RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780990|ref|YP_003065403.1| hypothetical protein CLIBASIA_04455 [Candidatus Liberibacter asiaticus str. psy62] (66 letters) >gnl|CDD|37440 KOG2229, KOG2229, KOG2229, Protein required for actin cytoskeleton organization and cell cycle progression [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton]. Length = 616 Score = 24.9 bits (54), Expect = 5.0 Identities = 8/42 (19%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query: 9 IDDLFEEDLFQYDANKSELVLISSLWSIDFF-EINCALLRRR 49 + + +DL Y +K ++V++++ I + E+ +L ++ Sbjct: 350 MTEELLQDLASYKTSKKKVVMMAARSLIALYREVLPDMLIKK 391 >gnl|CDD|30502 COG0153, GalK, Galactokinase [Carbohydrate transport and metabolism]. Length = 390 Score = 24.5 bits (53), Expect = 7.8 Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 16 DLFQYDANKSELVLISSLWSIDFFEINCALLR 47 LF +K+EL I+ + F +NC ++ Sbjct: 146 RLFNLPLDKAELAKIAQVAENQFVGVNCGIMD 177 >gnl|CDD|185751 cd09238, V_Alix_like_1, Protein-interacting V-domain of an uncharacterized family of the V_Alix_like superfamily. This domain family is comprised of uncharacterized plant proteins. It belongs to the V_Alix_like superfamily which includes the V-shaped (V) domains of Bro1 and Rim20 (also known as PalA) from Saccharomyces cerevisiae, mammalian Alix (apoptosis-linked gene-2 interacting protein X), (His-Domain) type N23 protein tyrosine phosphatase (HD-PTP, also known as PTPN23), and related domains. Alix, also known as apoptosis-linked gene-2 interacting protein 1 (AIP1), participates in membrane remodeling processes during the budding of enveloped viruses, vesicle budding inside late endosomal multivesicular bodies (MVBs), and the abscission reactions of mammalian cell division. It also functions in apoptosis. HD-PTP functions in cell migration and endosomal trafficking, Bro1 in endosomal trafficking, and Rim20 in the response to the external pH via the Rim101 pathway. Alix, HD-PTP, Bro1, and Rim20 all interact with the ESCRT (Endosomal Sorting Complexes Required for Transport) system. The mammalian Alix V-domain (belonging to a different family) contains a binding site, partially conserved in the superfamily, for the retroviral late assembly (L) domain YPXnL motif. The Alix V-domain is also a dimerization domain. In addition to this V-domain, members of the V_Alix_Rim20_Bro1_like superfamily also have an N-terminal Bro1-like domain, which binds components of the ESCRT-III complex. The Bro1-like domains of Alix and HD-PTP can also bind to human immunodeficiency virus type 1 (HIV-1) nucleocapsid. Many members of the V_Alix_like superfamily also have a proline-rich region (PRR). Length = 339 Score = 24.0 bits (52), Expect = 8.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Query: 7 DGIDDLFEEDLFQYDANKSEL 27 D LF+E+L +YD+ + + Sbjct: 236 GSYDALFKEELKKYDSVREAV 256 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.144 0.442 Gapped Lambda K H 0.267 0.0713 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 884,923 Number of extensions: 35552 Number of successful extensions: 101 Number of sequences better than 10.0: 1 Number of HSP's gapped: 101 Number of HSP's successfully gapped: 5 Length of query: 66 Length of database: 6,263,737 Length adjustment: 37 Effective length of query: 29 Effective length of database: 5,464,204 Effective search space: 158461916 Effective search space used: 158461916 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (23.5 bits)