HHSEARCH alignment of GI: 254780992 and SCOP domain: d2owna1

Alignment
>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]}
Probab=99.00  E-value=1.7e-08  Score=66.76  Aligned_cols=115  Identities=10%  Similarity=-0.025  Sum_probs=92.5

Q ss_pred             CCEEEEEEECHHHCCCCCCEEHHHHHHHHHHHHHHHHHHHC-------CCCCE-EEEEEEEEEECCCCCCCEEEEEEEEE
Q ss_conf             83489998483342747843089999999999999999973-------89832-55752034321467573899999999
Q gi|254780992|r   31 GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLC-------KCRVV-TKAVTELLFEKPIQVSDLVHIYTQIR  102 (152)
Q Consensus        31 ~~~~l~~~~~P~~~N~~G~lfGG~ll~~~D~aa~~~A~~~~-------~~~~v-t~~id~i~F~~Pv~~Gd~l~~~a~V~  102 (152)
                      +--+.+..+...|++..|.++=+.++.|+++++..-.....       +.... .+.=-.+.|.+|+..||.|++..++.
T Consensus         7 ~~f~~~~~Vr~~d~D~~g~v~~~~y~~~~~~a~~~~~~~~g~~~~~~~~~~~~~vv~~~~i~y~~~~~~~d~l~V~t~~~   86 (147)
T d2owna1           7 SLYSEQHRITYYECDRTGRATLTTLIDIAVLASEDQSDALGLTTEMVQSHGVGWVVTQYAIDITRMPRQDEVVTIAVRGS   86 (147)
T ss_dssp             CCEEEEEECCGGGBCTTSBBCHHHHHHHHHHHHHHHHHHTTCCHHHHHTTTEEEEEEEEEEEESSCCBTTCEEEEEEEEE
T ss_pred             CEEEEEEEECHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCCEEEEEEEEEEEECCCCCCCEEEEEEEEE
T ss_conf             74999999898992999929789999999999999998855560344315531688888732704640587987799885


Q ss_pred             EECCCEEEEEEEEEEECCCCCCCEEEEEEEEEEEEEEEC-CCCCCCCCCCC
Q ss_conf             621650799999999537788860899999999999987-89880227999
Q gi|254780992|r  103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVD-EKGNPKSIRTE  152 (152)
Q Consensus       103 ~~G~tSm~V~V~V~~~~~~~~~~~~~~v~~a~fTfVavD-e~g~P~pip~e  152 (152)
                      ..|++++....+++.     .++  +.+++|..++|.+| +.+||.++|+|
T Consensus        87 ~~~~~~~~~~~~i~~-----~~g--~~~a~~~~~~v~id~~~rr~~~ip~~  130 (147)
T d2owna1          87 AYNPYFAYREFWIRD-----ADG--QQLAYITSIWVMMSQTTRRIVKILPE  130 (147)
T ss_dssp             EECSSCEEEEEEEEC-----TTC--CEEEEEEEEEEEEETTTCSEECCCGG
T ss_pred             ECCCCEEEEEEEEEE-----CCC--CEEEEEEEEEEEEECCCCCCCCCCHH
T ss_conf             258758999999995-----899--88887999999999999968479999


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: Acyl-ACP thioesterase-like
domain: Putative oleoyl-ACP thioesterase LP0708
species: Lactobacillus plantarum [TaxId: 1590]