 TPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGVEKGYLTKDP 120 V + + + R + P T+ + L W + + + Sbjct: 287 KSVEIKEESAVESTVKNLRIQNTSAITKS---PSTSESQGKIRKLEKWLWPDVTRVDSEE 343 Query: 121 LTLLAPFTQDIIACILGF 138 ++ L Q + AC F Sbjct: 344 VSRLFSTLQVLTACFASF 361 >gnl|CDD|38718 KOG3508, KOG3508, KOG3508, GTPase-activating protein [General function prediction only]. Length = 932 Score = 26.1 bits (57), Expect = 3.7 Identities = 24/90 (26%), Positives = 31/90 (34%), Gaps = 28/90 (31%) Query: 17 VPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANEDQ 76 PSLFNL +EY + R IAK+ LQN AN + Sbjct: 430 SPSLFNLAQEYPSPTTA----RTLTLIAKV---------------------LQNLANFSK 464 Query: 77 FERESKAMIFFNALIR---PFTTLFWIILY 103 F + K M F N + LF + Sbjct: 465 FGGKEKRMRFMNEFLEHEWEAMKLFLKRIS 494 >gnl|CDD|38459 KOG3249, KOG3249, KOG3249, Uncharacterized conserved protein [Function unknown]. Length = 181 Score = 26.2 bits (57), Expect = 4.0 Identities = 6/24 (25%), Positives = 9/24 (37%) Query: 86 FFNALIRPFTTLFWIILYPLLIWW 109 F +L L W +L P+ Sbjct: 100 FSLSLKMWVIVLLWFVLAPIAHRL 123 >gnl|CDD|38307 KOG3097, KOG3097, KOG3097, Predicted membrane protein [Function unknown]. Length = 390 Score = 26.1 bits (57), Expect = 4.5 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 7/40 (17%) Query: 100 IILYPLLIWWGVEKGYLTKDPLTLLAPFTQDIIACILGFW 139 +L PL I+ G+E+ +L D FT+ +AC LG Sbjct: 278 RLLVPLTIFSGLEQAFLCAD-------FTKAYVACALGVS 310 >gnl|CDD|35658 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 1080 Score = 25.7 bits (56), Expect = 4.9 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 14/70 (20%) Query: 3 SFLTGSIARFFIKFVPSLFNLLEE------------YIMKEKS--IEHDRLRLEIAKIQS 48 SF+T + ++ FV FN L+E Y K+ ++HDR E Q Sbjct: 204 SFITTDVNPYYDSFVRWQFNKLKEAGKIKFGKRYTIYSPKDGQPCMDHDRASGEGVGPQE 263 Query: 49 TTQVDLKALE 58 T + L+ LE Sbjct: 264 YTLIKLEVLE 273 >gnl|CDD|185743 cd09002, GH43_XYL_3, Glycosyl hydrolase family 43, beta-D-xylosidase. This glycosyl hydrolase family 43 (GH43) includes enzymes that have been characterized to have beta-1,4-xylosidase (beta-D-xylosidase;xylan 1,4-beta-xylosidase; EC 3.2.1.37) activity. They are part of an array of hemicellulases that are involved in the final breakdown of plant cell-wall whereby they degrade xylan. They hydrolyze beta-1,4 glycosidic bonds between two xylose units in short xylooligosaccharides. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller. Length = 280 Score = 25.5 bits (56), Expect = 6.3 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 4/23 (17%) Query: 108 WW----GVEKGYLTKDPLTLLAP 126 WW EKGYLT TLL P Sbjct: 247 WWMVYHAYEKGYLTLGRQTLLEP 269 >gnl|CDD|36288 KOG1070, KOG1070, KOG1070, rRNA processing protein Rrp5 [RNA processing and modification]. Length = 1710 Score = 25.4 bits (55), Expect = 6.9 Identities = 11/78 (14%), Positives = 23/78 (29%), Gaps = 6/78 (7%) Query: 7 GSIARF-----FIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESET 61 G++ F+ F L M + + D + + V++ + Sbjct: 605 GTLCAIKENGAFVTFTGGLSGFAPVSEMSDDFVLSDSEHFPVGQTVRAKIVNVDDEKRRM 664 Query: 62 PVRLARLQNQANEDQFER 79 P+ L R + A Sbjct: 665 PLGL-RASSCARACVKRS 681 >gnl|CDD|35152 COG5593, COG5593, Nucleic-acid-binding protein possibly involved in ribosomal biogenesis [Translation, ribosomal structure and biogenesis]. Length = 821 Score = 25.1 bits (54), Expect = 7.3 Identities = 14/96 (14%), Positives = 32/96 (33%), Gaps = 11/96 (11%) Query: 3 SFLTGSIARFFIKFVPSLFNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETP 62 + + +F F L N+ +E+ + +E + K SE Sbjct: 302 AVANKLVKVYFSIFRKFLENIPKEHRVNSNILEEKLV-----------IGLGKNKGSEKI 350 Query: 63 VRLARLQNQANEDQFERESKAMIFFNALIRPFTTLF 98 + ++ + + ++ A++ PF LF Sbjct: 351 CKTEIIRKEVHTEKNSFYGSAVLTGCNRAGPFALLF 386 >gnl|CDD|36049 KOG0831, KOG0831, KOG0831, Acyl-CoA:diacylglycerol acyltransferase (DGAT) [Lipid transport and metabolism]. Length = 334 Score = 25.2 bits (55), Expect = 7.6 Identities = 7/27 (25%), Positives = 10/27 (37%) Query: 83 AMIFFNALIRPFTTLFWIILYPLLIWW 109 +I FN T FW + +W Sbjct: 31 PLISFNVPFALLFTRFWPLAILYAVWL 57 >gnl|CDD|113049 pfam04262, Glu_cys_ligase, Glutamate-cysteine ligase. Family of bacterial f glutamate-cysteine ligases (EC:6.3.2.2) that carry out the first step of the glutathione biosynthesis pathway. Length = 377 Score = 25.1 bits (55), Expect = 8.0 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 66 ARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILY 103 L NE++ R+ ++ +F LIR F WI+ Y Sbjct: 158 TALFRAQNEEKSARDFQSAAYFR-LIRNFYRYGWILPY 194 >gnl|CDD|34590 COG4985, COG4985, ABC-type phosphate transport system, auxiliary component [Inorganic ion transport and metabolism]. Length = 289 Score = 25.0 bits (54), Expect = 8.1 Identities = 18/82 (21%), Positives = 37/82 (45%), Gaps = 8/82 (9%) Query: 22 NLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALE------SETPVRLARLQNQAN-- 73 + + E ++ + + +RLRLE ++Q Q+D + + SE RLA+LQ + + Sbjct: 181 DKMVEQQVRVINSQLERLRLEKRRLQLNGQLDDEFQQHYVAEKSELQKRLAQLQTELDAL 240 Query: 74 EDQFERESKAMIFFNALIRPFT 95 + ER+ ++ Sbjct: 241 RAELERQFLYLVDMQGETVSVP 262 >gnl|CDD|37131 KOG1920, KOG1920, KOG1920, IkappaB kinase complex, IKAP component [Transcription]. Length = 1265 Score = 24.9 bits (54), Expect = 9.1 Identities = 12/36 (33%), Positives = 19/36 (52%) Query: 21 FNLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKA 56 F L E + S ++ L L+I +I+S +V L A Sbjct: 24 FILSPELVTVASSTINELLGLKIFEIESVGKVRLVA 59 >gnl|CDD|146951 pfam04559, Herpes_UL17, Herpesvirus UL17 protein. UL17 protein is required for DNA cleavage and packaging in herpes viruses. It has been shown to associate with immature B-type capsids, and is required for the the localisation of capsids and capsid proteins to the intranuclear sites where viral DNA is cleaved and packaged. In the virion, UL17 is a component of the tegument, which is a protein layer surrounding the viral capsid. Length = 498 Score = 25.1 bits (55), Expect = 9.2 Identities = 7/29 (24%), Positives = 12/29 (41%), Gaps = 3/29 (10%) Query: 98 FWIILYPLLIWWGVEKGYLTKDPLTLLAP 126 F+++ Y WG G + D L+ Sbjct: 292 FYVVWYENSSAWG---GRSSLDLEDSLSR 317 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.328 0.142 0.428 Gapped Lambda K H 0.267 0.0588 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,851,100 Number of extensions: 91732 Number of successful extensions: 399 Number of sequences better than 10.0: 1 Number of HSP's gapped: 397 Number of HSP's successfully gapped: 51 Length of query: 151 Length of database: 6,263,737 Length adjustment: 85 Effective length of query: 66 Effective length of database: 4,426,972 Effective search space: 292180152 Effective search space used: 292180152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (24.5 bits)