RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780988|ref|YP_003065401.1| hypothetical protein CLIBASIA_04445 [Candidatus Liberibacter asiaticus str. psy62] (151 letters) >gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional. Length = 373 Score = 28.1 bits (63), Expect = 0.89 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Query: 20 LFNLLEEYIMKEKSIEHDRLRLE-IAKIQSTTQVDLKALESETPVRLARLQNQA 72 L N L Y ++ +D++R++ AK+ ++ K + E+ + L L+N+ Sbjct: 300 LANCLNAYDFEKALQRYDKIRVKHTAKVIKRSRKIGKIAQIESKL-LVALRNRV 352 >gnl|CDD|178007 PLN02381, PLN02381, valyl-tRNA synthetase. Length = 1066 Score = 26.0 bits (57), Expect = 4.5 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Query: 25 EEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANED 75 E+ I+ E+ +E + + E AK + + LKA + E A+LQ Q D Sbjct: 9 EKKILTEEELERKKKKEEKAKEKELKK--LKAAQKE---AKAKLQAQQASD 54 >gnl|CDD|163318 TIGR03545, TIGR03545, conserved hypothetical protein TIGR03545. This model represents a relatively rare but broadly distributed uncharacterized protein family, distributed in 1-2 percent of bacterial genomes, all of which have outer membranes. In many of these genomes, it is part of a two-gene pair. Length = 555 Score = 25.4 bits (56), Expect = 5.3 Identities = 12/64 (18%), Positives = 27/64 (42%), Gaps = 5/64 (7%) Query: 37 DRLRLEIAKIQSTTQVDLKALESETPVRLARLQNQANEDQFERESKAMIFFNALIRPFT- 95 + L+ + ++++ DL L+ L RL+N+ + ++ A+ F IR + Sbjct: 240 NDLQNDKKQLKA----DLAELKKAPQNDLKRLENKYAIKSGDLKNFAVDLFGPEIRKYLQ 295 Query: 96 TLFW 99 Sbjct: 296 KFLK 299 >gnl|CDD|184755 PRK14583, hmsR, N-glycosyltransferase; Provisional. Length = 444 Score = 25.7 bits (56), Expect = 5.7 Identities = 8/13 (61%), Positives = 11/13 (84%) Query: 96 TLFWIILYPLLIW 108 +LFWII YP++ W Sbjct: 395 SLFWIIWYPMVYW 407 >gnl|CDD|163225 TIGR03348, VI_IcmF, type VI secretion protein IcmF. Members of this protein family are IcmF homologs and tend to be associated with type VI secretion systems. Length = 1169 Score = 25.4 bits (56), Expect = 7.0 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 10/49 (20%) Query: 96 TLFWIILYPLLIWWGVEKGYLTKDPLTLLAPFTQD-----IIACILGFW 139 +L +IL +LIWW G L + P IIA +L W Sbjct: 2 SLLGLILLCILIWWA---GPLL--AVGDYKPLESVWARLLIIAVLLLVW 45 >gnl|CDD|182306 PRK10207, PRK10207, dipeptide/tripeptide permease B; Provisional. Length = 489 Score = 25.2 bits (55), Expect = 7.7 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 10/55 (18%) Query: 98 FWIIL-YPLLIWWGVEKGYLTKDPLTLLAPFTQDIIACILGF--------WFTDT 143 FW+++ P+L G KD L++ FT + C LGF WF D Sbjct: 320 FWVVVASPILAGIYTHLGSKGKD-LSMPMKFTLGMFLCSLGFLTAAAAGMWFADA 373 >gnl|CDD|184622 PRK14325, PRK14325, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional. Length = 444 Score = 25.1 bits (56), Expect = 7.7 Identities = 9/22 (40%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Query: 64 RLARLQNQANEDQFERESKAMI 85 RL RLQ N+ Q S++M+ Sbjct: 361 RLQRLQALINQQQMAF-SRSMV 381 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.328 0.142 0.428 Gapped Lambda K H 0.267 0.0771 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,475,731 Number of extensions: 147756 Number of successful extensions: 457 Number of sequences better than 10.0: 1 Number of HSP's gapped: 456 Number of HSP's successfully gapped: 34 Length of query: 151 Length of database: 5,994,473 Length adjustment: 85 Effective length of query: 66 Effective length of database: 4,157,793 Effective search space: 274414338 Effective search space used: 274414338 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (24.1 bits)