RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780989|ref|YP_003065402.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] (185 letters) >gnl|CDD|32967 COG3153, COG3153, Predicted acetyltransferase [General function prediction only]. Length = 171 Score = 79.9 bits (197), Expect = 3e-16 Identities = 37/161 (22%), Positives = 66/161 (40%), Gaps = 10/161 (6%) Query: 19 EQRVDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGDRIVGAI 78 E D A++ + +AF +E + + + E +S V D +VG I Sbjct: 9 ETPADIPAIEALTREAFGPGREA-------KLVDKLREGGRPDLTLSLVAEDDGEVVGHI 61 Query: 79 RATPIQIG--KYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAEFVLIDAKHDWH 136 +P+ +G + PL V EY+ +GIGS L A++ +GA V++ ++ Sbjct: 62 LFSPVTVGGEELGWLGLAPLAVDPEYQGQGIGSALVREGLEALRLAGASAVVVLGDPTYY 121 Query: 137 KHLGFKKPHQHQIRYAHGGGAATDWLVHIFKNNIMENMIGK 177 GF+ ++ YA G +L + +E G Sbjct: 122 SRFGFEPAAGAKL-YAPGPVPDERFLALELGDGALEGPSGT 161 >gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included. Length = 65 Score = 43.8 bits (104), Expect = 3e-05 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query: 65 SFVCRDGDRIVGAIRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRL 111 V D IVG +P G ++ G L VL EYR +GIGS L Sbjct: 1 FLVAEDDGEIVGFASLSPDGSGGDTAYI-GDLAVLPEYRGKGIGSAL 46 >gnl|CDD|144249 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins. Length = 80 Score = 43.0 bits (102), Expect = 5e-05 Identities = 19/80 (23%), Positives = 32/80 (40%), Gaps = 7/80 (8%) Query: 69 RDGDRIVGAIRATPIQIGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAEFVL 128 + +VG + I + G L V EYR +GIG+ L + G + + Sbjct: 2 EEDGELVGFASLSIIDEEGNVAEIEG-LAVDPEYRGKGIGTALLEALEEYARELGLKRIE 60 Query: 129 IDAKHD------WHKHLGFK 142 ++ D ++ LGFK Sbjct: 61 LEVLEDNEAAIALYEKLGFK 80 >gnl|CDD|38349 KOG3139, KOG3139, KOG3139, N-acetyltransferase [General function prediction only]. Length = 165 Score = 38.4 bits (89), Expect = 0.001 Identities = 37/156 (23%), Positives = 65/156 (41%), Gaps = 23/156 (14%) Query: 22 VDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLS------FVRL---MSFVCRDGD 72 V +++ L E + + + ++ EP S FV F+ D Sbjct: 6 ESDEWVLAEVIRPSLYPAEEYLADIMRLIDKDLSEPYSIYTYRYFVPNWPCFCFLALDEK 65 Query: 73 RI-VGAIRATPIQIGKYKGFLRGPLGVL---SEYRKRGIGSRLAYMSFMAIKNSGAEFVL 128 VGAI ++ ++ LRG + +L SEYR +GIG L + A+++ G V+ Sbjct: 66 GDTVGAI---VCKLDTHRNTLRGYIAMLAVDSEYRGQGIGKALVRKAIDAMRSRGYSEVV 122 Query: 129 ID------AKHDWHKHLGFKKPHQHQIRYAHGGGAA 158 ++ + ++ LGFK+ + RY G A Sbjct: 123 LETEVTNLSALRLYESLGFKRDKR-LFRYYLNGMDA 157 >gnl|CDD|30804 COG0456, RimI, Acetyltransferases [General function prediction only]. Length = 177 Score = 32.7 bits (73), Expect = 0.057 Identities = 32/157 (20%), Positives = 58/157 (36%), Gaps = 12/157 (7%) Query: 17 ANEQRVDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGDRIVG 76 A + + VA+ + + F + + K + E L ++VG Sbjct: 17 AINKDLLDVALAALEARTFDIRLPWSREYFEKDLTQA-PELLLVAETGGLDGLLDGKVVG 75 Query: 77 AIRATPIQIGKYKGFLRGP---LGVLSEYRKRGIGSRLAYMSFMAIKNSG-AEFVLIDAK 132 + + G+ G L V EYR RGIG L + ++ G A+ ++++ + Sbjct: 76 FLLVRVV-DGRPSADHEGHIYNLAVDPEYRGRGIGRALLDEALERLRERGLADKIVLEVR 134 Query: 133 HD------WHKHLGFKKPHQHQIRYAHGGGAATDWLV 163 ++ LGF+ + YA G G A L Sbjct: 135 ESNEAAIGLYRKLGFEVVKIRKNYYADGNGDALLMLK 171 >gnl|CDD|38348 KOG3138, KOG3138, KOG3138, Predicted N-acetyltransferase [General function prediction only]. Length = 187 Score = 30.0 bits (67), Expect = 0.44 Identities = 22/72 (30%), Positives = 30/72 (41%), Gaps = 8/72 (11%) Query: 48 KYVRNNVEEPLSFVRLMSFVCRDGDRIVGAIRATPIQIGKYKGFLRGP-------LGVLS 100 YV + LS L + + VGA+ I+ + L G LGVL Sbjct: 41 SYVDKFYPDVLSNGDLTQLAYYN-EIAVGAVACKLIKFVQNAKRLFGNRVIYILSLGVLP 99 Query: 101 EYRKRGIGSRLA 112 YR +GIGS+L Sbjct: 100 RYRNKGIGSKLL 111 >gnl|CDD|31439 COG1246, ArgA, N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism]. Length = 153 Score = 29.1 bits (65), Expect = 0.71 Identities = 25/117 (21%), Positives = 41/117 (35%), Gaps = 9/117 (7%) Query: 28 DEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGDRIVGAIRATPIQIGK 87 D + + E+ +L + EE F + +++G A + + Sbjct: 10 DIPAILELIRPLELQGILLRRSREQLEEEIDDFT-----IIERDGKVIGCA-ALHPVLEE 63 Query: 88 YKGFLRGPLGVLSEYRKRGIGSRLAYMSFMAIKNSGAE--FVLIDAKHDWHKHLGFK 142 G LR L V +YR G G RL + G + FVL ++ GF Sbjct: 64 DLGELRS-LAVHPDYRGSGRGERLLERLLADARELGIKELFVLTTRSPEFFAERGFT 119 >gnl|CDD|112855 pfam04057, Rep-A_N, Replication factor-A protein 1, N-terminal domain. Length = 100 Score = 26.9 bits (60), Expect = 3.0 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 9/47 (19%) Query: 32 VKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVC---RDGDRIV 75 KA L+TQ L+ V + + S V+L + ++G RI+ Sbjct: 50 SKAMLATQ------LNSLVISGKLQNGSIVQLTDYTVNDIKEGRRIL 90 >gnl|CDD|133286 cd01886, EF-G, Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group contains both eukaryotic and bacterial members. Length = 270 Score = 26.7 bits (60), Expect = 4.2 Identities = 9/36 (25%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query: 17 ANEQRVDQVA-VDEVMVKAFLSTQEITDDVLHKYVR 51 A E+ ++ +A D+ +++ +L +EIT++ + +R Sbjct: 199 AREELIETLAEFDDELMEKYLEGEEITEEEIKAAIR 234 >gnl|CDD|38445 KOG3235, KOG3235, KOG3235, Subunit of the major N alpha-acetyltransferase [General function prediction only]. Length = 193 Score = 26.1 bits (57), Expect = 5.8 Identities = 26/106 (24%), Positives = 41/106 (38%), Gaps = 13/106 (12%) Query: 64 MSFVCRD-GDRIVGAIRAT---PIQIGKYKGFLRGPLGVLSEYRKRGIGSRLAYMSFMA- 118 +S+V D +IVG + A G + L V YR+ G+ +L + A Sbjct: 42 LSYVAEDENGKIVGYVLAKMEEDPDDEPPHGHITS-LAVKRSYRRLGLAQKLMNQASRAM 100 Query: 119 IKNSGAEFVLI-------DAKHDWHKHLGFKKPHQHQIRYAHGGGA 157 ++ A++V + A H + LGF YA G A Sbjct: 101 VEVYEAKYVSLHVRKSNRAALHLYKNTLGFVVCEVEPKYYADGEDA 146 >gnl|CDD|33130 COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 1061 Score = 26.2 bits (57), Expect = 5.9 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Query: 69 RDGDRIVGAIRAT-PIQIGKYKGF 91 RDGDRI IR + Q G+ G Sbjct: 254 RDGDRIYAVIRGSAVNQDGRSNGL 277 >gnl|CDD|33892 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 213 Score = 26.1 bits (57), Expect = 6.6 Identities = 12/68 (17%), Positives = 23/68 (33%), Gaps = 6/68 (8%) Query: 13 GLTFANEQRVDQVAVDEVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSFVCRDGD 72 G+ F + ++V + ++ A + + RN L L +D Sbjct: 80 GILFQDALLFPHLSVGQNLLFA------LPATLKGNARRNAANAALERSGLDGAFHQDPA 133 Query: 73 RIVGAIRA 80 + G RA Sbjct: 134 TLSGGQRA 141 >gnl|CDD|29420 cd00833, PKS, polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations. PKSs can be divided into 2 groups, modular type I PKSs consisting of one or more large multifunctional proteins and iterative type II PKSs, complexes of several monofunctional subunits.. Length = 421 Score = 25.5 bits (56), Expect = 9.2 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Query: 69 RDGDRIVGAIRATPI-QIGKYKG 90 RDGDRI IR + + Q G+ KG Sbjct: 250 RDGDRIYAVIRGSAVNQDGRTKG 272 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.139 0.416 Gapped Lambda K H 0.267 0.0750 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,275,654 Number of extensions: 117284 Number of successful extensions: 202 Number of sequences better than 10.0: 1 Number of HSP's gapped: 200 Number of HSP's successfully gapped: 18 Length of query: 185 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 97 Effective length of database: 4,362,145 Effective search space: 423128065 Effective search space used: 423128065 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.5 bits)