BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780990|ref|YP_003065403.1| hypothetical protein CLIBASIA_04455 [Candidatus Liberibacter asiaticus str. psy62] (66 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780990|ref|YP_003065403.1| hypothetical protein CLIBASIA_04455 [Candidatus Liberibacter asiaticus str. psy62] Length = 66 Score = 136 bits (342), Expect = 7e-35, Method: Compositional matrix adjust. Identities = 66/66 (100%), Positives = 66/66 (100%) Query: 1 MFLVPDDGIDDLFEEDLFQYDANKSELVLISSLWSIDFFEINCALLRRRHPINKYEKTDN 60 MFLVPDDGIDDLFEEDLFQYDANKSELVLISSLWSIDFFEINCALLRRRHPINKYEKTDN Sbjct: 1 MFLVPDDGIDDLFEEDLFQYDANKSELVLISSLWSIDFFEINCALLRRRHPINKYEKTDN 60 Query: 61 FFALYT 66 FFALYT Sbjct: 61 FFALYT 66 >gi|255764516|ref|YP_003084344.1| hypothetical protein CLIBASIA_05532 [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Score = 25.8 bits (55), Expect = 0.16, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 18/30 (60%) Query: 5 PDDGIDDLFEEDLFQYDANKSELVLISSLW 34 PD +++L E F+ D ++S L+L S W Sbjct: 40 PDGNMEELSPERDFKVDVDESSLILSSKRW 69 >gi|254780158|ref|YP_003064571.1| phosphoribosylaminoimidazole carboxylase ATPase subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 354 Score = 23.5 bits (49), Expect = 0.76, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 10/33 (30%) Query: 10 DDLFEEDLFQYDANKSELVLISSLWSIDFFEIN 42 D L+E+ FQ S L ++DF+EIN Sbjct: 101 DRLYEKKFFQE----------SGLTTVDFYEIN 123 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.144 0.442 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,220 Number of Sequences: 1233 Number of extensions: 1343 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 66 length of database: 328,796 effective HSP length: 37 effective length of query: 29 effective length of database: 283,175 effective search space: 8212075 effective search space used: 8212075 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 31 (16.5 bits)