HHsearch results for GI: 254780992 and protein with PDBid: 3dkz_A

>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis}
Probab=99.37  E-value=6.6e-12  Score=88.08  Aligned_cols=105  Identities=19%  Similarity=0.253  Sum_probs=84.8

Q ss_pred             CCCCCEEEEEEECHHHCCCCCCEEHHHHHHHHHHHHHHHHHHHC-CCCCEEEEEEEEEEECCCCCCCEEEEEEEEEEECC
Q ss_conf             89983489998483342747843089999999999999999973-89832557520343214675738999999996216
Q gi|254780992|r   28 HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLC-KCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGK  106 (152)
Q Consensus        28 ~~~~~~~l~~~~~P~~~N~~G~lfGG~ll~~~D~aa~~~A~~~~-~~~~vt~~id~i~F~~Pv~~Gd~l~~~a~V~~~G~  106 (152)
                      -++|.+.++..+.|.++|..|.+|||.++.++|.+++.++.... ....+|+.+ +++|++|++ |+ +.++|++.+.||
T Consensus        26 ~~~g~~~~~~~v~~~~~n~~G~~HGG~l~tl~D~a~g~a~~~~~~~~~~~T~~l-~i~flrp~~-g~-l~~~a~v~~~gr  102 (142)
T 3dkz_A           26 SGNGTARTRLPARADLVNSRGDIHGGTLMSVLDFTLGAAIRGDTPEVGVATIDM-NTSFMSPGR-GD-LVIETRCLRRGA  102 (142)
T ss_dssp             EETTEEEEEECCCSTTBCSSSSBCHHHHHHHHHHHHHHTTTTSCTTSCEEEEEE-EEEECSCCC-SC-EEEEEEEEEECS
T ss_pred             EECCEEEEEEECCHHHCCCCCCEEEEEEEEEHHHHHHHHHHHCCCCCCEEEEEE-EEEEECCCC-CC-EEEEEEEEEECC
T ss_conf             969999999998999939999697000212011223456650277552255778-899967878-88-999999999688


Q ss_pred             CEEEEEEEEEEECCCCCCCEEEEEEEEEEEEEEECC
Q ss_conf             507999999995377888608999999999999878
Q gi|254780992|r  107 TSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE  142 (152)
Q Consensus       107 tSm~V~V~V~~~~~~~~~~~~~~v~~a~fTfVavDe  142 (152)
                      +...++++++.+     ++  ++++++..||--++.
T Consensus       103 ~~~~~~~~i~~~-----~g--~lvA~a~~t~~i~~~  131 (142)
T 3dkz_A          103 SIAFCEGEIRDS-----AG--ELVAKATATFKIIQR  131 (142)
T ss_dssp             SEEEEEEEEEET-----TC--CEEEEEEEEEEECC-
T ss_pred             CEEEEEEEEEEC-----CC--CEEEEEEEEEEEECC
T ss_conf             799999999979-----99--999999999999588