254780989

254780989

GCN5-related N-acetyltransferase

GeneID in NCBI database:8210011Locus tag:CLIBASIA_04450
Protein GI in NCBI database:254780989Protein Accession:YP_003065402.1
Gene range:+(984918, 985475)Protein Length:185aa
Gene description:GCN5-related N-acetyltransferase
COG prediction:[R] Predicted acetyltransferase
KEGG prediction:GCN5-related N-acetyltransferase
SEED prediction:GCN5-related N-acetyltransferase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MPKQPNVNIELEGLTFANEQRVDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGDRIVGAIRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIGKMSLRREYD
cccccccccccccEEEEEccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccEEEEEEEccEEEEEEEEEEEccccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEccHHHHHHcccEEccccEEEccccccccccEEEEEccccccccccEEEEEccccc
ccccccEEEEEcEEEEEHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHccccEEEEEcccEEEEEEEEEccEcccccccccccccccccHHccccHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHcHHHHcc
mpkqpnvnielegltfaneqrvdqVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGDRIVgairatpiqigkykgflrgplgvlseyrkrGIGSRLAYMSFMAIKNSGAEFVLIDAkhdwhkhlgfkkphqhqiryahgggaaTDWLVHIFKNNIMENMIGKmslrreyd
mpkqpnvnielegltfaneqrvDQVAVDEVMVKAFLStqeitddvlhKYVRNNVEEPLSFVRLMSFVCRDGDRIVGAiratpiqigkykgflrgplgvLSEYRKRGIGSRLAYMSFMAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMEnmigkmslrreyd
MPKQPNVNIELEGLTFANEQRVDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGDRIVGAIRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIGKMSLRREYD
*************LTFANEQRVDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGDRIVGAIRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIGKMSLRREYD
MPKQPNVNIELEGLTFANEQRVDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGDRIVGAIRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIGKMSLRREYD
***QPNVNIELEGLTFANEQRVDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGDRIVGAIRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIGKMSLRR**D
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKQPNVNIELEGLTFANEQRVDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGDRIVGAIRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIGKMSLRREYD
MPKQPNVNIELEGLTFANEQRVDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGDRIVGAIRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIGKMSLRREYD
MPKQPNVNIELEGLTFANEQRVDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGDRIVGAIRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIGKMSLRREYD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target185 GCN5-related N-acetyltransferase [Candidatus Liberibact
25478096249 hypothetical protein CLIBASIA_04315 [Candidatus Li 1e-17
254781162192 GCN5-related N-acetyltransferase [Candidatus Liber 9e-13
25478115535 hypothetical protein CLIBASIA_05310 [Candidatus Li 5e-09
>gi|254780962|ref|YP_003065375.1| hypothetical protein CLIBASIA_04315 [Candidatus Liberibacter asiaticus str. psy62] Length = 49 Back     alignment 
 Score = 80.9 bits (198), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/68 (64%), Positives = 46/68 (67%), Gaps = 20/68 (29%)

Query: 117 MAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIG 176
           MAIKNSGAEFVLIDAK D +KHLGFKKP                    IFKNNIMENMIG
Sbjct: 1   MAIKNSGAEFVLIDAKSDGYKHLGFKKP--------------------IFKNNIMENMIG 40

Query: 177 KMSLRREY 184
           +MSLRREY
Sbjct: 41  RMSLRREY 48
>gi|254781162|ref|YP_003065575.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 192 Back     alignment 
 Score = 64.7 bits (156), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 49/79 (62%)

Query: 64  MSFVCRDGDRIVGAIRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSG 123
           +SF+C +G RIVG++R TPI I K  G L GP+ V   Y+ +GIG +L  MS  A +  G
Sbjct: 74  LSFLCAEGKRIVGSVRMTPISIEKITGHLLGPIVVHPLYQNKGIGRKLISMSVDAAEKKG 133

Query: 124 AEFVLIDAKHDWHKHLGFK 142
           ++ +++     ++  LGF+
Sbjct: 134 SQVIVLVGDIAYYSKLGFQ 152
>gi|254781155|ref|YP_003065568.1| hypothetical protein CLIBASIA_05310 [Candidatus Liberibacter asiaticus str. psy62] Length = 35 Back     alignment 
 Score = 52.4 bits (124), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 22/34 (64%), Positives = 27/34 (79%)

Query: 139 LGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIME 172
           +GFKKP+Q+QI +A GG   T WLVHIFK N+ME
Sbjct: 1   MGFKKPYQNQIEHAQGGRKTTAWLVHIFKKNLME 34

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target185 GCN5-related N-acetyltransferase [Candidatus Liberibact
25478096249 hypothetical protein CLIBASIA_04315 [Candidatus Liberib 1 7e-14
315122547167 GCN5-related N-acetyltransferase [Candidatus Liberibact 1 4e-13
239832443187 acetyltransferase [Ochrobactrum intermedium LMG 3301] L 1 8e-10
254505003165 acetyltransferase, GNAT family [Labrenzia alexandrii DF 1 1e-09
153008935168 GCN5-like N-acetyltransferase [Ochrobactrum anthropi AT 1 1e-09
319408921183 Acetyltransferase, GNAT family protein [Bartonella scho 1 2e-09
62290444168 acetyltransferase [Brucella abortus bv. 1 str. 9-941] L 1 2e-09
237815952186 acetyltransferase [Brucella abortus str. 2308 A] Length 1 2e-09
17986739172 acetyltransferase [Brucella melitensis bv. 1 str. 16M] 1 2e-09
23502424168 acetyltransferase [Brucella suis 1330] Length = 168 1 2e-09
>gi|254780962|ref|YP_003065375.1| hypothetical protein CLIBASIA_04315 [Candidatus Liberibacter asiaticus str. psy62] Length = 49 Back     alignment and organism information
 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/68 (64%), Positives = 46/68 (67%), Gaps = 20/68 (29%)

Query: 117 MAIKNSGAEFVLIDAKHDWHKHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIG 176
           MAIKNSGAEFVLIDAK D +KHLGFKKP                    IFKNNIMENMIG
Sbjct: 1   MAIKNSGAEFVLIDAKSDGYKHLGFKKP--------------------IFKNNIMENMIG 40

Query: 177 KMSLRREY 184
           +MSLRREY
Sbjct: 41  RMSLRREY 48



Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122547|ref|YP_004063036.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 167 Back     alignment and organism information
>gi|239832443|ref|ZP_04680772.1| acetyltransferase [Ochrobactrum intermedium LMG 3301] Length = 187 Back     alignment and organism information
>gi|254505003|ref|ZP_05117154.1| acetyltransferase, GNAT family [Labrenzia alexandrii DFL-11] Length = 165 Back     alignment and organism information
>gi|153008935|ref|YP_001370150.1| GCN5-like N-acetyltransferase [Ochrobactrum anthropi ATCC 49188] Length = 168 Back     alignment and organism information
>gi|319408921|emb|CBI82578.1| Acetyltransferase, GNAT family protein [Bartonella schoenbuchensis R1] Length = 183 Back     alignment and organism information
>gi|62290444|ref|YP_222237.1| acetyltransferase [Brucella abortus bv. 1 str. 9-941] Length = 168 Back     alignment and organism information
>gi|237815952|ref|ZP_04594949.1| acetyltransferase [Brucella abortus str. 2308 A] Length = 186 Back     alignment and organism information
>gi|17986739|ref|NP_539373.1| acetyltransferase [Brucella melitensis bv. 1 str. 16M] Length = 172 Back     alignment and organism information
>gi|23502424|ref|NP_698551.1| acetyltransferase [Brucella suis 1330] Length = 168 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target185 GCN5-related N-acetyltransferase [Candidatus Liberibact
cd0430165 cd04301, NAT_SF, N-Acyltransferase superfamily: Various 3e-05
pfam0058380 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) fam 5e-05
KOG3139165 KOG3139, KOG3139, KOG3139, N-acetyltransferase [General 0.001
COG3153171 COG3153, COG3153, Predicted acetyltransferase [General 3e-16
>gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>gnl|CDD|144249 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family Back     alignment and domain information
>gnl|CDD|38349 KOG3139, KOG3139, KOG3139, N-acetyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|32967 COG3153, COG3153, Predicted acetyltransferase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 185 GCN5-related N-acetyltransferase [Candidatus Liberibact
COG3153171 Predicted acetyltransferase [General function predictio 100.0
PRK09491144 rimI ribosomal-protein-alanine N-acetyltransferase; Pro 99.84
PRK07757152 acetyltransferase; Provisional 99.81
PRK10140162 putative acetyltransferase YhhY; Provisional 99.78
PRK07922170 N-acetylglutamate synthase; Validated 99.76
TIGR01575140 rimI ribosomal-protein-alanine acetyltransferase; Inter 99.73
PRK10562145 hypothetical protein; Provisional 99.65
COG1247169 Sortase and related acyltransferases [Cell envelope bio 99.61
PRK09831147 hypothetical protein; Provisional 99.57
KOG3139165 consensus 99.55
COG0456177 RimI Acetyltransferases [General function prediction on 99.54
PRK10314153 hypothetical protein; Provisional 99.3
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103. 99.21
KOG3235193 consensus 98.96
KOG3138187 consensus 98.81
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; Prov 98.72
KOG3234173 consensus 98.24
COG3916209 LasI N-acyl-L-homoserine lactone synthetase [Signal tra 94.64
PRK03624140 putative acetyltransferase; Provisional 99.87
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Provisio 99.82
PTZ00330147 acetyltransferase; Provisional 99.82
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransferase 99.71
PRK10975231 TDP-fucosamine acetyltransferase; Provisional 99.69
PRK01346 411 hypothetical protein; Provisional 99.65
PRK10514146 hypothetical protein; Provisional 99.63
COG1246153 ArgA N-acetylglutamate synthase and related acetyltrans 99.62
PRK12308614 bifunctional argininosuccinate lyase/N-acetylglutamate 99.6
PRK05279441 N-acetylglutamate synthase; Validated 99.59
KOG3216163 consensus 99.39
TIGR01890439 N-Ac-Glu-synth amino-acid N-acetyltransferase; InterPro 99.08
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; Provi 98.93
KOG3397225 consensus 98.91
KOG4144190 consensus 98.87
TIGR03448 292 mycothiol_MshD mycothiol biosynthesis acetyltransferase 98.85
COG4552 389 Eis Predicted acetyltransferase involved in intracellul 98.83
KOG3396150 consensus 98.83
TIGR02382201 wecD_rffC TDP-D-fucosamine acetyltransferase; InterPro: 98.81
TIGR02406162 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferas 98.8
KOG2488202 consensus 98.69
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transferase 98.64
COG3393268 Predicted acetyltransferase [General function predictio 98.63
COG3981174 Predicted acetyltransferase [General function predictio 98.59
COG1670187 RimL Acetyltransferases, including N-acetylases of ribo 98.18
pfam04958 338 AstA Arginine N-succinyltransferase beta subunit. Argin 98.05
PRK10456 344 arginine succinyltransferase; Provisional 97.95
TIGR03244 336 arg_catab_AstA arginine N-succinyltransferase. In many 97.94
COG3818167 Predicted acetyltransferase, GNAT superfamily [General 97.88
TIGR03243 335 arg_catab_AOST arginine and ornithine succinyltransfera 97.83
TIGR03245 336 arg_AOST_alph arginine/ornithine succinyltransferase, a 97.7
pfam00765182 Autoind_synth Autoinducer synthetase. 97.42
COG3375266 Uncharacterized conserved protein [Function unknown] 97.36
COG3882574 FkbH Predicted enzyme involved in methoxymalonyl-ACP bi 97.22
pfam02474196 NodA Nodulation protein A (NodA). Rhizobia nodulation ( 96.96
PRK00756196 acyltransferase NodA; Provisional 96.84
KOG3698891 consensus 96.62
pfam09390161 DUF1999 Protein of unknown function (DUF1999). This fam 96.42
pfam01233162 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-ter 96.18
TIGR01686337 FkbH FkbH domain; InterPro: IPR010037 This entry descri 95.94
pfam02799190 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-t 95.85
PRK13834207 putative autoinducer synthesis protein; Provisional 95.72
COG2401 593 ABC-type ATPase fused to a predicted acetyltransferase 93.57
TIGR03019330 pepcterm_femAB FemAB-related protein, PEP-CTERM system- 91.39
PHA01733153 hypothetical protein 91.11
cd0430183 GNAT GCN5-related N-acetyltransferases (GNAT) represent 99.53
pfam0058380 Acetyltransf_1 Acetyltransferase (GNAT) family. This fa 99.38
pfam0844586 FR47 FR47-like protein. The members of this family are 98.99
COG2153155 ElaA Predicted acyltransferase [General function predic 98.99
TIGR01211573 ELP3 histone acetyltransferase, ELP3 family; InterPro: 98.35
PHA00673154 acetyltransferase domain containing protein 98.15
cd02169 296 Citrate_lyase_ligase Citrate lyase ligase, also known a 98.14
COG238899 Predicted acetyltransferase [General function predictio 97.96
COG1243515 ELP3 Histone acetyltransferase [Transcription / Chromat 97.5
PRK13688157 hypothetical protein; Provisional 97.1
pfam0844489 Gly_acyl_tr_C Aralkyl acyl-CoA:amino acid N-acyltransfe 96.44
PHA01807145 hypothetical protein 95.89
PTZ00064442 histone acetyltransferase; Provisional 95.79
pfam01853189 MOZ_SAS MOZ/SAS family. This region of these proteins h 95.6
KOG2747396 consensus 95.14
pfam05301120 Mec-17 Touch receptor neuron protein Mec-17. Mec-17 is 94.87
COG5628143 Predicted acetyltransferase [General function predictio 94.83
TIGR00124 342 cit_ly_ligase [citrate (pro-3S)-lyase] ligase; InterPro 93.31
COG1444 758 Predicted P-loop ATPase fused to an acetyltransferase [ 98.77
COG3053 352 CitC Citrate lyase synthetase [Energy production and co 97.85
KOG2036 1011 consensus 95.93
KOG2535554 consensus 95.22
COG0454156 WecD Histone acetyltransferase HPA2 and related acetylt 97.08
COG3138 336 AstA Arginine/ornithine N-succinyltransferase beta subu 96.41
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase; InterPro: IPR006464 Histone acetylation is carried out by a class of enzymes known as histone acetyltransferases (HATs), which catalyse the transfer of an acetyl group from acetyl-CoA to the lysine E-amino groups on the N-terminal tails of histones Back     alignment and domain information
>PRK10562 hypothetical protein; Provisional Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09831 hypothetical protein; Provisional Back     alignment and domain information
>KOG3139 consensus Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>PRK10314 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>KOG3235 consensus Back     alignment and domain information
>KOG3138 consensus Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>KOG3234 consensus Back     alignment and domain information
>COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>PRK10514 hypothetical protein; Provisional Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>KOG3216 consensus Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase; InterPro: IPR010167 This entry represents a clade of amino-acid N-acetyltransferases, or N-acetylglutamate synthase, which is the product of the argA gene and the first enzyme in arginine biosynthesis Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>KOG3397 consensus Back     alignment and domain information
>KOG4144 consensus Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] Back     alignment and domain information
>KOG3396 consensus Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase; InterPro: IPR012752 This entry represents the WecD protein (formerly RffC) for the biosynthesis of enterobacterial common antigen (ECA), an outer leaflet, outer membrane glycolipid with a trisaccharide repeat unit Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase; InterPro: IPR012772 This enzyme family is the EctA of ectoine biosynthesis Back     alignment and domain information
>KOG2488 consensus Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG3981 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam04958 AstA Arginine N-succinyltransferase beta subunit Back     alignment and domain information
>PRK10456 arginine succinyltransferase; Provisional Back     alignment and domain information
>TIGR03244 arg_catab_AstA arginine N-succinyltransferase Back     alignment and domain information
>COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] Back     alignment and domain information
>TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits Back     alignment and domain information
>TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit Back     alignment and domain information
>pfam00765 Autoind_synth Autoinducer synthetase Back     alignment and domain information
>COG3375 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>pfam02474 NodA Nodulation protein A (NodA) Back     alignment and domain information
>PRK00756 acyltransferase NodA; Provisional Back     alignment and domain information
>KOG3698 consensus Back     alignment and domain information
>pfam09390 DUF1999 Protein of unknown function (DUF1999) Back     alignment and domain information
>pfam01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain Back     alignment and domain information
>TIGR01686 FkbH FkbH domain; InterPro: IPR010037 This entry describes a domain of unknown function Back     alignment and domain information
>pfam02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain Back     alignment and domain information
>PRK13834 putative autoinducer synthesis protein; Provisional Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated Back     alignment and domain information
>PHA01733 hypothetical protein Back     alignment and domain information
>cd04301 GNAT GCN5-related N-acetyltransferases (GNAT) represent a large superfamily of functionally diverse enzymes that catalyze the transfer of an acetyl group from acetyl-Coenzyme A to the primary amine of a wide range of acceptor substrates Back     alignment and domain information
>pfam00583 Acetyltransf_1 Acetyltransferase (GNAT) family Back     alignment and domain information
>pfam08445 FR47 FR47-like protein Back     alignment and domain information
>COG2153 ElaA Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family; InterPro: IPR005910 Histone acetylation is carried out by a class of enzymes known as histone acetyltransferases (HATs), which catalyse the transfer of an acetyl group from acetyl-CoA to the lysine E-amino groups on the N-terminal tails of histones Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase, also known as [Citrate (pro-3S)-lyase] ligase, is responsible for acetylation of the (2-(5''-phosphoribosyl)-3'-dephosphocoenzyme-A) prosthetic group of the gamma subunit of citrate lyase, converting the inactive thiol form of this enzyme to the active form Back     alignment and domain information
>COG2388 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>pfam08444 Gly_acyl_tr_C Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>pfam01853 MOZ_SAS MOZ/SAS family Back     alignment and domain information
>KOG2747 consensus Back     alignment and domain information
>pfam05301 Mec-17 Touch receptor neuron protein Mec-17 Back     alignment and domain information
>COG5628 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase; InterPro: IPR005216 [Citrate (pro-3S)-lyase] ligase (6 Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>KOG2036 consensus Back     alignment and domain information
>KOG2535 consensus Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>COG3138 AstA Arginine/ornithine N-succinyltransferase beta subunit [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target185 GCN5-related N-acetyltransferase [Candidatus Liberibact
3dr8_A174 Structure Of Ynca, A Putative Acetyltransferase Fro 6e-09
1z4e_A153 Crystal Structure Of Transcriptional Regulator From 3e-08
2j8m_A172 Structure Of P. Aeruginosa Acetyltransferase Pa4866 2e-07
1yvo_A172 Hypothetical Acetyltransferase From P.Aeruginosa Pa 2e-06
2bl1_A172 Crystal Structure Of A Putative Phosphinothricin Ac 2e-06
3f8k_A160 Crystal Structure Of Protein Acetyltransferase (Pat 3e-06
2fe7_A166 The Crystal Structure Of A Probable N-Acetyltransfe 2e-05
2r98_A456 Crystal Structure Of N-Acetylglutamate Synthase (Se 2e-05
2bei_A170 X-Ray Structure Of Thialysine N-Acetyltransferase ( 2e-05
1yr0_A175 Crystal Structure Of Phosphinothricin Acetyltransfe 3e-05
2r8v_A456 Native Structure Of N-Acetylglutamate Synthase From 3e-05
1wk4_A174 Crystal Structure Of Ttk003001606 Length = 174 3e-05
1kuv_A207 X-Ray Crystallographic Studies Of Serotonin N- Acet 1e-04
1ib1_E200 Crystal Structure Of The 14-3-3 Zeta:serotonin N- A 2e-04
1l0c_A207 Investigation Of The Roles Of Catalytic Residues In 2e-04
1cjw_A166 Serotonin N-Acetyltransferase Complexed With A Bisu 3e-04
2x7b_A168 Crystal Structure Of The N-Terminal Acetylase Ard1 3e-04
1b6b_A174 Melatonin Biosynthesis: The Structure Of Serotonin 4e-04
2jev_A174 Crystal Structure Of Human Spermine,Spermidine Acet 8e-04
2f5i_A179 X-Ray Structure Of SpermidineSPERMINE N1-Acetyltran 0.001
2r1i_A172 Crystal Structure Of Putative Acetyltransferase (Yp 0.001
3bj7_A171 SpermineSPERMIDINE N1-Acetyltransferase From Mouse: 0.001
2pdo_A144 Crystal Structure Of The Putative Acetyltransferase 0.001
1mk4_A157 Structure Of Protein Of Unknown Function Yqjy From 0.001
2i79_A172 The Crystal Structure Of The Acetyltransferase Of G 0.002
2fxf_A170 Human SpermidineSPERMINE N1-Acetyltransferase Lengt 0.003
2b3u_A171 Human Spermine Spermidine Acetyltransferase K26r Mu 0.004
2b4d_A171 Ssat+coa+sp- Sp Disordered Length = 171 0.004
1wwz_A159 Crystal Structure Of Ph1933 From Pyrococcus Horikos 3e-04
1y9w_A140 Structural Genomics, 1.9a Crystal Structure Of An A 0.004
>gi|196049902|pdb|3DR8|A Chain A, Structure Of Ynca, A Putative Acetyltransferase From Salmonella Typhimurium With Its Cofactor Acetyl-Coa Length = 174 Back     alignment and structure 
 Score = 64.7 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 46/165 (27%), Gaps = 9/165 (5%)

Query: 15  TFANEQRVDQVAVDEVMVKAFLSTQEITDDVLHKYV-RNNVEEPLSFVRLMSFVCRDGDR 73
           T     + D  A+ E+   A L T  I +D       R    E    +     V  +   
Sbjct: 5   TIRFADKADCAAITEIYNHAVLHTAAIWNDRTVDTDNRLAWYEARQLLGYPVLVSEENGV 64

Query: 74  IVGAIRATPIQ-IGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAEFV----- 127
           + G       +    ++  +   + V   ++ +G+G +L        +  G         
Sbjct: 65  VTGYASFGDWRSFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVXVAGIE 124

Query: 128 -LIDAKHDWHKHLGF-KKPHQHQIRYAHGGGAATDWLVHIFKNNI 170
               A    H  LGF       Q+    G      +       + 
Sbjct: 125 SQNAASIRLHHSLGFTVTAQXPQVGVKFGRWLDLTFXQLQLDEHA 169
gi|71042161|pdb|1Z4E|A Chain A, Crystal Structure Of Transcriptional Regulator From Bacillus Halodurans C-125 Length = 153 Back     alignment and structure
gi|126031020|pdb|2J8M|A Chain A, Structure Of P. Aeruginosa Acetyltransferase Pa4866 Length = 172 Back     alignment and structure
>gi|62738792|pdb|1YVO|A Chain A, Hypothetical Acetyltransferase From P.Aeruginosa Pa01 Length = 172 Back     alignment and structure
>gi|78101606|pdb|2BL1|A Chain A, Crystal Structure Of A Putative Phosphinothricin Acetyltransferase (Pa4866) From Pseudomonas Aeruginosa Pac1 Length = 172 Back     alignment and structure
>gi|238537792|pdb|3F8K|A Chain A, Crystal Structure Of Protein Acetyltransferase (Pat) From Sulfolobus Solfataricus Length = 160 Back     alignment and structure
>gi|88192965|pdb|2FE7|A Chain A, The Crystal Structure Of A Probable N-Acetyltransferase From Pseudomonas Aeruginosa Length = 166 Back     alignment and structure
>gi|82408099|pdb|2BEI|A Chain A, X-Ray Structure Of Thialysine N-Acetyltransferase (Ssat2) From Homo Sapiens Length = 170 Back     alignment and structure
>gi|61680795|pdb|1YR0|A Chain A, Crystal Structure Of Phosphinothricin Acetyltransferase From Agrobacterium Tumefaciens Length = 175 Back     alignment and structure
>gi|165761077|pdb|2R8V|A Chain A, Native Structure Of N-Acetylglutamate Synthase From Neisseria Gonorrhoeae Length = 456 Back     alignment and structure
>gi|56966944|pdb|1WK4|A Chain A, Crystal Structure Of Ttk003001606 Length = 174 Back     alignment and structure
gi|20151068|pdb|1KUV|A Chain A, X-Ray Crystallographic Studies Of Serotonin N- Acetyltransferase Catalysis And Inhibition Length = 207 Back     alignment and structure
>gi|14278222|pdb|1IB1|E Chain E, Crystal Structure Of The 14-3-3 Zeta:serotonin N- Acetyltransferase Complex Length = 200 Back     alignment and structure
>gi|21730597|pdb|1L0C|A Chain A, Investigation Of The Roles Of Catalytic Residues In Serotonin N-Acetyltransferase Length = 207 Back     alignment and structure
>gi|5107555|pdb|1CJW|A Chain A, Serotonin N-Acetyltransferase Complexed With A Bisubstrate Analog Length = 166 Back     alignment and structure
>gi|301015706|pdb|2X7B|A Chain A, Crystal Structure Of The N-Terminal Acetylase Ard1 From Sulfolobus Solfataricus P2 Length = 168 Back     alignment and structure
>gi|6980559|pdb|1B6B|A Chain A, Melatonin Biosynthesis: The Structure Of Serotonin N- Acetyltransferase At 2.5 A Resolution Suggests A Catalytic Mechanism Length = 174 Back     alignment and structure
>gi|149242333|pdb|2JEV|A Chain A, Crystal Structure Of Human Spermine,Spermidine Acetyltransferase In Complex With A Bisubstrate Analog (N1- Acetylspermine-S-Coa). Length = 174 Back     alignment and structure
>gi|83755052|pdb|2F5I|A Chain A, X-Ray Structure Of SpermidineSPERMINE N1-Acetyltransferase (Sat) From Homo Sapiens Length = 179 Back     alignment and structure
>gi|158430557|pdb|2R1I|A Chain A, Crystal Structure Of Putative Acetyltransferase (Yp_831484.1) From Arthrobacter Sp. Fb24 At 1.65 A Resolution Length = 172 Back     alignment and structure
gi|203282373|pdb|3BJ7|A Chain A, SpermineSPERMIDINE N1-Acetyltransferase From Mouse: Crystal Structure Of A Ternary Complex Reveals Solvent-Mediated Spermine Binding Length = 171 Back     alignment and structure
>gi|146387120|pdb|2PDO|A Chain A, Crystal Structure Of The Putative Acetyltransferase Of Gnat Family From Shigella Flexneri Length = 144 Back     alignment and structure
>gi|30749478|pdb|1MK4|A Chain A, Structure Of Protein Of Unknown Function Yqjy From Bacillus Subtilis, Probable Acetyltransferase Length = 157 Back     alignment and structure
gi|118138240|pdb|2I79|A Chain A, The Crystal Structure Of The Acetyltransferase Of Gnat Family From Streptococcus Pneumoniae Length = 172 Back     alignment and structure
>gi|90109721|pdb|2FXF|A Chain A, Human SpermidineSPERMINE N1-Acetyltransferase Length = 170 Back     alignment and structure
>gi|88192215|pdb|2B3U|A Chain A, Human Spermine Spermidine Acetyltransferase K26r Mutant Length = 171 Back     alignment and structure
>gi|88192225|pdb|2B4D|A Chain A, Ssat+coa+sp- Sp Disordered Length = 171 Back     alignment and structure
gi|60593940|pdb|1WWZ|A Chain A, Crystal Structure Of Ph1933 From Pyrococcus Horikoshii Ot3 Length = 159 Back     alignment and structure
gi|60594187|pdb|1Y9W|A Chain A, Structural Genomics, 1.9a Crystal Structure Of An Acetyltransferase From Bacillus Cereus Atcc 14579 Length = 140 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target185 GCN5-related N-acetyltransferase [Candidatus Liberibact
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, structural 1e-06
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structural gen 3e-05
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, acetyltr 2e-04
3mgd_A157 Predicted acetyltransferase; structural genomics, PSI-2 0.003
2hv2_A 400 Hypothetical protein; PSI, protein structure initiative 1e-06
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic bios 3e-05
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwich, s 1e-04
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding moti 3e-04
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Length = 388 Back     alignment and structure
 Score = 48.3 bits (114), Expect = 1e-06
 Identities = 21/137 (15%), Positives = 43/137 (31%), Gaps = 15/137 (10%)

Query: 17  ANEQRVDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGDRIVG 76
             E +  +     +   AF    ++ +D L + +    E          +   +G+ +  
Sbjct: 9   LKEDKFREAL--RLSEYAF--QYKVDEDRLQQQITKMKE------SHEVYGIMEGENLAA 58

Query: 77  AIRATPIQI----GKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAEFV-LIDA 131
            +   P  I     K+K      +    EYR+ G    L   S   +K  G     L   
Sbjct: 59  KLHLIPFHIYIGKEKFKMGGVAGVATYPEYRRSGYVKELLQHSLQTMKKDGYTVSMLHPF 118

Query: 132 KHDWHKHLGFKKPHQHQ 148
              +++  G++      
Sbjct: 119 AVSFYRKYGWELCANLL 135
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: COA; 2.25A {Pyrococcus horikoshii} Length = 288 Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransferase (GNAT) family, structural genomics, joint center for structural genomics; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Length = 396 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for structural genomics, MCSG, structural genomics; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Length = 400 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Length = 339 Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis H37RV} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Length = 181 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

Original result of HHsearch against PDB70 database

IdentityAlignment graphLength Definition Probability
Target185 GCN5-related N-acetyltransferase [Candidatus Liberibact
2i00_A 406 Acetyltransferase, GNAT family; structural genomics, PS 99.84
2fiw_A172 GCN5-related N- acetyltransferase:aminotransferase, cla 99.84
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structural gen 99.83
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomics, PS 99.82
3dr6_A174 YNCA; acetyltransferase, csgid target, essential gene, 99.82
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzyme-inh 99.82
1tiq_A180 Protease synthase and sporulation negative regulatory p 99.82
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobu 99.82
2cnt_A160 Modification of 30S ribosomal subunit protein S18; N-al 99.81
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural genom 99.81
2hv2_A 400 Hypothetical protein; PSI, protein structure initiative 99.81
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, acetyltr 99.81
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; struct 99.81
3mgd_A157 Predicted acetyltransferase; structural genomics, PSI-2 99.8
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, structur 99.8
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, structural 99.8
2fia_A162 Acetyltransferase; structural genomics, PSI, protein st 99.8
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, acetyltr 99.8
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, polyket 99.8
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, anti 99.79
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 1.80 99.79
2fe7_A166 Probable N-acetyltransferase; structural genomics, PSI, 99.79
3lod_A162 Putative acyl-COA N-acyltransferase; structural genomic 99.78
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 famil 99.78
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu tern 99.78
2cy2_A174 TTHA1209, probable acetyltransferase; structural genomi 99.78
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A, str 99.78
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-acetyltr 99.78
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate synthas 99.78
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, structural 99.78
1vhs_A175 Similar to phosphinothricin acetyltransferase; structur 99.77
3efa_A147 Putative acetyltransferase; structural genomics, PSI-2, 99.77
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/ 99.77
1u6m_A199 Acetyltransferase, GNAT family; structural genomics, PS 99.77
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural genomi 99.77
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, GNAT f 99.77
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1 99.77
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral genomics 99.76
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, stru 99.76
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE, ace 99.76
3i3g_A161 N-acetyltransferase; malaria, structural genomics, stru 99.75
3jvn_A166 Acetyltransferase; alpha-beta protein, structural genom 99.75
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwich, s 99.75
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron cass 99.74
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coenzyme 99.74
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; puta 99.74
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, COA, ribos 99.74
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltransfe 99.73
3dsb_A157 Putative acetyltransferase; APC60368.2, structural geno 99.73
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {B 99.72
3fix_A183 N-acetyltransferase; termoplasma acidophilum, structura 99.72
2i6c_A160 Putative acetyltransferase; GNAT family, structural gen 99.72
1y9w_A140 Acetyltransferase; structural genomics, protein structu 99.71
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase; acy 99.71
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, 99.71
3kkw_A182 Putative uncharacterized protein; acetyltransferase, GN 99.71
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; structural 99.71
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- acetyl 99.71
2g3a_A152 Acetyltransferase; ACETYLFTRANSFERASE, structural genom 99.7
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, structural 99.7
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, RIMI 99.7
2b5g_A171 Diamine acetyltransferase 1; structural genomics, PSI, 99.69
2ge3_A170 Probable acetyltransferase; structural genomics, PSI, p 99.69
2qec_A204 Histone acetyltransferase HPA2 and related acetyltransf 99.69
2ozh_A142 Hypothetical protein XCC2953; NP_638301.1, structural g 99.69
1on0_A158 YYCN protein; structural genomics, alpha-beta protein w 99.68
1wwz_A159 Hypothetical protein PH1933; structural genomics, riken 99.67
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransferase, 99.66
2eui_A153 Probable acetyltransferase; dimer, structural genomics, 99.65
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A putat 99.65
3exn_A160 Probable acetyltransferase; GCN5-related N-acetyltransf 99.65
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, structural 99.65
1y7r_A133 Hypothetical protein SA2161; structural genomics, prote 99.64
2jlm_A182 Putative phosphinothricin N-acetyltransferase; methioni 99.64
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, putative 99.64
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GCN5-re 99.64
3ey5_A181 Acetyltransferase-like, GNAT family; structural genomic 99.63
3iwg_A276 Acetyltransferase, GNAT family; structural genomics, AP 99.63
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding moti 99.62
2aj6_A159 Hypothetical protein MW0638; acetyltransferase (GNAT) f 99.62
1xeb_A150 Hypothetical protein PA0115; midwest center for structu 99.61
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, acyl 99.61
3h4q_A188 Putative acetyltransferase; NP_371943.1, structural gen 99.61
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha-beta 99.61
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltr 99.6
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic bios 99.58
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, putat 99.57
2fl4_A149 Spermine/spermidine acetyltransferase; structural genom 99.57
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, stru 99.57
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, acetyltr 99.56
1vkc_A158 Putative acetyl transferase; structural genomics, south 99.55
3frm_A254 Uncharacterized conserved protein; APC61048, structural 99.55
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltransfera 99.54
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyltrans 99.52
3ec4_A228 Putative acetyltransferase from the GNAT family; YP_497 99.52
1y9k_A157 IAA acetyltransferase; structural genomics, midwest cen 99.52
1sqh_A312 Hypothetical protein CG14615-PA; structural genomics, P 99.5
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase, COA 99.49
3owc_A188 Probable acetyltransferase; structural genomics, PSI-2, 99.48
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; PSI, 99.39
1nsl_A184 Probable acetyltransferase; structural genomics, hexame 99.37
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransferase, G 99.32
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransferase, 99.3
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroqu 99.28
1yre_A197 Hypothetical protein PA3270; APC5563, midwest center fo 99.24
2fck_A181 Ribosomal-protein-serine acetyltransferase, putative; s 99.23
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062,meth 99.21
1s7k_A182 Acetyl transferase; GNAT, coenzyme A; 1.80A {Salmonella 99.2
3eg7_A176 Spermidine N1-acetyltransferase; structural genomics, I 99.18
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, legion 99.17
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha/beta 99.14
2qml_A198 BH2621 protein; NP_243487.1, uncharacterized protein BH 99.12
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltransfera 99.11
2fsr_A195 Acetyltranferase; alpha-beta-sandwich, structural genom 99.05
3fbu_A168 Acetyltransferase, GNAT family; structural genomics, PS 98.95
3juw_A175 Probable GNAT-family acetyltransferase; structural geno 98.95
2zw5_A 301 Bleomycin acetyltransferase; dimer, two domains; HET: C 98.92
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, protein-pr 98.84
1ro5_A201 Autoinducer synthesis protein LASI; alpha-beta-alpha sa 98.71
1yle_A 342 Arginine N-succinyltransferase, alpha chain; structural 98.23
1kzf_A230 Acyl-homoserinelactone synthase ESAI; alpha-beta, autoi 97.89
3iu1_A 383 Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyl 97.4
2wuu_A 421 N-myristoyltransferase; acyltransferase; HET: NHM; 1.42 96.84
1iic_A 422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccha 96.58
1iyk_A 392 Myristoyl-COA:protein N-myristoyltransferase; HET: MYA 96.41
2d4p_A141 Hypothetical protein TTHA1254; structural genomics, NPP 95.94
1iyk_A392 Myristoyl-COA:protein N-myristoyltransferase; HET: MYA 95.93
2wuu_A421 N-myristoyltransferase; acyltransferase; HET: NHM; 1.42 95.84
3iu1_A383 Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyl 95.81
1iic_A422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccha 95.1
1rxt_A 496 Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; 94.92
3gkr_A336 FEMX; peptidoglycan, hexapeptide, transferase; HET: UDP 93.91
1lrz_A426 FEMA, factor essential for expression of methicillin re 92.16
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, structural 99.67
2gan_A190 182AA long hypothetical protein; alpha-beta protein., s 99.57
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-acetyl 99.54
1z4r_A168 General control of amino acid synthesis protein 5-like 99.52
1ygh_A164 ADA4, protein (transcriptional activator GCN5); transcr 99.46
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic bios 99.27
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP protein, 99.23
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, acetyl 99.14
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltransfera 98.98
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enzyme, 98.66
3dns_A135 Ribosomal-protein-alanine acetyltransferase; MCSG, PSI, 97.95
2q04_A211 Acetoin utilization protein; ZP_00540088.1, structural 97.57
1xmt_A103 Putative acetyltransferase; structural genomics, protei 97.2
2p0w_A324 Histone acetyltransferase type B catalytic subunit; HAT 96.84
2ou2_A280 Histone acetyltransferase htatip; structural genomics, 96.74
1bob_A320 HAT1, histone acetyltransferase; histone modification, 96.62
2ozu_A284 Histone acetyltransferase MYST3; structural genomics, s 96.12
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, structur 96.04
1fy7_A278 ESA1 histone acetyltransferase; coenzyme A; HET: COA; 2 95.71
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.30A {Enterococcus faecalis V583} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
Probab=99.84  E-value=1.2e-20  Score=143.29  Aligned_cols=137  Identities=12%  Similarity=0.134  Sum_probs=102.8

Q ss_pred             CCCEEECCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEHHHHHCHH-CCCCCCCEEEEEEEECCEEEEEEEEEEEEECC--
Q ss_conf             002075137975789999999997278766675615202541200-02576654899998987864799999988606--
Q gi|254780989|r   11 LEGLTFANEQRVDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVE-EPLSFVRLMSFVCRDGDRIVGAIRATPIQIGK--   87 (185)
Q Consensus        11 ~~~l~IR~a~~~D~~aI~~L~~~aF~~~~~~~~~~~~~~~~~~~~-~~~~~~~~l~~Vae~d~~iVG~i~~~~~~~~~--   87 (185)
                      .+.|+||+++++|.+++.+|...+|.................... ..........+|++++|+|||++.+.|..+.-  
T Consensus         7 ~~~m~IR~~~~~D~~~i~~L~~~aF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vg~~~~~~~~~~~~g   86 (406)
T 2i00_A            7 RKQLTLKPVEEEHIDQFNELLSYVFQVTEADIEESGFENKRAFIKSKQPILELSKVFGWFHENQLISQIAIYPCEVNIHG   86 (406)
T ss_dssp             ---CEEEECCGGGHHHHHHHHHHHCCCCHHHHHHTTCSSHHHHHHTTHHHHHHSEEEEEEETTEEEEEEEEEEEEEEETT
T ss_pred             CCCCEEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEEEECCEEEEEEEEEEEEEEECC
T ss_conf             89839999999999999999999708553442223303378898742301366738999999999999999980788998


Q ss_pred             --CCEEEEEEEEECHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEC-CHHHHHHCCCEEHHHC
Q ss_conf             --78489986775254615998999999999999988997999950-8325431385870527
Q gi|254780989|r   88 --YKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAEFVLIDA-KHDWHKHLGFKKPHQH  147 (185)
Q Consensus        88 --~~~~~l~~laV~P~~qg~GiG~~Li~~~l~~a~~~G~~~v~l~~-~~~~Y~r~GF~~~~~~  147 (185)
                        .+...|+.|+|+|+|||||+|++||+++++.++++|+..++|.. ++.||+||||..+..+
T Consensus        87 ~~~~~~~i~~v~v~p~~rg~G~~~~L~~~~~~~~~~~g~~~~~l~~~~~~~Y~~~Gf~~~~~~  149 (406)
T 2i00_A           87 ALYKMGGVTGVGTYPEYANHGLMKDLIQTALEEMRQDKQWISYLFPYNIPYYRRKGWEIMSDK  149 (406)
T ss_dssp             EEEEEEEEEEEEECGGGTTSCHHHHHHHHHHHHHHHTTCCEEEECCSCHHHHHHTTCEEEEEE
T ss_pred             EEEEEEEEEEEEECHHHCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHCCCCEEECCE
T ss_conf             575687899999998987798789999999999997498289954766236871794783217
>2fiw_A GCN5-related N- acetyltransferase:aminotransferase, class-II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase; HET: ACO; 2.35A {Rhodopseudomonas palustris CGA009} SCOP: d.108.1.1 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics; HET: MSE; 1.75A {Salmonella typhimurium} PDB: 3dr8_A* Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal protein, acetyltransferase; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for structural genomics, MCSG, structural genomics; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural genomics, joint center for structural genomics, JCSG; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis V583} SCOP: d.108.1.1 Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransferase (GNAT) family, structural genomics, joint center for structural genomics; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketide synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula 19L} PDB: 2ref_A* Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, protein structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus HB8} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structural genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structural genomics, PSI; HET: GOL; 2.19A {Enterococcus faecalis V583} SCOP: d.108.1.1 Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure initiative; 2.01A {Streptococcus pneumoniae TIGR4} SCOP: d.108.1.1 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, protein structure initiative; 2.00A {Bacillus halodurans c-125} SCOP: d.108.1.1 Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.00A {Shigella flexneri 2a str} Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.61A {Vibrio fischeri ES114} Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, COA, ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.48A {Clostridium difficile 630} Back     alignment and structure