BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780992|ref|YP_003065405.1| acyl-CoA hydrolase [Candidatus
Liberibacter asiaticus str. psy62]
         (152 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780992|ref|YP_003065405.1| acyl-CoA hydrolase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040669|gb|ACT57465.1| acyl-CoA hydrolase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 152

 Score =  310 bits (794), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%)

Query: 1   MVDISKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQID 60
           MVDISKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQID
Sbjct: 1   MVDISKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQID 60

Query: 61  IACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPR 120
           IACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPR
Sbjct: 61  IACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPR 120

Query: 121 NASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           NASSDVLQKTCEATVVMVAVDEKGNPKSIRTE
Sbjct: 121 NASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152


>gi|315122485|ref|YP_004062974.1| acyl-CoA hydrolase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495887|gb|ADR52486.1| acyl-CoA hydrolase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 132

 Score =  190 bits (482), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (85%), Gaps = 1/125 (0%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           ++HSSG LTLK+QTMPTD+N+DGN+FGGWIMSQID+ACGI AS++ K RVVTKAV ELLF
Sbjct: 4   RLHSSGKLTLKVQTMPTDINIDGNIFGGWIMSQIDLACGICASEVAKSRVVTKAVKELLF 63

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           EKP+ V DLVHIYT +R IG+TS+TIYCDVWT  RNA  D LQKT EAT +MVAVD++G 
Sbjct: 64  EKPVYVGDLVHIYTDVRAIGRTSITIYCDVWTSTRNA-LDCLQKTSEATFIMVAVDKQGV 122

Query: 146 PKSIR 150
           P+ I+
Sbjct: 123 PQPIK 127


>gi|15889285|ref|NP_354966.1| acyl-CoA hydrolase [Agrobacterium tumefaciens str. C58]
 gi|15157118|gb|AAK87751.1| acyl-CoA hydrolase [Agrobacterium tumefaciens str. C58]
          Length = 130

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 82/123 (66%), Gaps = 2/123 (1%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           +  +G LTL+   MP D N  G++FGGW+MSQ+D+A GIRA++  +CRVVT AV E+ FE
Sbjct: 6   IKPTGELTLRTLAMPADANPAGDIFGGWVMSQMDLASGIRAAERSRCRVVTAAVKEMAFE 65

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            P+++ D + IYT I ++G+TS+T+  + W   + +  D L+K    T +MVA+DE G P
Sbjct: 66  LPVKIGDTLSIYTDIARLGRTSITLTVEAWA--QRSRYDKLEKVTAGTFIMVAMDENGQP 123

Query: 147 KSI 149
             I
Sbjct: 124 TPI 126


>gi|325293361|ref|YP_004279225.1| Acyl-CoA hydrolase [Agrobacterium sp. H13-3]
 gi|325061214|gb|ADY64905.1| Acyl-CoA hydrolase [Agrobacterium sp. H13-3]
          Length = 130

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 82/123 (66%), Gaps = 2/123 (1%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           +  +G LTL+   MP D N  G++FGGW+MSQ+D+A GIRA++  +CRVVT AV E+ FE
Sbjct: 6   IKPTGELTLRTLAMPADANPAGDIFGGWVMSQMDLASGIRAAERSRCRVVTAAVKEMAFE 65

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            P+++ D + IYT I ++G+TS+T+  + W   + +  D L+K    T +MVA+DE G P
Sbjct: 66  LPVKIGDTLSIYTDIARLGRTSITLTVEAWA--QRSRYDKLEKVTAGTFIMVAMDENGQP 123

Query: 147 KSI 149
             I
Sbjct: 124 TPI 126


>gi|319781937|ref|YP_004141413.1| thioesterase superfamily protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167825|gb|ADV11363.1| thioesterase superfamily protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 131

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LTL+   MP+D N  G++FGGW+M+Q+D+ACGIRA++  K RVVT AV E+ F KP++
Sbjct: 11  GDLTLRTLAMPSDANAAGDIFGGWVMAQMDLACGIRAAERAKGRVVTAAVKEMSFAKPMK 70

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           + D + IYT + ++G+TS+T+  + W   +   SD+++K   A  VMVA+D +G PK++ 
Sbjct: 71  IGDTLCIYTHVERVGRTSMTLKVEAWA--QRYLSDLMEKVTHADFVMVALDGEGKPKAVP 128

Query: 151 TE 152
            E
Sbjct: 129 AE 130


>gi|209549772|ref|YP_002281689.1| thioesterase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535528|gb|ACI55463.1| thioesterase superfamily protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 128

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 83/130 (63%), Gaps = 2/130 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M       G LTL+   MP D N  G++FGGW+M+Q+D+A GIRA++  K RVVT AV E
Sbjct: 1   MTDAAKPRGELTLRTLAMPGDANPAGDIFGGWVMAQMDLASGIRAAERAKGRVVTAAVKE 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + FE P+++ D + +YT I ++G+TS+T+  + W     A    ++K   AT +MVA+DE
Sbjct: 61  MAFELPVKIGDTMSVYTDIERVGRTSITLIVEAWA--HRARYAKMEKVTAATFIMVALDE 118

Query: 143 KGNPKSIRTE 152
           +G PK++  E
Sbjct: 119 EGKPKAVPEE 128


>gi|327192693|gb|EGE59631.1| putative acyl-CoA hydrolase protein [Rhizobium etli CNPAF512]
          Length = 127

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 84/129 (65%), Gaps = 2/129 (1%)

Query: 24  VCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTEL 83
           + +    G LTL+   MP D N  G++FGGW+M+Q+D+A GIRA++  + RVVT AV E+
Sbjct: 1   MTEAKPRGELTLRTLAMPGDANPAGDIFGGWVMAQMDLASGIRAAERARGRVVTAAVKEM 60

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEK 143
            FE P+++ D + +YT I ++G+TS+T+  + W     A    ++K   AT +MVA+DE+
Sbjct: 61  AFELPVKIGDTLSVYTDIERVGRTSITLIVEAWA--HRARYAKMEKVTAATFIMVALDEE 118

Query: 144 GNPKSIRTE 152
           G PK++  E
Sbjct: 119 GKPKAVPEE 127


>gi|260463975|ref|ZP_05812170.1| thioesterase superfamily protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259030146|gb|EEW31427.1| thioesterase superfamily protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 131

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LTL+   MP+D N  G++FGGW+M+Q+D+ACGIRA++  + RVVT AV E+ F KP++
Sbjct: 11  GDLTLRTLAMPSDANAAGDIFGGWVMAQMDLACGIRAAERARGRVVTAAVKEMSFAKPMK 70

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           + D + IYT + ++G+TS+T+  + W   +   SD+++K   A  VMVA+D +G PK++ 
Sbjct: 71  IGDTLCIYTHVERVGRTSMTLKVEAWA--QRYLSDLMEKVTHADFVMVALDGEGKPKAVP 128

Query: 151 TE 152
            E
Sbjct: 129 AE 130


>gi|13472339|ref|NP_103906.1| acyl-CoA hydrolase [Mesorhizobium loti MAFF303099]
 gi|14023085|dbj|BAB49692.1| probable acyl-CoA hydrolase [Mesorhizobium loti MAFF303099]
          Length = 131

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LTL+   MP+D N  G++FGGW+M+Q+D+ACGIRA++  + RVVT AV E+ F KP++
Sbjct: 11  GDLTLRTLAMPSDANAAGDIFGGWVMAQMDLACGIRAAERARGRVVTAAVKEMSFAKPMK 70

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           + D + IYT + ++G+TS+T+  + W   +   SD+++K   A  VMVA+D +G PK++ 
Sbjct: 71  IGDTLCIYTHVERVGRTSMTLKVEAWA--QRYLSDLMEKVTHADFVMVALDGEGKPKAVP 128

Query: 151 TE 152
            E
Sbjct: 129 AE 130


>gi|190892244|ref|YP_001978786.1| acyl-CoA hydrolase [Rhizobium etli CIAT 652]
 gi|218508143|ref|ZP_03506021.1| probable acyl-CoA hydrolase protein [Rhizobium etli Brasil 5]
 gi|190697523|gb|ACE91608.1| probable acyl-CoA hydrolase protein [Rhizobium etli CIAT 652]
          Length = 127

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 84/129 (65%), Gaps = 2/129 (1%)

Query: 24  VCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTEL 83
           + +    G LTL+   MP D N  G++FGGW+M+Q+D+A GIRA++  + RVVT AV E+
Sbjct: 1   MTEAKPRGELTLRTLAMPGDANPAGDIFGGWVMAQMDLASGIRAAERARGRVVTAAVKEM 60

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEK 143
            FE P+++ D + +YT I ++G+TS+T+  + W     A    ++K   AT +MVA+DE+
Sbjct: 61  AFELPVKIGDTLSVYTDIERVGRTSITLIVEAWA--HRARYVKMEKVTAATFIMVALDEE 118

Query: 144 GNPKSIRTE 152
           G PK++  E
Sbjct: 119 GKPKAVPEE 127


>gi|222086262|ref|YP_002544794.1| acyl-CoA hydrolase protein [Agrobacterium radiobacter K84]
 gi|221723710|gb|ACM26866.1| acyl-CoA hydrolase protein [Agrobacterium radiobacter K84]
          Length = 129

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 51/122 (41%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LTL+   MP D N  G++FGGW+M+Q+D+A GIRA++  + RVVT AV E+ FE P++
Sbjct: 9   GELTLRTLAMPADANPAGDIFGGWVMAQMDLASGIRAAERARGRVVTAAVKEMAFELPVK 68

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           + D + +YT+I ++G+TS+T+  + W     +  + ++K    T +MVA+DE G PK + 
Sbjct: 69  IGDTLSVYTEIERVGRTSITLVVEAWA--HRSRYNQMEKVIAGTFIMVALDENGAPKPVP 126

Query: 151 TE 152
            E
Sbjct: 127 AE 128


>gi|86358157|ref|YP_470049.1| acyl-CoA hydrolase protein [Rhizobium etli CFN 42]
 gi|86282259|gb|ABC91322.1| probable acyl-CoA hydrolase protein [Rhizobium etli CFN 42]
          Length = 128

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 82/130 (63%), Gaps = 2/130 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M       G LTL+   MP D N  G++FGGW+M+Q+D+A GIRA++  K RVVT AV E
Sbjct: 1   MTDAAKPRGELTLRTLAMPGDANPAGDIFGGWVMAQMDLASGIRAAERAKGRVVTAAVKE 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + FE P+++ D + +YT I ++G+TS+T+  + W     +    ++K   AT +MVA+DE
Sbjct: 61  MAFELPVKIGDTLSVYTDIDRVGRTSITLIVEAWA--HRSRYAKMEKVTAATFIMVALDE 118

Query: 143 KGNPKSIRTE 152
           +G PK +  E
Sbjct: 119 EGKPKRVPEE 128


>gi|332716581|ref|YP_004444047.1| Acyl-CoA hydrolase [Agrobacterium sp. H13-3]
 gi|325063266|gb|ADY66956.1| Acyl-CoA hydrolase [Agrobacterium sp. H13-3]
          Length = 129

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 55/120 (45%), Positives = 82/120 (68%), Gaps = 2/120 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LTL+   MP D N  G++FGGW+MSQ+D+A  +RA+ +   R VT AV E++F+KP+++ 
Sbjct: 11  LTLRTLAMPADANPAGDIFGGWVMSQMDLAAFVRANDVAGGRTVTVAVHEIVFKKPVKIG 70

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           D + +YT+I K+G+TSVT+  + WT  R    D  +K  EA  +MVAVD+KG P+ +R E
Sbjct: 71  DTLCVYTRIEKVGRTSVTLKIEAWT--RRHYQDSREKVTEAVFIMVAVDDKGEPRPVRKE 128


>gi|159185921|ref|NP_356772.2| acyl-CoA hydrolase [Agrobacterium tumefaciens str. C58]
 gi|159141055|gb|AAK89557.2| acyl-CoA hydrolase [Agrobacterium tumefaciens str. C58]
          Length = 129

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 56/120 (46%), Positives = 80/120 (66%), Gaps = 2/120 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LTL+   MP D N  G++FGGW+MSQ+D+A  +RA+ +   R VT AV E++F+KP+++ 
Sbjct: 11  LTLRTLAMPADANPAGDIFGGWVMSQMDLAAFVRANDVAGGRTVTVAVHEIVFKKPVKIG 70

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           D + +YT+I KIG+TSVT+  + WT  R    D   K  EA  +MVAVDE G P+ +R E
Sbjct: 71  DTLCVYTRIEKIGRTSVTLKIEAWT--RRHYQDSRDKVTEAVFIMVAVDENGEPRPVRKE 128


>gi|116252679|ref|YP_768517.1| Acyl-CoA hydrolase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257327|emb|CAK08422.1| putative Acyl-CoA hydrolase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 128

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 81/130 (62%), Gaps = 2/130 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M       G LTL+   MP D N  G++FGGW+M+Q+D+A GIRA++  K RVVT AV E
Sbjct: 1   MTDAAKPRGELTLRTLAMPGDANPAGDIFGGWVMAQMDLASGIRAAERAKGRVVTAAVKE 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + FE P+++ D + +YT I ++G+TS+T+  + W     A    ++K    T +MVA+DE
Sbjct: 61  MAFELPVKIGDTLSVYTDIDRVGRTSITLCVEAWA--HRARYAKMEKVTAGTFIMVALDE 118

Query: 143 KGNPKSIRTE 152
           +G PK +  E
Sbjct: 119 EGKPKQVPEE 128


>gi|241205180|ref|YP_002976276.1| thioesterase superfamily protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859070|gb|ACS56737.1| thioesterase superfamily protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 128

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 81/130 (62%), Gaps = 2/130 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M       G LTL+   MP D N  G++FGGW+M+Q+D+A GIRA++  K RVVT AV E
Sbjct: 1   MTDAAKPRGELTLRTLAMPGDANPAGDIFGGWVMAQMDLASGIRAAERAKGRVVTAAVKE 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + FE P+++ D + +YT I ++G+TS+T+  + W     +  +  +K    T +MVA+DE
Sbjct: 61  MAFELPVKIGDTLSVYTDIDRVGRTSITLIVEAWA--HRSRYNQQEKVTAGTFIMVALDE 118

Query: 143 KGNPKSIRTE 152
           +G PK +  E
Sbjct: 119 EGKPKQVPEE 128


>gi|222107151|ref|YP_002547942.1| acyl-CoA hydrolase [Agrobacterium vitis S4]
 gi|221738330|gb|ACM39226.1| acyl-CoA hydrolase [Agrobacterium vitis S4]
          Length = 130

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 80/122 (65%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LTL+   MP D N  G++FGGW+++Q+D A GIR+S+  K R VT AV E+ F++P++
Sbjct: 9   GELTLRTLAMPADTNPAGDIFGGWVLAQMDAAAGIRSSERAKGRTVTAAVKEVSFKRPVK 68

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V D V IYT I  +G+TS+T+Y + W   R   +   QK  +A  +MVA+DEKG P+ + 
Sbjct: 69  VGDTVCIYTSISHVGRTSMTLYVECWV--RRQFTQERQKVTDAHFIMVALDEKGAPRQVE 126

Query: 151 TE 152
            E
Sbjct: 127 PE 128


>gi|110634474|ref|YP_674682.1| thioesterase superfamily protein [Mesorhizobium sp. BNC1]
 gi|110285458|gb|ABG63517.1| thioesterase superfamily [Chelativorans sp. BNC1]
          Length = 130

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 79/122 (64%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LT++ Q MP D N  G++FGGW+MSQ+D+A GIRA++  + RVVT AV E+ F KP+Q
Sbjct: 10  GELTIRTQAMPGDANAAGDIFGGWVMSQMDLASGIRAAERARGRVVTAAVREMHFRKPVQ 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V D + +YTQ+  +G+TS+T+  + W   +   SDV+     A  VMVA+D  G P  + 
Sbjct: 70  VGDTLCVYTQVTNVGRTSITLKVEAWA--QRYLSDVMDLVTMADFVMVALDGTGRPTPVP 127

Query: 151 TE 152
            E
Sbjct: 128 PE 129


>gi|90418252|ref|ZP_01226164.1| acyl-CoA hydrolase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337924|gb|EAS51575.1| acyl-CoA hydrolase [Aurantimonas manganoxydans SI85-9A1]
          Length = 133

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 51/125 (40%), Positives = 82/125 (65%), Gaps = 2/125 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
              G LT+++  MP D N +G++FGGW+MSQ+D+A GIRA++  + RV T AV  L+F+K
Sbjct: 7   QPRGELTIRLPAMPADANANGDIFGGWVMSQMDLAAGIRAAERARGRVATIAVNTLIFKK 66

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           P+++ D + +Y+ I K+G+TS+T+  + W   R  +     K  E T VMVA+D++G P 
Sbjct: 67  PVKIGDTLCVYSTIDKVGRTSITLSIEAWAKGR--ARHERTKVTEGTFVMVAIDDEGRPT 124

Query: 148 SIRTE 152
           ++  E
Sbjct: 125 AVPAE 129


>gi|150396823|ref|YP_001327290.1| thioesterase superfamily protein [Sinorhizobium medicae WSM419]
 gi|150028338|gb|ABR60455.1| thioesterase superfamily protein [Sinorhizobium medicae WSM419]
          Length = 129

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 81/130 (62%), Gaps = 2/130 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M      +G LTL+   MP D N  G++FGGW+M+Q+D++CGIRA++  + RVVT AV E
Sbjct: 1   MTAANKPNGELTLRTLAMPGDANAAGDIFGGWVMAQMDLSCGIRAAERARGRVVTAAVKE 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + F  P+++ D + IYT I K+G+TS+T+  + W   +   S V+ K  +A  VMVA+D 
Sbjct: 61  MAFALPVKIGDTLCIYTDIIKVGRTSMTLKVEAWA--QRYLSQVMDKVTDAIFVMVALDS 118

Query: 143 KGNPKSIRTE 152
            G P  +  E
Sbjct: 119 SGKPTPVPAE 128


>gi|158423244|ref|YP_001524536.1| putative acyl-CoA hydrolase protein [Azorhizobium caulinodans ORS
           571]
 gi|158330133|dbj|BAF87618.1| putative acyl-CoA hydrolase protein [Azorhizobium caulinodans ORS
           571]
          Length = 128

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 78/122 (63%), Gaps = 2/122 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
             +G LTL+   MP D N  G++FGGW+M+Q+D+A GIRA+++   RVVT  V E+ F  
Sbjct: 6   EPTGELTLRTLAMPADANPSGDIFGGWVMAQMDLAAGIRAAEVAAGRVVTAGVKEINFRL 65

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           P++V D + IYT + K+G+TS+T+    W   R   S V +K  EA  VMVA+D +G P+
Sbjct: 66  PVKVGDTMCIYTNLLKVGRTSMTLDVQAWA--RRQHSAVREKVTEAVFVMVALDAEGRPR 123

Query: 148 SI 149
            +
Sbjct: 124 PV 125


>gi|15965651|ref|NP_386004.1| hypothetical protein SMc04228 [Sinorhizobium meliloti 1021]
 gi|307314055|ref|ZP_07593668.1| thioesterase superfamily protein [Sinorhizobium meliloti BL225C]
 gi|307321232|ref|ZP_07600634.1| thioesterase superfamily protein [Sinorhizobium meliloti AK83]
 gi|15074832|emb|CAC46477.1| Probable acyl-CoA hydrolase [Sinorhizobium meliloti 1021]
 gi|306893134|gb|EFN23918.1| thioesterase superfamily protein [Sinorhizobium meliloti AK83]
 gi|306899177|gb|EFN29816.1| thioesterase superfamily protein [Sinorhizobium meliloti BL225C]
          Length = 129

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 81/123 (65%), Gaps = 2/123 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G LTL+   MP D N  G++FGGW+M+Q+D++CGIRA++  + RVVT AV E+ F  P+
Sbjct: 8   NGELTLRTLAMPGDANAAGDIFGGWVMAQMDLSCGIRAAERARGRVVTAAVKEMAFAMPV 67

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ D + IYT I  +G+TS+T+  + W   +   S V++K  +A  VMVA+D  G P  +
Sbjct: 68  KIGDTLCIYTDIVTVGRTSMTLKVEAWA--QRYLSHVMEKVTDAIFVMVALDSTGKPTPV 125

Query: 150 RTE 152
            +E
Sbjct: 126 PSE 128


>gi|227822293|ref|YP_002826264.1| predicted acyl-CoA hydrolase protein [Sinorhizobium fredii NGR234]
 gi|227341293|gb|ACP25511.1| predicted acyl-CoA hydrolase protein [Sinorhizobium fredii NGR234]
          Length = 128

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/125 (41%), Positives = 80/125 (64%), Gaps = 2/125 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
             +G LTL+   MP D N  G++FGGW+M+Q+D++CGIRA++  + RVVT AV E+ F  
Sbjct: 6   RPNGELTLRTLAMPGDANAAGDIFGGWVMAQMDLSCGIRAAERARGRVVTAAVKEMAFAL 65

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           P+++ D + IYT I  +G+TS+T+  + W   +   S V++K  +A  VMVA+D  G P 
Sbjct: 66  PVKIGDTLCIYTDIVTVGRTSMTLKVEAWA--QRYLSHVMEKVTDAIFVMVALDGSGKPT 123

Query: 148 SIRTE 152
            +  E
Sbjct: 124 PVPAE 128


>gi|163759727|ref|ZP_02166812.1| hypothetical protein HPDFL43_10247 [Hoeflea phototrophica DFL-43]
 gi|162283324|gb|EDQ33610.1| hypothetical protein HPDFL43_10247 [Hoeflea phototrophica DFL-43]
          Length = 125

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 76/123 (61%), Gaps = 2/123 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G LTL+   MP D N  G++FGGW+M+Q+D+ACGIRA++  + RVVT AV E+ F  P+
Sbjct: 5   TGELTLRTLAMPADANAAGDIFGGWVMAQMDLACGIRAAERARGRVVTAAVNEMSFAMPV 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ D + IYT I K G+TS+T+  + W   +   S  + K      VMVA+D  G P  +
Sbjct: 65  KIGDTLCIYTDIVKTGRTSMTLLVEAWA--QRYLSPKMDKVTNGLFVMVALDSDGKPTPL 122

Query: 150 RTE 152
             E
Sbjct: 123 PAE 125


>gi|114706630|ref|ZP_01439531.1| acyl-CoA hydrolase [Fulvimarina pelagi HTCC2506]
 gi|114538022|gb|EAU41145.1| acyl-CoA hydrolase [Fulvimarina pelagi HTCC2506]
          Length = 131

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 79/123 (64%), Gaps = 2/123 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           SG LT++I  MP D N +G++FGGW+++ +D+A GIRA++  + RV T A+  L F+KP+
Sbjct: 9   SGELTVRIPAMPGDANANGDIFGGWVVAHMDMAAGIRAAERARGRVATVAINTLTFKKPV 68

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ D + +YT I ++G+TS+T+  + WT  R  +     K  E   VMV++DE G+   +
Sbjct: 69  KIGDTLCVYTSIERVGRTSITLSIEAWT--RRRTGPEKTKVTEGIFVMVSIDENGHATPL 126

Query: 150 RTE 152
             E
Sbjct: 127 PPE 129


>gi|124265631|ref|YP_001019635.1| acyl-CoA hydrolase-like protein [Methylibium petroleiphilum PM1]
 gi|124258406|gb|ABM93400.1| acyl-CoA hydrolase-like protein [Methylibium petroleiphilum PM1]
          Length = 143

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 83/126 (65%), Gaps = 1/126 (0%)

Query: 24  VCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTEL 83
           + Q+    VL L++  MP D N +G++FGGWIM+Q+D+A  +  +++ + R+VT AV + 
Sbjct: 16  LTQVDPDLVLVLRVMPMPADANPNGDIFGGWIMAQVDLAGAVLPARVARGRIVTVAVNQF 75

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEK 143
           +F++P+ V DL+  Y ++ +IG+TSVT++  V+   RN +  V+ K  EA +  VA++  
Sbjct: 76  VFKQPVSVGDLLSFYARVERIGRTSVTVHVVVY-AERNPADPVVVKVTEANLTYVAINMD 134

Query: 144 GNPKSI 149
           G+P+ I
Sbjct: 135 GSPREI 140


>gi|188581758|ref|YP_001925203.1| thioesterase superfamily protein [Methylobacterium populi BJ001]
 gi|179345256|gb|ACB80668.1| thioesterase superfamily protein [Methylobacterium populi BJ001]
          Length = 134

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 82/133 (61%), Gaps = 2/133 (1%)

Query: 20  EVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKA 79
           + + V   H  G LT++   MP D N +G++FGGW++SQ+D A GI   +  + RVVT A
Sbjct: 3   QAIDVGDEHPIGDLTVRTIAMPADTNANGDIFGGWVLSQMDQAGGIAGVERAQGRVVTVA 62

Query: 80  VTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVA 139
           V  + F +P++V D++ +YT+I ++G+TS+ I+ + W   R   +   +K  EAT   VA
Sbjct: 63  VDAMTFIRPVRVGDVLCVYTRIGRVGRTSMKIHLEAWA--RRFQTQFREKVTEATFTFVA 120

Query: 140 VDEKGNPKSIRTE 152
           +DE G P+ I +E
Sbjct: 121 IDEAGRPRPIPSE 133


>gi|239832389|ref|ZP_04680718.1| acyl-CoA hydrolase [Ochrobactrum intermedium LMG 3301]
 gi|239824656|gb|EEQ96224.1| acyl-CoA hydrolase [Ochrobactrum intermedium LMG 3301]
          Length = 130

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 79/131 (60%), Gaps = 2/131 (1%)

Query: 22  LMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVT 81
           +M      +G LT+++  MP D N   ++FGGW+M+Q+D+A GIR+++  K R VT AV 
Sbjct: 1   MMNTDNEPNGTLTIRVSAMPKDANSAYDIFGGWVMAQMDMAAGIRSAERAKGRTVTAAVR 60

Query: 82  ELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVD 141
           E+ F +P+++ D + +YT I ++G+TS+T+  + W   +   SD       A  VMV++D
Sbjct: 61  EMAFARPVKIGDTLCVYTDITRVGRTSITLRVEAWA--KRYLSDRRDLVTHAEFVMVSLD 118

Query: 142 EKGNPKSIRTE 152
           E G P  +  E
Sbjct: 119 ENGKPTPVPPE 129


>gi|159043156|ref|YP_001531950.1| thioesterase superfamily protein [Dinoroseobacter shibae DFL 12]
 gi|157910916|gb|ABV92349.1| thioesterase superfamily protein [Dinoroseobacter shibae DFL 12]
          Length = 143

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 76/126 (60%), Gaps = 2/126 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           +    GVL ++   MP D N  G++FGGW+MSQ+D+A G  A ++ + R  T AV  + F
Sbjct: 20  RQQDDGVLVIRTVAMPADTNPAGDIFGGWLMSQMDLAAGNMAGRVSQGRGATVAVEAMQF 79

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
            +P+ V D V IY  + ++G+TS+ I+ DVW  PR +++ V  K   A  V VA+DE G 
Sbjct: 80  SRPVNVGDEVTIYASLVRMGRTSMRIHVDVWARPRFSNASV--KVTSADFVFVALDEDGK 137

Query: 146 PKSIRT 151
           P+ I T
Sbjct: 138 PRDIPT 143


>gi|37679396|ref|NP_934005.1| acyl-CoA hydrolase [Vibrio vulnificus YJ016]
 gi|37198139|dbj|BAC93976.1| acyl-CoA hydrolase [Vibrio vulnificus YJ016]
          Length = 143

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 57/134 (42%), Positives = 84/134 (62%), Gaps = 2/134 (1%)

Query: 20  EVLMVCQMHSS-GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTK 78
           +V M  + HS  G L L+   MP D N +G+VFGGWIMSQ+D+A GI A ++   R+VT 
Sbjct: 9   DVKMSQEFHSPKGQLLLRTLAMPADTNANGDVFGGWIMSQLDLAGGILAKEISHGRIVTV 68

Query: 79  AVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCP-RNASSDVLQKTCEATVVM 137
           +V+ + F+KP+ V D+V +Y +  KIG+TS++I  +VW  P R+   +     C+AT   
Sbjct: 69  SVSGITFKKPVSVGDVVCVYGECTKIGRTSMSINLEVWVKPVRDHGIEDRFMVCDATFNY 128

Query: 138 VAVDEKGNPKSIRT 151
           VA+D  G P+ I T
Sbjct: 129 VAIDADGKPRPIVT 142


>gi|89094333|ref|ZP_01167274.1| thioesterase family protein [Oceanospirillum sp. MED92]
 gi|89081392|gb|EAR60623.1| thioesterase family protein [Oceanospirillum sp. MED92]
          Length = 155

 Score =  110 bits (274), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 78/124 (62%), Gaps = 2/124 (1%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
           + G LT +   MP D N  G++FGGW++SQ+DIA GI A Q  +CRVVT ++  + F +P
Sbjct: 22  ARGRLTTRTMAMPADTNPAGDIFGGWVLSQMDIAAGICAGQRAQCRVVTVSLDSMSFIRP 81

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           ++V D++ +YT+I K+G++S+ I+ + W   R       +K  EA    VA+D++GNP  
Sbjct: 82  VKVGDILGVYTEIEKVGRSSMEIHVECWV--RRGRIGKREKVTEANFKFVAIDDEGNPTP 139

Query: 149 IRTE 152
           +  E
Sbjct: 140 VPAE 143


>gi|254719545|ref|ZP_05181356.1| acyl-CoA hydrolase [Brucella sp. 83/13]
 gi|265984554|ref|ZP_06097289.1| thioesterase superfamily protein [Brucella sp. 83/13]
 gi|306838485|ref|ZP_07471326.1| acyl-CoA hydrolase [Brucella sp. NF 2653]
 gi|264663146|gb|EEZ33407.1| thioesterase superfamily protein [Brucella sp. 83/13]
 gi|306406449|gb|EFM62687.1| acyl-CoA hydrolase [Brucella sp. NF 2653]
          Length = 129

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 80/130 (61%), Gaps = 2/130 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  +   +G+LT+++  MP D N   ++FGGW+M+Q+D+A GIR+++  + R VT AV E
Sbjct: 1   MNTENEPTGMLTIRVSAMPKDANSAYDIFGGWVMAQMDMAAGIRSAERARGRTVTAAVRE 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + F +P+++ D + +YT I ++G+TS+T++ + W   +   SD       A  +MVA+D 
Sbjct: 61  MAFARPVKIGDTLCVYTDITRVGRTSITLWVEAWA--KRYLSDKRDLVTHAEFIMVALDA 118

Query: 143 KGNPKSIRTE 152
            G P  +  E
Sbjct: 119 DGKPTPVPQE 128


>gi|160896795|ref|YP_001562377.1| thioesterase superfamily protein [Delftia acidovorans SPH-1]
 gi|160362379|gb|ABX33992.1| thioesterase superfamily protein [Delftia acidovorans SPH-1]
          Length = 158

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 80/117 (68%), Gaps = 1/117 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L LK+  MP DVN +G++FGGW+M+Q+D+A  +  S+L + R+VT AV E +F++P++V 
Sbjct: 18  LVLKVIPMPADVNANGDIFGGWVMAQVDLAGSVLPSRLGQSRMVTVAVNEFIFKQPVRVG 77

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           D++  Y+ ++++G+TSVT+  +V+   R A      K  EA +  VA+D +G P+S+
Sbjct: 78  DILSFYSSVQRVGRTSVTVDVEVY-AERFADQGRFVKVTEALLTYVAIDGQGKPQSL 133


>gi|307941721|ref|ZP_07657076.1| acyl-CoA thioester hydrolase YciA [Roseibium sp. TrichSKD4]
 gi|307775329|gb|EFO34535.1| acyl-CoA thioester hydrolase YciA [Roseibium sp. TrichSKD4]
          Length = 154

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 86/143 (60%), Gaps = 4/143 (2%)

Query: 10  LLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQ 69
           +  + ++T ++VL   +   +G LTL+   MP D N +G++FGGW++SQ+D+A GI + Q
Sbjct: 10  IRFVKVVTGEDVL--AEESPTGELTLRTMAMPADTNANGDIFGGWVLSQMDLAGGIASGQ 67

Query: 70  LCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK 129
               RVVT AV ++ F +P+ V D++ +Y+ I ++G TS+ I+ + W           +K
Sbjct: 68  RAAGRVVTIAVDKMKFIRPVHVGDVLCVYSSIIRVGNTSMEIWIEAWALRHRFGH--REK 125

Query: 130 TCEATVVMVAVDEKGNPKSIRTE 152
             EA   MVA+D+ G P+++  E
Sbjct: 126 VTEAKFTMVAIDDDGRPRTVPRE 148


>gi|310778266|ref|YP_003966599.1| thioesterase superfamily protein [Ilyobacter polytropus DSM 2926]
 gi|309747589|gb|ADO82251.1| thioesterase superfamily protein [Ilyobacter polytropus DSM 2926]
          Length = 131

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 78/120 (65%), Gaps = 9/120 (7%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            L++  MP D N  G+VFGGWIM+Q+D+A  + ASQ  + R+VT  VT+ +F++P+ V D
Sbjct: 15  ALRLVAMPADTNPAGDVFGGWIMAQVDLAGAVIASQRAQSRIVTIKVTDFVFKEPVYVGD 74

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC----EATVVMVAVDEKGNPKSI 149
           LV  Y +I KIG TS+T+   V  C   A  +  +KTC    EATVV VA+DE GNPK I
Sbjct: 75  LVTCYGKIEKIGNTSITV--KVVVC---AQRNRYEKTCIKVTEATVVYVAIDEDGNPKEI 129


>gi|332527399|ref|ZP_08403455.1| acyl-CoA hydrolase-like protein [Rubrivivax benzoatilyticus JA2]
 gi|332111808|gb|EGJ11788.1| acyl-CoA hydrolase-like protein [Rubrivivax benzoatilyticus JA2]
          Length = 140

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 75/117 (64%), Gaps = 1/117 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L +++  MP D N +G+VFGGWIM+Q+D+A  +  +++ + R+ T AV + +F++P+ + 
Sbjct: 23  LVMRVMPMPADANANGDVFGGWIMAQVDLAGAVLPARVARGRIATVAVNQFVFKQPVSIG 82

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           DL+  Y  + +IG TSVT++  VW   RN +   + K  EA +  VA+ + G P++I
Sbjct: 83  DLLSFYAHVERIGNTSVTVHVQVWAE-RNPADPQIVKVTEANLTYVAITDDGKPRTI 138


>gi|163851996|ref|YP_001640039.1| thioesterase superfamily protein [Methylobacterium extorquens PA1]
 gi|254561718|ref|YP_003068813.1| acyl-CoA thioester hydrolase [Methylobacterium extorquens DM4]
 gi|163663601|gb|ABY30968.1| thioesterase superfamily protein [Methylobacterium extorquens PA1]
 gi|254268996|emb|CAX24957.1| acyl-CoA thioester hydrolase [Methylobacterium extorquens DM4]
          Length = 139

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 78/125 (62%), Gaps = 2/125 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
           H  G LT++   MP D N +G++FGGW++SQ+D A GI   +  + RVVT AV  + F +
Sbjct: 11  HPIGDLTVRTIAMPADTNANGDIFGGWVLSQMDQAGGIAGVERAQGRVVTVAVDAMTFIR 70

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           P++V D++ +YT+I ++G+TS+ I+ + W   R   +   +K  EAT   VA+DE G P+
Sbjct: 71  PVRVGDVLCVYTRIGRVGRTSMKIHLEAWA--RRFQTQFREKVTEATFTFVAIDEVGRPR 128

Query: 148 SIRTE 152
            I  E
Sbjct: 129 PIPVE 133


>gi|240139124|ref|YP_002963599.1| acyl-CoA thioester hydrolase [Methylobacterium extorquens AM1]
 gi|240009096|gb|ACS40322.1| acyl-CoA thioester hydrolase [Methylobacterium extorquens AM1]
          Length = 139

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 78/125 (62%), Gaps = 2/125 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
           H  G LT++   MP D N +G++FGGW++SQ+D A GI   +  + RVVT AV  + F +
Sbjct: 11  HPIGDLTVRTIAMPADTNANGDIFGGWVLSQMDQAGGIAGVERAQGRVVTVAVDAMTFIR 70

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           P++V D++ +YT+I ++G+TS+ I+ + W   R   +   +K  EAT   VA+DE G P+
Sbjct: 71  PVRVGDVLCVYTRIGRVGRTSMKIHLEAWA--RRFQTQFREKVTEATFTFVAIDEVGRPR 128

Query: 148 SIRTE 152
            I  E
Sbjct: 129 PIPVE 133


>gi|17986786|ref|NP_539420.1| acyl-CoA hydrolase [Brucella melitensis bv. 1 str. 16M]
 gi|225627952|ref|ZP_03785988.1| acyl-CoA hydrolase [Brucella ceti str. Cudo]
 gi|237815903|ref|ZP_04594900.1| acyl-CoA hydrolase [Brucella abortus str. 2308 A]
 gi|294852828|ref|ZP_06793501.1| acyl-CoA thioesterase YciA [Brucella sp. NVSL 07-0026]
 gi|17982416|gb|AAL51684.1| acyl-CoA hydrolase [Brucella melitensis bv. 1 str. 16M]
 gi|225617115|gb|EEH14161.1| acyl-CoA hydrolase [Brucella ceti str. Cudo]
 gi|237789201|gb|EEP63412.1| acyl-CoA hydrolase [Brucella abortus str. 2308 A]
 gi|294821417|gb|EFG38416.1| acyl-CoA thioesterase YciA [Brucella sp. NVSL 07-0026]
          Length = 132

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 78/125 (62%), Gaps = 2/125 (1%)

Query: 22  LMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVT 81
           LM  +   +G+LT+++  MP D N   ++FGGW+M+Q+D+A GIR+++  + R VT AV 
Sbjct: 3   LMNTENEPTGMLTIRVSAMPKDANSAYDIFGGWVMAQMDMAAGIRSAERARGRTVTAAVR 62

Query: 82  ELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVD 141
           E+ F +P+++ D + +YT I ++G+TS+T+  + W   +   SD       A  +MVA+D
Sbjct: 63  EMAFARPVKIGDTLCVYTDITRVGRTSITLRVEAWA--KRYLSDKRDLVTHAEFIMVALD 120

Query: 142 EKGNP 146
             G P
Sbjct: 121 ADGKP 125


>gi|27366343|ref|NP_761871.1| acyl-CoA hydrolase [Vibrio vulnificus CMCP6]
 gi|320156851|ref|YP_004189230.1| acyl-CoA thioesterase YciA, involved in membrane biogenesis [Vibrio
           vulnificus MO6-24/O]
 gi|27362544|gb|AAO11398.1| Acyl-CoA hydrolase [Vibrio vulnificus CMCP6]
 gi|319932163|gb|ADV87027.1| acyl-CoA thioesterase YciA, involved in membrane biogenesis [Vibrio
           vulnificus MO6-24/O]
          Length = 132

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 82/131 (62%), Gaps = 2/131 (1%)

Query: 23  MVCQMHSS-GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVT 81
           M  + HS  G L L+   MP D N +G+VFGGWIMSQ+D+A GI A ++   R+VT +V+
Sbjct: 1   MSQEFHSPKGQLLLRTLAMPADTNANGDVFGGWIMSQLDLAGGILAKEISHGRIVTVSVS 60

Query: 82  ELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCP-RNASSDVLQKTCEATVVMVAV 140
            + F+KP+ V D+V +Y +  KIG+TS++I  +VW  P R+   +     C+AT   VA+
Sbjct: 61  GITFKKPVSVGDVVCVYGECTKIGRTSMSINLEVWVKPVRDHGIEDRFMVCDATFNYVAI 120

Query: 141 DEKGNPKSIRT 151
           D  G P+ I T
Sbjct: 121 DADGKPRPIVT 131


>gi|306844511|ref|ZP_07477100.1| acyl-CoA hydrolase [Brucella sp. BO1]
 gi|306275122|gb|EFM56878.1| acyl-CoA hydrolase [Brucella sp. BO1]
          Length = 129

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 80/130 (61%), Gaps = 2/130 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  +   +G+LT+++  MP D N   ++FGGW+M+Q+D+A GIR+++  + R VT AV E
Sbjct: 1   MNTENEPTGMLTIRVSAMPKDANSAYDIFGGWVMAQMDMAAGIRSAERARGRTVTAAVRE 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + F +P+++ D + +YT I ++G+TS+T+  + W   +   SD       A  +MVA+D 
Sbjct: 61  MAFARPVKIGDTLCVYTDITRVGRTSITLRVEAWA--KRYLSDKRDLVTHAEFIMVALDA 118

Query: 143 KGNPKSIRTE 152
           +G P  +  E
Sbjct: 119 EGKPTPVPQE 128


>gi|153008985|ref|YP_001370200.1| thioesterase superfamily protein [Ochrobactrum anthropi ATCC 49188]
 gi|151560873|gb|ABS14371.1| thioesterase superfamily protein [Ochrobactrum anthropi ATCC 49188]
          Length = 129

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 77/122 (63%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G+LTL++  MP D N   ++FGGW+M+Q+D A GIRA++  K RVVT AV E+ F KP++
Sbjct: 9   GMLTLRVPAMPKDANAAFDIFGGWVMAQMDSASGIRAAERAKGRVVTAAVREMSFAKPVK 68

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           + D + +YT+I ++G++S+T+  + W   +   +  +        VMV++DE G P  + 
Sbjct: 69  IGDALCVYTEITRVGRSSITLRVEAWA--QRYLTQQMDLVTHGEFVMVSLDENGKPTPVP 126

Query: 151 TE 152
            E
Sbjct: 127 PE 128


>gi|222869945|gb|EEF07076.1| predicted protein [Populus trichocarpa]
          Length = 223

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 80/117 (68%), Gaps = 1/117 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L LK+  MP DVN +G++FGGW+M+Q+D+A  +  S+L + R+VT AV E +F++P++V 
Sbjct: 18  LVLKVIPMPADVNANGDIFGGWVMAQVDLAGSVLPSRLGQSRMVTVAVNEFIFKQPVRVG 77

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           D++  Y+ ++++G+TSVT+  +V+   R A      K  EA +  VA+D +G P+S+
Sbjct: 78  DILSFYSSVQRVGRTSVTVDVEVY-AERFADQGRFVKVTEALLTYVAIDGQGKPQSL 133


>gi|261211821|ref|ZP_05926108.1| acyl-CoA hydrolase [Vibrio sp. RC341]
 gi|260839171|gb|EEX65803.1| acyl-CoA hydrolase [Vibrio sp. RC341]
          Length = 139

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 78/121 (64%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGGILAKEISYGRIVTVSVSSITFKKPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  KIG+TS++I  +VW  P   +   D  Q  CEAT   VA+D  G P++
Sbjct: 70  VGDVVCCYGECTKIGRTSMSINLEVWVKPVKEDGVGDRFQ-VCEATFNYVAIDANGRPRA 128

Query: 149 I 149
           I
Sbjct: 129 I 129


>gi|306843143|ref|ZP_07475763.1| acyl-CoA hydrolase [Brucella sp. BO2]
 gi|306286666|gb|EFM58224.1| acyl-CoA hydrolase [Brucella sp. BO2]
          Length = 132

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 79/130 (60%), Gaps = 2/130 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  +   +G+LT+++  MP D N   ++FGGW+M+Q+D+A GIR+++  + R VT AV E
Sbjct: 4   MNTENEPTGMLTIRVSAMPKDANSAYDIFGGWVMAQMDMAAGIRSAERARGRTVTAAVRE 63

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + F +P+++ D + +YT I ++G+TS+T+  + W   +   SD       A  +MVA+D 
Sbjct: 64  MAFARPVKIGDTLCVYTDITRVGRTSITLRVEAWA--KRYLSDKRDLVTHAEFIMVALDA 121

Query: 143 KGNPKSIRTE 152
            G P  +  E
Sbjct: 122 DGKPTPVPQE 131


>gi|323495661|ref|ZP_08100732.1| hypothetical protein VISI1226_06189 [Vibrio sinaloensis DSM 21326]
 gi|323319296|gb|EGA72236.1| hypothetical protein VISI1226_06189 [Vibrio sinaloensis DSM 21326]
          Length = 132

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 81/123 (65%), Gaps = 5/123 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGGILAKEISSGRIVTVSVSSITFKKPVR 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ---KTCEATVVMVAVDEKGNPK 147
           V D+V  Y +  KIG+TS++I  +VW  P   + D +Q   + CEAT   VA+D +G P+
Sbjct: 70  VGDVVCCYGECTKIGRTSMSINLEVWVKP--VTEDGIQSRYQVCEATFNYVAIDGEGKPR 127

Query: 148 SIR 150
            I+
Sbjct: 128 PIK 130


>gi|148554287|ref|YP_001261869.1| thioesterase superfamily protein [Sphingomonas wittichii RW1]
 gi|148499477|gb|ABQ67731.1| thioesterase superfamily protein [Sphingomonas wittichii RW1]
          Length = 130

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 79/124 (63%), Gaps = 2/124 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           ++  +G   +++  MP D N +G++FGGW++S +D+A G  AS+  K R  T A+  ++F
Sbjct: 7   ELPPAGDPAIRVVAMPADTNANGDIFGGWLVSMMDLAAGTVASKHSKGRAATIAIDGMIF 66

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
            +P++V D+V +Y  +R +G+TS+ I    W   R+ S +  ++  +AT+  VA+DE+G 
Sbjct: 67  HRPVKVGDIVSVYADLRSVGRTSMKIEVAAWRQARDGSEN--ERVTQATITFVAIDEQGR 124

Query: 146 PKSI 149
           P+++
Sbjct: 125 PRAV 128


>gi|218530749|ref|YP_002421565.1| thioesterase superfamily protein [Methylobacterium chloromethanicum
           CM4]
 gi|218523052|gb|ACK83637.1| thioesterase superfamily protein [Methylobacterium chloromethanicum
           CM4]
          Length = 139

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 78/125 (62%), Gaps = 2/125 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
           H  G LT++   MP D N +G++FGGW++SQ+D A GI   +  + RVVT AV  + F +
Sbjct: 11  HPIGDLTVRTIAMPADTNANGDIFGGWVLSQMDQAGGIAGVERAQGRVVTVAVDAMTFIR 70

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           P++V D++ +YT+I ++G+TS+ I+ + W   R   +   +K  EAT   VA+DE G P+
Sbjct: 71  PVRVGDVLCVYTRIGRVGRTSMKIHLEAWA--RRFQTQFREKVTEATFTFVAIDEVGLPR 128

Query: 148 SIRTE 152
            I  E
Sbjct: 129 PIPVE 133


>gi|119896757|ref|YP_931970.1| acyl-CoA thioesterase [Azoarcus sp. BH72]
 gi|119669170|emb|CAL93083.1| conserved hypothetical acyl-CoA thioesterase [Azoarcus sp. BH72]
          Length = 134

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 75/120 (62%), Gaps = 1/120 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LTL++  MP D+N  G+VFGGWIMS +DIA  I A++  K RV T AV   +F++P+ V 
Sbjct: 16  LTLRVVPMPGDLNPSGDVFGGWIMSMVDIAGAIPANRRAKSRVATVAVNSFVFKQPVSVG 75

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           DLV  Y ++   G+TSVT+  +V+   R  ++  + K  EA +  VA+DEKG  + I  E
Sbjct: 76  DLVSFYARVVATGRTSVTVDVEVY-AERGHANPFVVKVTEAKLTYVAMDEKGGKRPIPAE 134


>gi|23502379|ref|NP_698506.1| long-chain acyl-CoA thioester hydrolase [Brucella suis 1330]
 gi|62290398|ref|YP_222191.1| long-chain acyl-CoA thioester hydrolase [Brucella abortus bv. 1
           str. 9-941]
 gi|82700320|ref|YP_414894.1| thioesterase superfamily protein [Brucella melitensis biovar
           Abortus 2308]
 gi|148559485|ref|YP_001259388.1| putative long-chain acyl-CoA thioester hydrolase [Brucella ovis
           ATCC 25840]
 gi|161619457|ref|YP_001593344.1| thioesterase superfamily protein [Brucella canis ATCC 23365]
 gi|163843764|ref|YP_001628168.1| thioesterase superfamily protein [Brucella suis ATCC 23445]
 gi|189024624|ref|YP_001935392.1| Thioesterase superfamily [Brucella abortus S19]
 gi|225852989|ref|YP_002733222.1| thioesterase superfamily protein [Brucella melitensis ATCC 23457]
 gi|254689695|ref|ZP_05152949.1| acyl-CoA hydrolase [Brucella abortus bv. 6 str. 870]
 gi|254694185|ref|ZP_05156013.1| acyl-CoA hydrolase [Brucella abortus bv. 3 str. Tulya]
 gi|254697838|ref|ZP_05159666.1| acyl-CoA hydrolase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254702227|ref|ZP_05164055.1| acyl-CoA hydrolase [Brucella suis bv. 5 str. 513]
 gi|254704762|ref|ZP_05166590.1| acyl-CoA hydrolase [Brucella suis bv. 3 str. 686]
 gi|254708175|ref|ZP_05170003.1| acyl-CoA hydrolase [Brucella pinnipedialis M163/99/10]
 gi|254710546|ref|ZP_05172357.1| acyl-CoA hydrolase [Brucella pinnipedialis B2/94]
 gi|254714729|ref|ZP_05176540.1| acyl-CoA hydrolase [Brucella ceti M644/93/1]
 gi|254717789|ref|ZP_05179600.1| acyl-CoA hydrolase [Brucella ceti M13/05/1]
 gi|254730728|ref|ZP_05189306.1| acyl-CoA hydrolase [Brucella abortus bv. 4 str. 292]
 gi|256032040|ref|ZP_05445654.1| acyl-CoA hydrolase [Brucella pinnipedialis M292/94/1]
 gi|256045129|ref|ZP_05448030.1| acyl-CoA hydrolase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061562|ref|ZP_05451704.1| acyl-CoA hydrolase [Brucella neotomae 5K33]
 gi|256114066|ref|ZP_05454836.1| acyl-CoA hydrolase [Brucella melitensis bv. 3 str. Ether]
 gi|256160236|ref|ZP_05457930.1| acyl-CoA hydrolase [Brucella ceti M490/95/1]
 gi|256255442|ref|ZP_05460978.1| acyl-CoA hydrolase [Brucella ceti B1/94]
 gi|256257946|ref|ZP_05463482.1| acyl-CoA hydrolase [Brucella abortus bv. 9 str. C68]
 gi|256263532|ref|ZP_05466064.1| thioesterase superfamily protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369926|ref|YP_003107437.1| long-chain acyl-CoA thioester hydrolase, putative [Brucella microti
           CCM 4915]
 gi|260169175|ref|ZP_05755986.1| acyl-CoA hydrolase [Brucella sp. F5/99]
 gi|260546935|ref|ZP_05822674.1| thioesterase superfamily protein [Brucella abortus NCTC 8038]
 gi|260565269|ref|ZP_05835753.1| thioesterase superfamily protein [Brucella melitensis bv. 1 str.
           16M]
 gi|260565993|ref|ZP_05836463.1| thioesterase superfamily protein [Brucella suis bv. 4 str. 40]
 gi|260755230|ref|ZP_05867578.1| thioesterase superfamily protein [Brucella abortus bv. 6 str. 870]
 gi|260758450|ref|ZP_05870798.1| thioesterase superfamily protein [Brucella abortus bv. 4 str. 292]
 gi|260762276|ref|ZP_05874619.1| thioesterase superfamily protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884244|ref|ZP_05895858.1| thioesterase superfamily protein [Brucella abortus bv. 9 str. C68]
 gi|261214493|ref|ZP_05928774.1| thioesterase superfamily protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261219639|ref|ZP_05933920.1| thioesterase superfamily protein [Brucella ceti M13/05/1]
 gi|261222649|ref|ZP_05936930.1| thioesterase superfamily protein [Brucella ceti B1/94]
 gi|261315683|ref|ZP_05954880.1| thioesterase superfamily protein [Brucella pinnipedialis
           M163/99/10]
 gi|261318121|ref|ZP_05957318.1| thioesterase superfamily protein [Brucella pinnipedialis B2/94]
 gi|261322527|ref|ZP_05961724.1| thioesterase superfamily protein [Brucella ceti M644/93/1]
 gi|261325571|ref|ZP_05964768.1| thioesterase superfamily protein [Brucella neotomae 5K33]
 gi|261752801|ref|ZP_05996510.1| thioesterase superfamily protein [Brucella suis bv. 5 str. 513]
 gi|261755460|ref|ZP_05999169.1| thioesterase superfamily protein [Brucella suis bv. 3 str. 686]
 gi|261758690|ref|ZP_06002399.1| thioesterase superfamily [Brucella sp. F5/99]
 gi|265989151|ref|ZP_06101708.1| thioesterase superfamily protein [Brucella pinnipedialis M292/94/1]
 gi|265991565|ref|ZP_06104122.1| thioesterase superfamily protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995402|ref|ZP_06107959.1| thioesterase superfamily protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998613|ref|ZP_06111170.1| thioesterase superfamily protein [Brucella ceti M490/95/1]
 gi|297248783|ref|ZP_06932501.1| acyl-CoA thioesterase YciA [Brucella abortus bv. 5 str. B3196]
 gi|23348363|gb|AAN30421.1| long-chain acyl-CoA thioester hydrolase, putative [Brucella suis
           1330]
 gi|62196530|gb|AAX74830.1| long-chain acyl-CoA thioester hydrolase, hypothetical [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616421|emb|CAJ11484.1| Thioesterase superfamily [Brucella melitensis biovar Abortus 2308]
 gi|148370742|gb|ABQ60721.1| putative long-chain acyl-CoA thioester hydrolase [Brucella ovis
           ATCC 25840]
 gi|161336268|gb|ABX62573.1| thioesterase superfamily protein [Brucella canis ATCC 23365]
 gi|163674487|gb|ABY38598.1| thioesterase superfamily protein [Brucella suis ATCC 23445]
 gi|189020196|gb|ACD72918.1| Thioesterase superfamily [Brucella abortus S19]
 gi|225641354|gb|ACO01268.1| thioesterase superfamily protein [Brucella melitensis ATCC 23457]
 gi|256000089|gb|ACU48488.1| long-chain acyl-CoA thioester hydrolase, putative [Brucella microti
           CCM 4915]
 gi|260095985|gb|EEW79862.1| thioesterase superfamily protein [Brucella abortus NCTC 8038]
 gi|260151337|gb|EEW86431.1| thioesterase superfamily protein [Brucella melitensis bv. 1 str.
           16M]
 gi|260155511|gb|EEW90591.1| thioesterase superfamily protein [Brucella suis bv. 4 str. 40]
 gi|260668768|gb|EEX55708.1| thioesterase superfamily protein [Brucella abortus bv. 4 str. 292]
 gi|260672708|gb|EEX59529.1| thioesterase superfamily protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675338|gb|EEX62159.1| thioesterase superfamily protein [Brucella abortus bv. 6 str. 870]
 gi|260873772|gb|EEX80841.1| thioesterase superfamily protein [Brucella abortus bv. 9 str. C68]
 gi|260916100|gb|EEX82961.1| thioesterase superfamily protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|260921233|gb|EEX87886.1| thioesterase superfamily protein [Brucella ceti B1/94]
 gi|260924728|gb|EEX91296.1| thioesterase superfamily protein [Brucella ceti M13/05/1]
 gi|261295217|gb|EEX98713.1| thioesterase superfamily protein [Brucella ceti M644/93/1]
 gi|261297344|gb|EEY00841.1| thioesterase superfamily protein [Brucella pinnipedialis B2/94]
 gi|261301551|gb|EEY05048.1| thioesterase superfamily protein [Brucella neotomae 5K33]
 gi|261304709|gb|EEY08206.1| thioesterase superfamily protein [Brucella pinnipedialis
           M163/99/10]
 gi|261738674|gb|EEY26670.1| thioesterase superfamily [Brucella sp. F5/99]
 gi|261742554|gb|EEY30480.1| thioesterase superfamily protein [Brucella suis bv. 5 str. 513]
 gi|261745213|gb|EEY33139.1| thioesterase superfamily protein [Brucella suis bv. 3 str. 686]
 gi|262553237|gb|EEZ09071.1| thioesterase superfamily protein [Brucella ceti M490/95/1]
 gi|262766515|gb|EEZ12304.1| thioesterase superfamily protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002349|gb|EEZ14924.1| thioesterase superfamily protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093560|gb|EEZ17585.1| thioesterase superfamily protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661348|gb|EEZ31609.1| thioesterase superfamily protein [Brucella pinnipedialis M292/94/1]
 gi|297175952|gb|EFH35299.1| acyl-CoA thioesterase YciA [Brucella abortus bv. 5 str. B3196]
 gi|326409527|gb|ADZ66592.1| Thioesterase superfamily [Brucella melitensis M28]
 gi|326539235|gb|ADZ87450.1| thioesterase superfamily protein [Brucella melitensis M5-90]
          Length = 129

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 77/124 (62%), Gaps = 2/124 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  +   +G+LT+++  MP D N   ++FGGW+M+Q+D+A GIR+++  + R VT AV E
Sbjct: 1   MNTENEPTGMLTIRVSAMPKDANSAYDIFGGWVMAQMDMAAGIRSAERARGRTVTAAVRE 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + F +P+++ D + +YT I ++G+TS+T+  + W   +   SD       A  +MVA+D 
Sbjct: 61  MAFARPVKIGDTLCVYTDITRVGRTSITLRVEAWA--KRYLSDKRDLVTHAEFIMVALDA 118

Query: 143 KGNP 146
            G P
Sbjct: 119 DGKP 122


>gi|209694696|ref|YP_002262624.1| acyl-CoA thioester hydrolase (p14 protein) [Aliivibrio salmonicida
           LFI1238]
 gi|208008647|emb|CAQ78831.1| acyl-CoA thioester hydrolase (p14 protein) [Aliivibrio salmonicida
           LFI1238]
          Length = 140

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 78/121 (64%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+  +MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 17  GQLLLRTLSMPADTNANGDIFGGWIMSQLDLAGGILAKEISGGRIVTVSVSSITFKKPVK 76

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +   IG+TS++I  +VW  P   +   D  Q  CEAT   VA+D KG P+ 
Sbjct: 77  VGDVVCCYGECVNIGRTSMSINLEVWVKPIKEDGIGDRFQ-VCEATFNYVAIDAKGKPRP 135

Query: 149 I 149
           I
Sbjct: 136 I 136


>gi|197336116|ref|YP_002155828.1| acyl-CoA thioester hydrolase YciA [Vibrio fischeri MJ11]
 gi|197317606|gb|ACH67053.1| acyl-CoA thioester hydrolase YciA [Vibrio fischeri MJ11]
          Length = 136

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 78/121 (64%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+  +MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 13  GQLLLRTLSMPADTNANGDIFGGWIMSQLDLAGGILAKEISGGRIVTVSVSSITFKKPVK 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  KIG+TS++I  +VW  P   +   D  Q  CEAT   VA+D  G P+ 
Sbjct: 73  VGDVVCCYGECVKIGRTSMSINLEVWVKPVKEDGIGDRFQ-VCEATFNYVAIDASGKPRP 131

Query: 149 I 149
           I
Sbjct: 132 I 132


>gi|237808919|ref|YP_002893359.1| thioesterase superfamily protein [Tolumonas auensis DSM 9187]
 gi|237501180|gb|ACQ93773.1| thioesterase superfamily protein [Tolumonas auensis DSM 9187]
          Length = 132

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 81/124 (65%), Gaps = 3/124 (2%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
           H  G L ++ Q MP D N +G++FGGWIMSQ+D+A G+ A+++ + R+ T AV  + F +
Sbjct: 7   HPKGELIIRTQAMPADTNQNGDIFGGWIMSQMDLAGGMLATEIARGRIATVAVEGMTFHQ 66

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           P++V D V ++ +  ++G+TS+T++ +VW  P    S+  ++ C  E     VA+D+ G+
Sbjct: 67  PVKVGDAVCVHGECTRVGRTSMTVHLEVWIKPL-LRSESYERYCVTEGVFTYVAIDDAGH 125

Query: 146 PKSI 149
           P+++
Sbjct: 126 PRAV 129


>gi|59711631|ref|YP_204407.1| hydrolase [Vibrio fischeri ES114]
 gi|59479732|gb|AAW85519.1| predicted hydrolase [Vibrio fischeri ES114]
          Length = 143

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 78/121 (64%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+  +MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 20  GQLLLRTLSMPADTNANGDIFGGWIMSQLDLAGGILAKEISGGRIVTVSVSSITFKKPVK 79

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  KIG+TS++I  +VW  P   +   D  Q  CEAT   VA+D  G P+ 
Sbjct: 80  VGDVVCCYGECVKIGRTSMSINLEVWVKPVKEDGIGDRFQ-VCEATFNYVAIDASGKPRP 138

Query: 149 I 149
           I
Sbjct: 139 I 139


>gi|258621855|ref|ZP_05716885.1| Putative acyl-CoA thioester hydrolase yciA [Vibrio mimicus VM573]
 gi|258627448|ref|ZP_05722229.1| Putative acyl-CoA thioester hydrolase yciA [Vibrio mimicus VM603]
 gi|262171290|ref|ZP_06038968.1| acyl-CoA hydrolase [Vibrio mimicus MB-451]
 gi|258580254|gb|EEW05222.1| Putative acyl-CoA thioester hydrolase yciA [Vibrio mimicus VM603]
 gi|258585793|gb|EEW10512.1| Putative acyl-CoA thioester hydrolase yciA [Vibrio mimicus VM573]
 gi|261892366|gb|EEY38352.1| acyl-CoA hydrolase [Vibrio mimicus MB-451]
          Length = 139

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 78/121 (64%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGGILAKEISCGRIVTVSVSSITFKKPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  KIG+TS++I  +VW  P   +   D  Q  CEAT   VA+D  G P++
Sbjct: 70  VGDVVCCYGECTKIGRTSMSINLEVWVKPVKEDGVGDRFQ-VCEATFNYVAIDTNGRPRA 128

Query: 149 I 149
           I
Sbjct: 129 I 129


>gi|328545076|ref|YP_004305185.1| Thioesterase family protein [polymorphum gilvum SL003B-26A1]
 gi|326414818|gb|ADZ71881.1| Thioesterase family protein [Polymorphum gilvum SL003B-26A1]
          Length = 138

 Score =  106 bits (265), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 49/120 (40%), Positives = 72/120 (60%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           SG LTL+   MP D N  G++FGGW++SQ+D+A GI ASQ    RVVT A+  + F +P+
Sbjct: 13  SGELTLRTMAMPADTNAAGDIFGGWVLSQMDLAGGIAASQRANGRVVTIAIDRMKFIRPV 72

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V D++ +Y ++ +IG+TS+ I  + W           +K  EA    VAVDE G P+ +
Sbjct: 73  HVGDVLCVYARVGRIGRTSMEINLEAWALRHRFGH--REKVTEAMFTFVAVDEDGRPRPV 130


>gi|308050644|ref|YP_003914210.1| thioesterase superfamily protein [Ferrimonas balearica DSM 9799]
 gi|307632834|gb|ADN77136.1| thioesterase superfamily protein [Ferrimonas balearica DSM 9799]
          Length = 130

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 74/127 (58%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  Q+  +G L L+   MP D N +G++FGGWIMSQ+D+A G+ A  + + R+ T AV  
Sbjct: 1   MTEQVKPTGELLLRTLAMPADTNANGDIFGGWIMSQMDMAGGLMAKAISRGRICTVAVNG 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + F +P+ V D V +Y  +R++G  S+ I  +VW  P    +D   +  EA    VA+D 
Sbjct: 61  MSFYRPVAVGDAVCVYGNVRRLGNASMEIGLEVWVRPIAKGTDEHYRVTEAIFTYVAIDA 120

Query: 143 KGNPKSI 149
           +G P+ +
Sbjct: 121 EGKPRPL 127


>gi|73540157|ref|YP_294677.1| thioesterase superfamily protein [Ralstonia eutropha JMP134]
 gi|72117570|gb|AAZ59833.1| Thioesterase superfamily [Ralstonia eutropha JMP134]
          Length = 133

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/117 (43%), Positives = 72/117 (61%), Gaps = 1/117 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++  MP D N+ G+VFGGWIMSQ+DIA  I A +  + RV T AV   LF+ P+ V DL
Sbjct: 18  LRVVPMPADANVHGDVFGGWIMSQVDIAGSIPAVERAQGRVATVAVNSFLFKHPVFVGDL 77

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           V  Y +I K G+TS+T+  +V+   R   ++ + K  EAT+  VA DE   P+ + T
Sbjct: 78  VSFYAEIEKTGRTSITVSVEVYAQ-RMRHANEIVKVTEATLTYVATDESRQPRVLPT 133


>gi|262404118|ref|ZP_06080673.1| acyl-CoA hydrolase [Vibrio sp. RC586]
 gi|262349150|gb|EEY98288.1| acyl-CoA hydrolase [Vibrio sp. RC586]
          Length = 133

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 79/123 (64%), Gaps = 3/123 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGGILAKEISCGRIVTVSVSSITFKKPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  KIG+TS++I  +VW  P   +   +  Q  CEAT   VA+D  G P++
Sbjct: 70  VGDVVCCYGECTKIGRTSMSINLEVWVKPVKEDGVGERFQ-VCEATFNYVAIDANGRPRA 128

Query: 149 IRT 151
           I +
Sbjct: 129 ISS 131


>gi|89902260|ref|YP_524731.1| thioesterase superfamily protein [Rhodoferax ferrireducens T118]
 gi|89346997|gb|ABD71200.1| thioesterase superfamily [Rhodoferax ferrireducens T118]
          Length = 146

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 81/124 (65%), Gaps = 1/124 (0%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q+ +   L LK+  MP D N +G++FGGW+M+Q+D+A  +  ++  K R+VT AV E +F
Sbjct: 19  QLPTDQELVLKVIPMPGDCNANGDIFGGWVMAQVDLAGAVVPARYVKGRMVTVAVNEFVF 78

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           ++P++V D++  + ++ +IG+TS+T+  +V+   R  S +   K  EA++  VA+DE G 
Sbjct: 79  KQPVRVGDILSFFAKLTRIGRTSITVKIEVF-AERFGSLNEYAKVTEASLTYVAIDEHGK 137

Query: 146 PKSI 149
           P+ +
Sbjct: 138 PREV 141


>gi|170738394|ref|YP_001767049.1| thioesterase superfamily protein [Methylobacterium sp. 4-46]
 gi|168192668|gb|ACA14615.1| thioesterase superfamily protein [Methylobacterium sp. 4-46]
          Length = 139

 Score =  105 bits (261), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 77/121 (63%), Gaps = 2/121 (1%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
           + G LT++   MP D N +G++FGGW+MSQ+D A GI   +  + RVVT AV  + F +P
Sbjct: 12  ARGELTVRTIAMPADTNANGDIFGGWVMSQMDQAGGIAGVERAQGRVVTVAVEAMSFIRP 71

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           ++V D++ +YT++  +G+TS+ I  + W   R   + + +K  EAT   VA+D++G P+ 
Sbjct: 72  VRVGDVLCVYTRVAHVGRTSMRIQIEAWA--RRFRTQLREKVTEATFTFVAIDDEGRPRP 129

Query: 149 I 149
           +
Sbjct: 130 V 130


>gi|255744874|ref|ZP_05418824.1| acyl-CoA hydrolase [Vibrio cholera CIRS 101]
 gi|262161843|ref|ZP_06030861.1| acyl-CoA hydrolase [Vibrio cholerae INDRE 91/1]
 gi|262169710|ref|ZP_06037401.1| acyl-CoA hydrolase [Vibrio cholerae RC27]
 gi|255737345|gb|EET92740.1| acyl-CoA hydrolase [Vibrio cholera CIRS 101]
 gi|262021944|gb|EEY40654.1| acyl-CoA hydrolase [Vibrio cholerae RC27]
 gi|262028575|gb|EEY47230.1| acyl-CoA hydrolase [Vibrio cholerae INDRE 91/1]
 gi|327484306|gb|AEA78713.1| Acyl-CoA thioesterase YciA, involved in membrane biogenesis [Vibrio
           cholerae LMA3894-4]
          Length = 139

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 77/120 (64%), Gaps = 1/120 (0%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGGILAKEISCGRIVTVSVSSITFKKPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP-RNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V D+V  Y +  KIG+TS++I  +VW  P +        + CEAT   VA+D  G P++I
Sbjct: 70  VGDVVCCYGECTKIGRTSMSINLEVWVKPVKEEGVGERFQVCEATFNYVAIDANGRPRAI 129


>gi|15641705|ref|NP_231337.1| hypothetical protein VC1701 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121586947|ref|ZP_01676726.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|147675608|ref|YP_001217249.1| hypothetical protein VC0395_A1305 [Vibrio cholerae O395]
 gi|153213898|ref|ZP_01949100.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|153800996|ref|ZP_01955582.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|153817178|ref|ZP_01969845.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153821837|ref|ZP_01974504.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|153825489|ref|ZP_01978156.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|153830921|ref|ZP_01983588.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|227081850|ref|YP_002810401.1| Acyl-CoA thioester hydrolase [Vibrio cholerae M66-2]
 gi|229508190|ref|ZP_04397695.1| acyl-CoA hydrolase [Vibrio cholerae BX 330286]
 gi|229511572|ref|ZP_04401051.1| acyl-CoA hydrolase [Vibrio cholerae B33]
 gi|229515092|ref|ZP_04404552.1| acyl-CoA hydrolase [Vibrio cholerae TMA 21]
 gi|229518711|ref|ZP_04408154.1| acyl-CoA hydrolase [Vibrio cholerae RC9]
 gi|229520697|ref|ZP_04410120.1| acyl-CoA hydrolase [Vibrio cholerae TM 11079-80]
 gi|229523793|ref|ZP_04413198.1| acyl-CoA hydrolase [Vibrio cholerae bv. albensis VL426]
 gi|229529270|ref|ZP_04418660.1| acyl-CoA hydrolase [Vibrio cholerae 12129(1)]
 gi|229607763|ref|YP_002878411.1| acyl-CoA hydrolase [Vibrio cholerae MJ-1236]
 gi|254224850|ref|ZP_04918465.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|254285357|ref|ZP_04960322.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|254848820|ref|ZP_05238170.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|297579284|ref|ZP_06941212.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298498220|ref|ZP_07008027.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9656219|gb|AAF94851.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121548782|gb|EAX58827.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|124115636|gb|EAY34456.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124123466|gb|EAY42209.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|125622538|gb|EAZ50857.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|126512327|gb|EAZ74921.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126520635|gb|EAZ77858.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|146317491|gb|ABQ22030.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|148873600|gb|EDL71735.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|149740901|gb|EDM54986.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|150424629|gb|EDN16565.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|227009738|gb|ACP05950.1| Acyl-CoA thioester hydrolase [Vibrio cholerae M66-2]
 gi|227013607|gb|ACP09817.1| Acyl-CoA thioester hydrolase [Vibrio cholerae O395]
 gi|229333044|gb|EEN98530.1| acyl-CoA hydrolase [Vibrio cholerae 12129(1)]
 gi|229337374|gb|EEO02391.1| acyl-CoA hydrolase [Vibrio cholerae bv. albensis VL426]
 gi|229342252|gb|EEO07247.1| acyl-CoA hydrolase [Vibrio cholerae TM 11079-80]
 gi|229343400|gb|EEO08375.1| acyl-CoA hydrolase [Vibrio cholerae RC9]
 gi|229347797|gb|EEO12756.1| acyl-CoA hydrolase [Vibrio cholerae TMA 21]
 gi|229351537|gb|EEO16478.1| acyl-CoA hydrolase [Vibrio cholerae B33]
 gi|229355695|gb|EEO20616.1| acyl-CoA hydrolase [Vibrio cholerae BX 330286]
 gi|229370418|gb|ACQ60841.1| acyl-CoA hydrolase [Vibrio cholerae MJ-1236]
 gi|254844525|gb|EET22939.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|297536878|gb|EFH75711.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297542553|gb|EFH78603.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 146

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 77/120 (64%), Gaps = 1/120 (0%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 17  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGGILAKEISCGRIVTVSVSSITFKKPVK 76

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP-RNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V D+V  Y +  KIG+TS++I  +VW  P +        + CEAT   VA+D  G P++I
Sbjct: 77  VGDVVCCYGECTKIGRTSMSINLEVWVKPVKEEGVGERFQVCEATFNYVAIDANGRPRAI 136


>gi|260768747|ref|ZP_05877681.1| acyl-CoA hydrolase [Vibrio furnissii CIP 102972]
 gi|260616777|gb|EEX41962.1| acyl-CoA hydrolase [Vibrio furnissii CIP 102972]
 gi|315180450|gb|ADT87364.1| acyl-CoA hydrolase [Vibrio furnissii NCTC 11218]
          Length = 133

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 78/122 (63%), Gaps = 3/122 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGGILAKEISCGRIVTVSVSSITFKKPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  KIG+TS++I  +VW  P   +   D  Q  CEAT   VA+D  G P+ 
Sbjct: 70  VGDVVCCYGECTKIGRTSMSINLEVWVKPIKEDGILDRFQ-VCEATFNYVAIDADGRPRP 128

Query: 149 IR 150
           I+
Sbjct: 129 IK 130


>gi|296115708|ref|ZP_06834334.1| acyl-CoA thioester hydrolase cytosolic long-chain
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295977685|gb|EFG84437.1| acyl-CoA thioester hydrolase cytosolic long-chain
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 129

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 71/120 (59%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           SG LT+++  MP D N  G++FGGW+MSQ+D+A    A+     R  T A+  ++F +P+
Sbjct: 9   SGELTIRVVAMPADTNPAGDIFGGWLMSQMDLAASTTAALCAGGRCATVAIDRVVFHRPV 68

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V D V IYT + K G+TS+TI  + W   R AS    QK  E   V VA+DE G P+ +
Sbjct: 69  SVGDEVSIYTHLTKQGRTSMTIAVEAWRRVRRASQ--RQKVTEGHFVFVALDENGRPRPV 126


>gi|188591198|ref|YP_001795798.1| acyl-CoA thioester hydrolase [Cupriavidus taiwanensis LMG 19424]
 gi|170938092|emb|CAP63076.1| putative Acyl-CoA thioester hydrolase [Cupriavidus taiwanensis LMG
           19424]
          Length = 134

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 71/117 (60%), Gaps = 1/117 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++  MP D N+ G+VFGGWIMSQ+DIA  I A +  + RV T AV   LF+ P+ V DL
Sbjct: 18  LRVVPMPADANVHGDVFGGWIMSQVDIAGSIPAVERAQGRVATVAVNSFLFKHPVFVGDL 77

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           V  Y  I K G+TS+T+  +V+   R   S+ + K  EAT+  VA DE   P+ + T
Sbjct: 78  VSFYADIVKTGRTSITVAVEVYAQ-RMRHSNEIVKVTEATLTYVATDESRQPRVLPT 133


>gi|296134848|ref|YP_003642090.1| thioesterase superfamily protein [Thiomonas intermedia K12]
 gi|294338801|emb|CAZ87135.1| Acyl-CoA thioester hydrolase [Thiomonas sp. 3As]
 gi|295794970|gb|ADG29760.1| thioesterase superfamily protein [Thiomonas intermedia K12]
          Length = 134

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 75/118 (63%), Gaps = 1/118 (0%)

Query: 32  VLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
           V TL+ Q  P DVN+ G++FGGWIM+Q+DIA GI A+   K RV T AV E +F++P+ V
Sbjct: 11  VPTLRTQARPADVNMHGDIFGGWIMAQVDIAGGIAAAWRAKGRVATVAVKEFVFKQPVLV 70

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            D++  +T+I  +G TSVT+  +V+   R  S+  + K  EA +  VAV E   P+ +
Sbjct: 71  GDVLSFFTEIDHVGHTSVTVRVEVYAQ-RTPSNVEVIKVTEALLTYVAVGEDRRPRPV 127


>gi|121593028|ref|YP_984924.1| thioesterase superfamily protein [Acidovorax sp. JS42]
 gi|120605108|gb|ABM40848.1| thioesterase superfamily protein [Acidovorax sp. JS42]
          Length = 143

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 80/127 (62%), Gaps = 3/127 (2%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
            Q+ +   L LK+  MP D N +G++FGGW+M+Q+D+A  +  ++  + R+ T AV E +
Sbjct: 10  TQLPADKELVLKVIPMPADTNGNGDIFGGWVMAQVDLAGSVLPARYIRGRMATVAVNEFI 69

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCP-RNASSDVLQKTCEATVVMVAVDEK 143
           F++P++V DL+  + ++ +IG TS+T+  +V+    R   S V  K  EA++  VA+DE 
Sbjct: 70  FKQPVRVGDLLSFFAEVTRIGNTSMTVQVEVYAEHIRTQGSYV--KVTEASLTYVAIDEN 127

Query: 144 GNPKSIR 150
           G P+ IR
Sbjct: 128 GRPRPIR 134


>gi|28898745|ref|NP_798350.1| putative acyl-CoA hydrolase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153840211|ref|ZP_01992878.1| acyl-CoA thioester hydrolase YciA [Vibrio parahaemolyticus AQ3810]
 gi|260877262|ref|ZP_05889617.1| acyl-CoA thioester hydrolase YciA [Vibrio parahaemolyticus AN-5034]
 gi|260897791|ref|ZP_05906287.1| acyl-CoA thioester hydrolase YciA [Vibrio parahaemolyticus
           Peru-466]
 gi|260902306|ref|ZP_05910701.1| acyl-CoA thioester hydrolase YciA [Vibrio parahaemolyticus AQ4037]
 gi|28806963|dbj|BAC60234.1| putative acyl-CoA hydrolase [Vibrio parahaemolyticus RIMD 2210633]
 gi|149746124|gb|EDM57254.1| acyl-CoA thioester hydrolase YciA [Vibrio parahaemolyticus AQ3810]
 gi|308087615|gb|EFO37310.1| acyl-CoA thioester hydrolase YciA [Vibrio parahaemolyticus
           Peru-466]
 gi|308090338|gb|EFO40033.1| acyl-CoA thioester hydrolase YciA [Vibrio parahaemolyticus AN-5034]
 gi|308110219|gb|EFO47759.1| acyl-CoA thioester hydrolase YciA [Vibrio parahaemolyticus AQ4037]
 gi|328474693|gb|EGF45498.1| putative acyl-CoA hydrolase [Vibrio parahaemolyticus 10329]
          Length = 131

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 77/122 (63%), Gaps = 1/122 (0%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A  I A ++C  RVVT +V+ + F+KP+ 
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGAILAKEICSGRVVTVSVSSITFKKPVS 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASS-DVLQKTCEATVVMVAVDEKGNPKSI 149
           V D+V  Y   +KIG+TS+++  +VW  P      +     CEAT   VA+D +G P+ +
Sbjct: 70  VGDVVCCYGVCKKIGRTSMSVDLEVWVKPVKVDGIEDRFMVCEATFNYVAIDSEGKPRPV 129

Query: 150 RT 151
           ++
Sbjct: 130 QS 131


>gi|156975043|ref|YP_001445950.1| hypothetical protein VIBHAR_02769 [Vibrio harveyi ATCC BAA-1116]
 gi|156526637|gb|ABU71723.1| hypothetical protein VIBHAR_02769 [Vibrio harveyi ATCC BAA-1116]
          Length = 169

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/122 (41%), Positives = 78/122 (63%), Gaps = 3/122 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 48  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGGILAKEISSGRIVTVSVSSITFKKPVR 107

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  KIG+TS++I  +VW  P   +   D     C+AT   VA+D +G P+ 
Sbjct: 108 VGDVVCCYGECTKIGRTSMSIDLEVWVKPIKEHGIEDRFM-VCDATFNYVAIDSEGKPRP 166

Query: 149 IR 150
           I+
Sbjct: 167 IQ 168


>gi|92116667|ref|YP_576396.1| thioesterase superfamily protein [Nitrobacter hamburgensis X14]
 gi|91799561|gb|ABE61936.1| thioesterase superfamily [Nitrobacter hamburgensis X14]
          Length = 154

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 73/119 (61%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L  +   MP D N +G++FGGW++SQ+DI  GI AS+L K R VT A+  + F KP+ 
Sbjct: 24  GELCTRTLAMPADTNQNGDIFGGWLLSQMDIGGGIFASKLAKSRTVTVAIDAMNFRKPVF 83

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V DLV ++  + +IGKTS+T++ + W   R     +L    +     VA+D++GNP+ +
Sbjct: 84  VGDLVSVHATLVRIGKTSITVHLEAWVMRRKEMQFIL--VTDGKFTYVAIDDQGNPREV 140


>gi|171060697|ref|YP_001793046.1| thioesterase superfamily protein [Leptothrix cholodnii SP-6]
 gi|170778142|gb|ACB36281.1| thioesterase superfamily protein [Leptothrix cholodnii SP-6]
          Length = 155

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 73/117 (62%), Gaps = 1/117 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L L++  MP D N +G++FGGWIM+Q+D+A  +   ++ + RV T AV + +F++P+ V 
Sbjct: 29  LVLRVMPMPADANPNGDIFGGWIMAQVDLAGAVLPVRIARGRVATVAVNQFIFKQPVSVG 88

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           DL+  Y    +IG TSVT++ +V+   R  +     K  EA +  VA+D +G P++I
Sbjct: 89  DLLSFYATATRIGNTSVTVHVEVYAE-RKPADPQFVKVTEANLTYVAIDLEGRPRTI 144


>gi|56695355|ref|YP_165703.1| thioesterase family protein [Ruegeria pomeroyi DSS-3]
 gi|56677092|gb|AAV93758.1| thioesterase family protein [Ruegeria pomeroyi DSS-3]
          Length = 138

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 74/122 (60%), Gaps = 2/122 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
             SG LTL+   MP DVN++G++FGGW++SQ+DIA G+ A      RV T AV  + F +
Sbjct: 13  QPSGELTLRTLAMPRDVNVNGDIFGGWVLSQMDIAAGLTAGARAGGRVTTVAVDAMKFIR 72

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           P+ V D++ IY Q+ ++G++S+ I  + W         + +K  EA    VA+DE+G P+
Sbjct: 73  PVGVGDVLCIYCQVVRVGRSSMAIEIEAWAL--RDRQGLREKVTEAVFTFVAIDEEGRPR 130

Query: 148 SI 149
            +
Sbjct: 131 PV 132


>gi|260219965|emb|CBA27030.1| Uncharacterized acyl-CoA thioester hydrolase HI0827 [Curvibacter
           putative symbiont of Hydra magnipapillata]
          Length = 141

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 81/124 (65%), Gaps = 1/124 (0%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q+ +   L LK+  MP D N +G++FGGW+M+Q+D+A  +  ++  + R+ T AV E +F
Sbjct: 14  QLPTDQELVLKVIPMPGDCNANGDIFGGWVMAQVDLAGSVLPARYTQGRMATVAVNEFIF 73

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           ++P++V D++  ++++ +IG+TS+T+  +V+   R  S     K  EA++  VA+D++G 
Sbjct: 74  KQPVRVGDILSFFSKVSRIGRTSITVKVEVY-AERYRSQGQYTKVTEASLTYVAIDDQGR 132

Query: 146 PKSI 149
           P+ I
Sbjct: 133 PRPI 136


>gi|59711865|ref|YP_204641.1| acyl-CoA hydrolase [Vibrio fischeri ES114]
 gi|197335390|ref|YP_002156056.1| acyl-CoA thioester hydrolase YciA [Vibrio fischeri MJ11]
 gi|59479966|gb|AAW85753.1| acyl-CoA hydrolase [Vibrio fischeri ES114]
 gi|197316880|gb|ACH66327.1| acyl-CoA thioester hydrolase YciA [Vibrio fischeri MJ11]
          Length = 136

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 78/121 (64%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+  +MP D N +G++FGGWIMSQ+D+A  I A ++   R+VT +V+ + F+KP++
Sbjct: 13  GQLLLRTLSMPADTNANGDIFGGWIMSQLDLAGAILAQEISGGRIVTVSVSSITFKKPVK 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  K+G+TS++I  +VW  P   +  S   Q  CEAT   VA+D  G P++
Sbjct: 73  VGDVVCCYGECTKVGRTSMSIDLEVWVKPIKEDEVSHRFQ-VCEATFNYVAIDSNGKPRA 131

Query: 149 I 149
           I
Sbjct: 132 I 132


>gi|163803019|ref|ZP_02196905.1| hypothetical protein 1103602000574_AND4_00200 [Vibrio sp. AND4]
 gi|159173193|gb|EDP58022.1| hypothetical protein AND4_00200 [Vibrio sp. AND4]
          Length = 136

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 51/122 (41%), Positives = 77/122 (63%), Gaps = 3/122 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F++P++
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGGILAKEISSGRIVTVSVSGITFKRPVR 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  KIG+TS++I  +VW  P   +   D     C+AT   VA+D  G P+ 
Sbjct: 70  VGDVVCCYGECTKIGRTSMSIDLEVWVKPIKEHGIEDRFM-VCDATFNYVAIDSDGKPRP 128

Query: 149 IR 150
           IR
Sbjct: 129 IR 130


>gi|269959647|ref|ZP_06174027.1| Putative acyl-CoA thioester hydrolase yciA [Vibrio harveyi 1DA3]
 gi|269835570|gb|EEZ89649.1| Putative acyl-CoA thioester hydrolase yciA [Vibrio harveyi 1DA3]
          Length = 135

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 51/122 (41%), Positives = 78/122 (63%), Gaps = 3/122 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 14  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGGILAKEISSGRIVTVSVSSITFKKPVR 73

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  KIG+TS++I  +VW  P   +   D     C+AT   VA+D +G P+ 
Sbjct: 74  VGDVVCCYGECTKIGRTSMSIDLEVWVKPIKEHGIEDRFM-VCDATFNYVAIDTEGKPRP 132

Query: 149 IR 150
           I+
Sbjct: 133 IQ 134


>gi|218709141|ref|YP_002416762.1| acyl-Coa thioester hydrolase [Vibrio splendidus LGP32]
 gi|218322160|emb|CAV18274.1| Acyl-CoA thioester hydrolase [Vibrio splendidus LGP32]
          Length = 169

 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 55/139 (39%), Positives = 82/139 (58%), Gaps = 3/139 (2%)

Query: 13  INIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCK 72
           IN I    + +   ++  G L L+   MP+D N  G +FGGWIMSQ+D+A GI A ++  
Sbjct: 30  INTIKSTTMTIQSTLNPIGSLLLRTLAMPSDTNAAGQIFGGWIMSQLDLAGGILAKEISN 89

Query: 73  CRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKT 130
            ++VT +V+ + F++P+ V D+V +Y    KIG++S+ I  +VW  P   +   D   K 
Sbjct: 90  GKIVTVSVSSIEFKQPVSVGDVVCVYGDCTKIGRSSMNIDLEVWVKPVLDHGIGD-RYKV 148

Query: 131 CEATVVMVAVDEKGNPKSI 149
           C AT   VAVDE G P+SI
Sbjct: 149 CGATFNYVAVDESGKPRSI 167


>gi|94309335|ref|YP_582545.1| thioesterase superfamily protein [Cupriavidus metallidurans CH34]
 gi|93353187|gb|ABF07276.1| Putative thioesterase Protein [Cupriavidus metallidurans CH34]
          Length = 157

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/125 (40%), Positives = 73/125 (58%), Gaps = 1/125 (0%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
            V ++ S     L++  MP D N+ G+VFGGWIMSQ+D+A  I A +  + RV T AV  
Sbjct: 29  FVPELPSGKNPALRVVPMPADANVHGDVFGGWIMSQVDMAGSIPAVERAQGRVATVAVNS 88

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
            LF+ P+ V DLV  Y  I K G+TS+T+  +V+   R   ++ + K  EAT+  VA DE
Sbjct: 89  FLFKNPVFVGDLVSFYADIVKTGRTSITVSVEVYAQ-RMRHANEIVKVTEATLTYVATDE 147

Query: 143 KGNPK 147
              P+
Sbjct: 148 SRQPR 152


>gi|254509430|ref|ZP_05121510.1| acyl-CoA thioester hydrolase [Vibrio parahaemolyticus 16]
 gi|219547648|gb|EED24693.1| acyl-CoA thioester hydrolase [Vibrio parahaemolyticus 16]
          Length = 114

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 76/115 (66%), Gaps = 5/115 (4%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++V D+V  Y 
Sbjct: 1   MPADTNANGDIFGGWIMSQLDLAGGILAKEISAGRIVTVSVSSITFKKPVKVGDVVCCYG 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQ---KTCEATVVMVAVDEKGNPKSIRT 151
           +  KIG+TS++I  +VW  P   + D +Q   + CEAT   VA+D  G P+ I T
Sbjct: 61  ECTKIGRTSMSINLEVWVKP--VTEDGIQSRYQVCEATFNYVAIDGNGKPRPIVT 113


>gi|323493291|ref|ZP_08098415.1| hypothetical protein VIBR0546_10754 [Vibrio brasiliensis LMG 20546]
 gi|323312454|gb|EGA65594.1| hypothetical protein VIBR0546_10754 [Vibrio brasiliensis LMG 20546]
          Length = 130

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 78/122 (63%), Gaps = 3/122 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGGILAKEISSGRIVTVSVSSITFKKPVR 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  +IG+TS++I  +VW  P   +   D     C+AT   VA+D +G P+ 
Sbjct: 70  VGDVVCCYGECTRIGRTSMSIDLEVWVKPVKEHGLEDRFM-VCDATFNYVAIDAEGKPRP 128

Query: 149 IR 150
           I+
Sbjct: 129 IQ 130


>gi|260779048|ref|ZP_05887940.1| putative acyl-coA hydrolase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260605212|gb|EEX31507.1| putative acyl-coA hydrolase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 132

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 78/122 (63%), Gaps = 3/122 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + L+   MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 10  GQMLLRTLAMPADTNANGDIFGGWIMSQLDLAGGILAKEISGGRIVTVSVSSITFKKPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  KIG+TS++I  +VW  P   +   D     C+AT   VA+D +G P+ 
Sbjct: 70  VGDVVCCYGECTKIGRTSMSIDLEVWVKPVKEHGIEDRFM-VCDATFNYVAIDTEGKPRP 128

Query: 149 IR 150
           I+
Sbjct: 129 IK 130


>gi|300313155|ref|YP_003777247.1| acyl-CoA hydrolase [Herbaspirillum seropedicae SmR1]
 gi|300075940|gb|ADJ65339.1| acyl-CoA hydrolase (thioesterase) protein [Herbaspirillum
           seropedicae SmR1]
          Length = 144

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 73/126 (57%), Gaps = 1/126 (0%)

Query: 24  VCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTEL 83
           V ++       L++  MP+D N+ G+VFGGWIM+Q+DIA  + A++    RV T AV   
Sbjct: 5   VPELPPGKAPQLRVMPMPSDANVYGDVFGGWIMAQVDIAGSLPATRRANGRVATIAVNSF 64

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEK 143
           LF+ P+ V DL+  Y  I K+G TS+T+  +V+   RN     + K  EAT+  VA DE 
Sbjct: 65  LFKNPVFVGDLLSFYADIVKVGNTSITVNVEVYAE-RNRLQTEIVKVTEATLTYVATDEN 123

Query: 144 GNPKSI 149
             P+ +
Sbjct: 124 RKPRPL 129


>gi|113461411|ref|YP_719480.1| acyl-CoA hydrolase [Haemophilus somnus 129PT]
 gi|170718964|ref|YP_001784129.1| thioesterase superfamily protein [Haemophilus somnus 2336]
 gi|112823454|gb|ABI25543.1| possible acyl-CoA hydrolase [Haemophilus somnus 129PT]
 gi|168827093|gb|ACA32464.1| thioesterase superfamily protein [Haemophilus somnus 2336]
          Length = 154

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/124 (43%), Positives = 77/124 (62%), Gaps = 3/124 (2%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            S GVL L+   MP++ N +G++FGGWIMS++DI   I A ++   RVVT AV  + F K
Sbjct: 12  QSKGVLLLRTLAMPSNTNANGDIFGGWIMSKMDIGGAILAKEIAHGRVVTVAVNSMTFIK 71

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           PI V D+V  Y +  KIG++SV I  +VW   + AS  + ++ C  EA    VAVD +G 
Sbjct: 72  PIAVGDVVCCYGECVKIGRSSVQIKIEVWV-KKVASEPIGERYCVTEAVFTFVAVDAQGK 130

Query: 146 PKSI 149
           P++I
Sbjct: 131 PRAI 134


>gi|330823271|ref|YP_004386574.1| thioesterase superfamily protein [Alicycliphilus denitrificans
           K601]
 gi|329308643|gb|AEB83058.1| thioesterase superfamily protein [Alicycliphilus denitrificans
           K601]
          Length = 141

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 78/125 (62%), Gaps = 1/125 (0%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
            Q+ +   L LK+  MP D N +G++FGGW+M+Q+D+A  +  ++  + R+ T AV E +
Sbjct: 10  TQLPADKELVLKVMPMPADTNNNGDIFGGWVMAQVDLAGSVLPARRIQGRMATVAVNEFV 69

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           F++P++V DL+  + +++++G TS+T+  +V+          L K  EA++  VA+DE G
Sbjct: 70  FKQPVRVGDLLSFFAEVKRVGNTSITVQVEVYAEHIRTQGRYL-KVTEASLTYVAIDENG 128

Query: 145 NPKSI 149
            P+ I
Sbjct: 129 RPRPI 133


>gi|159044761|ref|YP_001533555.1| putative Acyl-CoA thioester hydrolase [Dinoroseobacter shibae DFL
           12]
 gi|157912521|gb|ABV93954.1| putative Acyl-CoA thioester hydrolase [Dinoroseobacter shibae DFL
           12]
          Length = 136

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 74/119 (62%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LTL+   MP DVN++G++FGGW++SQ+DIA GI A +  + RV T A+  + F +P++
Sbjct: 15  GALTLRTLAMPADVNVNGDIFGGWVLSQMDIAAGIVAGERAQGRVATVAIDAMKFIRPVK 74

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V D++ IY +I ++G++S+ +  + W           +K  EA    VA+DE+G  + +
Sbjct: 75  VGDVLCIYAEIERVGRSSMGVALEAWVL--RGRIGAREKVTEALFTFVAIDEEGRTRPV 131


>gi|319761401|ref|YP_004125338.1| thioesterase superfamily protein [Alicycliphilus denitrificans BC]
 gi|317115962|gb|ADU98450.1| thioesterase superfamily protein [Alicycliphilus denitrificans BC]
          Length = 141

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 78/125 (62%), Gaps = 1/125 (0%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
            Q+ +   L LK+  MP D N +G++FGGW+M+Q+D+A  +  ++  + R+ T AV E +
Sbjct: 10  TQLPTDKELVLKVMPMPADTNNNGDIFGGWVMAQVDLAGSVLPARRIQGRMATVAVNEFV 69

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           F++P++V DL+  + +++++G TS+T+  +V+          L K  EA++  VA+DE G
Sbjct: 70  FKQPVRVGDLLSFFAEVKRVGNTSITVQVEVYAEHIRTQGRYL-KVTEASLTYVAIDENG 128

Query: 145 NPKSI 149
            P+ I
Sbjct: 129 RPRPI 133


>gi|118590666|ref|ZP_01548067.1| thioesterase family protein [Stappia aggregata IAM 12614]
 gi|118436642|gb|EAV43282.1| thioesterase family protein [Stappia aggregata IAM 12614]
          Length = 128

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 73/120 (60%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G LTL+   MP D N  G++FGGW++SQ+D+A GI A Q  + RVVT AV ++ F +P+
Sbjct: 7   TGDLTLRTMAMPADTNASGDIFGGWVLSQMDLAGGIAAGQRAEGRVVTIAVDKMKFIRPV 66

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V D++ +Y ++ ++G +S+ I  + W           +K  EA   MVAVD+ G P+ +
Sbjct: 67  HVGDVLCVYAEVIRVGNSSMEIKLESWALRHRYGH--REKVTEAVFTMVAVDDGGKPRPV 124


>gi|86147771|ref|ZP_01066078.1| Acyl-CoA hydrolase [Vibrio sp. MED222]
 gi|85834409|gb|EAQ52560.1| Acyl-CoA hydrolase [Vibrio sp. MED222]
          Length = 132

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 75/121 (61%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP+D N  G +FGGWIMSQ+D+A GI A ++   ++VT +V+ + F++P+ 
Sbjct: 11  GSLLLRTLAMPSDTNAAGQIFGGWIMSQLDLAGGILAKEISNGKIVTVSVSSIEFKQPVS 70

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V +Y    KIG++S+ I  +VW  P   +   D   K C AT   VAVDE G P+S
Sbjct: 71  VGDVVCVYGDCTKIGRSSMNIDLEVWVKPVLDHGIGD-RYKVCGATFNYVAVDESGKPRS 129

Query: 149 I 149
           I
Sbjct: 130 I 130


>gi|260773028|ref|ZP_05881944.1| acyl-CoA hydrolase [Vibrio metschnikovii CIP 69.14]
 gi|260612167|gb|EEX37370.1| acyl-CoA hydrolase [Vibrio metschnikovii CIP 69.14]
          Length = 116

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 74/113 (65%), Gaps = 3/113 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++V D+V  Y 
Sbjct: 1   MPADTNANGDIFGGWIMSQLDLAGGILAKEISSGRIVTVSVSSITFKKPVKVGDVVCCYG 60

Query: 100 QIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           +  KIG+TS++I  +VW  P   +   D  Q  CEAT   VA+D  G P+ I+
Sbjct: 61  ECTKIGRTSMSINLEVWVKPIKEDGVLDRFQ-VCEATFNYVAIDADGRPRVIK 112


>gi|261252632|ref|ZP_05945205.1| putative acyl-coA hydrolase [Vibrio orientalis CIP 102891]
 gi|260936023|gb|EEX92012.1| putative acyl-coA hydrolase [Vibrio orientalis CIP 102891]
          Length = 126

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 77/122 (63%), Gaps = 3/122 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++
Sbjct: 6   GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGGILAKEISSGRIVTVSVSSITFKKPVR 65

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  +IG+TS++I  +VW  P   +   D     C+AT   VA+D  G P+ 
Sbjct: 66  VGDVVCCYGECTRIGRTSMSIDLEVWVKPVKEHGLEDRFM-VCDATFNYVAIDADGKPRP 124

Query: 149 IR 150
           I+
Sbjct: 125 IQ 126


>gi|48428783|gb|AAT42431.1| acyl-CoA hydrolase [Collimonas fungivorans Ter331]
          Length = 135

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 75/124 (60%), Gaps = 1/124 (0%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q+    +  L++  MP+D N+ G+VFGGWIM+Q+DIA  + A++    RV T AV   LF
Sbjct: 8   QLPPDTMPQLRVMPMPSDANVHGDVFGGWIMAQVDIAGSLPATRRANGRVATIAVNSFLF 67

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           ++P+ V DL+  Y +I K+G TS+T+  +V+   RN     + K  EAT+  VA D +  
Sbjct: 68  KQPVFVGDLLSFYAEIVKVGNTSITVNVEVY-AERNRLQTEVVKVTEATLTYVATDAQRK 126

Query: 146 PKSI 149
           P+ +
Sbjct: 127 PRQL 130


>gi|148977370|ref|ZP_01813970.1| acyl-CoA hydrolase [Vibrionales bacterium SWAT-3]
 gi|145963322|gb|EDK28587.1| acyl-CoA hydrolase [Vibrionales bacterium SWAT-3]
          Length = 132

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/122 (41%), Positives = 76/122 (62%), Gaps = 3/122 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP+D N  G +FGGWIMSQ+D+A GI A ++   ++VT +V+ + F++P+ 
Sbjct: 11  GSLLLRTLAMPSDTNAAGQIFGGWIMSQLDLAGGILAKEISNGKIVTVSVSSIEFKQPVS 70

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V +Y    KIG++S+ I  +VW  P   +   D   K C AT   VAVDE G P++
Sbjct: 71  VGDVVCVYGDCTKIGRSSMNIDLEVWVKPVLDHGIGD-RYKVCGATFNYVAVDESGKPRT 129

Query: 149 IR 150
           I+
Sbjct: 130 IK 131


>gi|302879072|ref|YP_003847636.1| thioesterase superfamily protein [Gallionella capsiferriformans
           ES-2]
 gi|302581861|gb|ADL55872.1| thioesterase superfamily protein [Gallionella capsiferriformans
           ES-2]
          Length = 131

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           TL++ TMP D +  G+VFGGWIM+Q+DIA  I A    + RV T AV   LF++P+ + D
Sbjct: 13  TLRVVTMPADCSYTGDVFGGWIMAQVDIAGSIPAVHRARGRVATVAVNSFLFKQPVFMGD 72

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           +V  Y  I  +G+TS+ +  +V+   R+ +  V  K  EAT+  VAVDE   P+ +  E
Sbjct: 73  IVSFYAHIDNVGRTSIAVNVEVYVQ-RDPAQPVCVKVTEATLTYVAVDENRRPREVPPE 130


>gi|222109796|ref|YP_002552060.1| thioesterase superfamily protein [Acidovorax ebreus TPSY]
 gi|221729240|gb|ACM32060.1| thioesterase superfamily protein [Acidovorax ebreus TPSY]
          Length = 157

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 80/127 (62%), Gaps = 3/127 (2%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
            Q+ +   L LK+  MP D N +G++FGGW+M+Q+D+A  +  ++  + R+ T AV E +
Sbjct: 24  SQLPADKELVLKVIPMPADTNGNGDIFGGWVMAQVDLAGSVLPARYIRGRMATVAVNEFI 83

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCP-RNASSDVLQKTCEATVVMVAVDEK 143
           F++P++V DL+  + ++ +IG TS+T+  +V+    R   S V  K  EA++  VA+DE 
Sbjct: 84  FKQPVRVGDLLSFFAEVTRIGNTSMTVQVEVYAEHIRTQGSYV--KVTEASLTYVAIDEN 141

Query: 144 GNPKSIR 150
           G P+ I+
Sbjct: 142 GRPRPIQ 148


>gi|148262857|ref|YP_001229563.1| thioesterase superfamily protein [Geobacter uraniireducens Rf4]
 gi|146396357|gb|ABQ24990.1| thioesterase superfamily protein [Geobacter uraniireducens Rf4]
          Length = 141

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 73/122 (59%), Gaps = 5/122 (4%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
           +  G L L+   MP+D N +G++FGGWIMSQ+DIA G+ A ++   R VT AV  + F K
Sbjct: 7   YPEGELLLRTSPMPSDTNANGDIFGGWIMSQMDIAGGMMAIEITGGRAVTIAVDAMKFIK 66

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCP-----RNASSDVLQKTCEATVVMVAVDE 142
           P++V D+V  Y Q+ +IG TSVTI  +VW  P     +    +V     EA+   VAVD 
Sbjct: 67  PVRVGDVVCCYGQVTRIGNTSVTIRLEVWVKPGFLEIKLDKENVFSMVTEASYTYVAVDH 126

Query: 143 KG 144
           +G
Sbjct: 127 EG 128


>gi|329118661|ref|ZP_08247365.1| acyl-CoA thioester hydrolase YciA [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327465396|gb|EGF11677.1| acyl-CoA thioester hydrolase YciA [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 137

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 75/121 (61%), Gaps = 1/121 (0%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+  T P D N +G++FGGW+M+Q+DIA GI A +  K R+VT A  +++F +P+ 
Sbjct: 16  GSLLLRTMTRPADTNPNGDIFGGWLMAQMDIAGGILACETAKGRIVTVAADKIVFHRPVA 75

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK-TCEATVVMVAVDEKGNPKSI 149
           V D+V  Y ++ ++G TS+ I  +VW    + +S   Q+   EA    VA+D +G P+ +
Sbjct: 76  VGDVVGCYGEVARVGNTSLQIRIEVWVHSASFASFEEQRLVTEALFTYVAIDNEGRPRPV 135

Query: 150 R 150
           R
Sbjct: 136 R 136


>gi|332528860|ref|ZP_08404834.1| thioesterase superfamily protein [Hylemonella gracilis ATCC 19624]
 gi|332041719|gb|EGI78071.1| thioesterase superfamily protein [Hylemonella gracilis ATCC 19624]
          Length = 147

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 76/117 (64%), Gaps = 1/117 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L LK+  MP D N +G++FGGW+M+Q+D+A  +  ++    R+ T AV E LF++P++V 
Sbjct: 23  LVLKVIPMPADCNANGDIFGGWVMAQVDLAGSVIPARYAGGRMATVAVNEFLFKQPVRVG 82

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           DL+  Y+++ +IG+TS+T+  +V+   R  +     K  EAT+  V +DE+G P+ +
Sbjct: 83  DLLSFYSKLVRIGRTSLTVKVEVFAE-RIPAQGQFVKVTEATLTYVCIDEQGKPREV 138


>gi|27377541|ref|NP_769070.1| acyl-CoA hydrolase [Bradyrhizobium japonicum USDA 110]
 gi|27350685|dbj|BAC47695.1| acyl-CoA hydrolase [Bradyrhizobium japonicum USDA 110]
          Length = 143

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 73/120 (60%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           SG L ++   MP D N +G++FGGW++SQ+D+  G+ AS++ K R VT A+  + F K +
Sbjct: 17  SGDLCIRTLAMPADTNANGDIFGGWLLSQMDVGGGVFASKVAKSRTVTVAIEAMNFRKAV 76

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V DLV +Y  + ++G+TS+T++ + W   R  +   L    +     V++D+ G P+SI
Sbjct: 77  YVGDLVSVYANLVRVGRTSLTVHLEAWALRRREADPFL--VTDGNFTYVSIDDHGRPQSI 134


>gi|71905991|ref|YP_283578.1| thioesterase superfamily protein [Dechloromonas aromatica RCB]
 gi|71845612|gb|AAZ45108.1| Thioesterase superfamily [Dechloromonas aromatica RCB]
          Length = 151

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 77/119 (64%), Gaps = 1/119 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           TL++  MP D+N +G+VFGGW+M+Q+D+A  I A +    RV T +V   LF++P+ V D
Sbjct: 33  TLRVVPMPADLNQNGDVFGGWVMAQVDVAGAIPAMRRACGRVATVSVNSFLFKQPVSVGD 92

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           +V +Y  I ++G TS+T+  +V+   RN ++ ++ K  EA +  VA+D  G  +++ TE
Sbjct: 93  IVSLYADIVRVGTTSITVRVEVY-AERNYAAPIIVKVTEAELTYVAIDGAGMKRNVPTE 150


>gi|152978557|ref|YP_001344186.1| thioesterase superfamily protein [Actinobacillus succinogenes 130Z]
 gi|150840280|gb|ABR74251.1| thioesterase superfamily protein [Actinobacillus succinogenes 130Z]
          Length = 147

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 77/127 (60%), Gaps = 4/127 (3%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
              G L L+   MP+D N +G++FGGWIMSQ+D+   I A ++ K RVVT  V ++ F +
Sbjct: 9   QPEGALILRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAKGRVVTVCVDKITFLR 68

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           PI V D+V  Y ++ K+G+TS+ +  +VW   +   + V  + C  EA    VA+DEKG 
Sbjct: 69  PISVGDVVCCYGKLVKVGRTSMQVKVEVWI--KQVYTGVRDRHCVTEALFTYVAIDEKGK 126

Query: 146 PKSIRTE 152
           P+++  E
Sbjct: 127 PRAVPQE 133


>gi|54309671|ref|YP_130691.1| putative acyl-CoA hydrolase [Photobacterium profundum SS9]
 gi|46914109|emb|CAG20889.1| putative acyl-CoA hydrolase [Photobacterium profundum SS9]
          Length = 132

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 76/121 (62%), Gaps = 1/121 (0%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A  I A ++   RVVT +V  + F+ P++
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGAILAKEISGGRVVTVSVDSIAFKAPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP-RNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V D+V  Y + ++IG TS+++  +VW  P  + S     + CEAT   VA++ +G P+ I
Sbjct: 70  VGDVVCCYGECKRIGNTSMSVALEVWVKPVAHESVGDRYRVCEATFNYVAINSEGRPRPI 129

Query: 150 R 150
           +
Sbjct: 130 K 130


>gi|149926664|ref|ZP_01914924.1| Acyl-CoA hydrolase [Limnobacter sp. MED105]
 gi|149824593|gb|EDM83809.1| Acyl-CoA hydrolase [Limnobacter sp. MED105]
          Length = 113

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 69/110 (62%), Gaps = 1/110 (0%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  G+VFGGWIM+Q+D+A  + A+   K R+VT AV E +F++P+ V DL   Y 
Sbjct: 1   MPKDSNASGDVFGGWIMAQVDLAGSVPATAHAKGRIVTVAVNEFIFKEPVFVGDLCSFYA 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ K+G+TS+ IY +V+   R    DV  K  EA V  VAVDE  N + +
Sbjct: 61  EVVKVGRTSMQIYVEVFAQRRLKPDDV-AKVTEAYVTYVAVDENRNSRPV 109


>gi|330818277|ref|YP_004361982.1| Thioesterase family protein [Burkholderia gladioli BSR3]
 gi|327370670|gb|AEA62026.1| Thioesterase family protein [Burkholderia gladioli BSR3]
          Length = 132

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 71/115 (61%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P+D N+ G+VFGGWIMSQ+DIA  I AS+    RV T AV   LF++P+ V DL
Sbjct: 15  LRVVPQPSDANVHGDVFGGWIMSQVDIAGSIPASRRANGRVATIAVNSFLFKQPVFVGDL 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V  Y  I K G TS+TI  +V+      + +V+ K  EAT+  VA D +  P+++
Sbjct: 75  VSFYANIVKTGNTSITIGVEVYAQRMGLAGEVV-KVTEATLTYVATDSERRPRAL 128


>gi|319897679|ref|YP_004135876.1| hydrolase [Haemophilus influenzae F3031]
 gi|317433185|emb|CBY81559.1| predicted hydrolase [Haemophilus influenzae F3031]
          Length = 158

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 76/127 (59%), Gaps = 3/127 (2%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            S GVL L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F K
Sbjct: 12  QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIK 71

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           PI V D+V  Y Q  KIG++S+ I  +VW   + AS  + ++ C  +A    VAVD  G 
Sbjct: 72  PISVGDVVCCYGQCLKIGRSSIKIKVEVWV-KKVASEPIGERYCVTDAVFTFVAVDNNGR 130

Query: 146 PKSIRTE 152
            ++I  E
Sbjct: 131 SRTIPRE 137


>gi|262393845|ref|YP_003285699.1| putative acyl-coA hydrolase [Vibrio sp. Ex25]
 gi|262337439|gb|ACY51234.1| putative acyl-coA hydrolase [Vibrio sp. Ex25]
          Length = 131

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 78/122 (63%), Gaps = 3/122 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A  I A ++   RVVT +V+ + F+KP+ 
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGAILAKEISSGRVVTVSVSSITFKKPVG 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK--TCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  KIG+TS+++  +VW  P  A   V ++   C+AT   VA+D +G P+ 
Sbjct: 70  VGDVVCCYGECTKIGRTSMSVDLEVWVKPVKAHG-VGERFMVCDATFNYVAIDSEGKPRP 128

Query: 149 IR 150
           ++
Sbjct: 129 VQ 130


>gi|90412164|ref|ZP_01220170.1| putative acyl-CoA hydrolase [Photobacterium profundum 3TCK]
 gi|90326888|gb|EAS43273.1| putative acyl-CoA hydrolase [Photobacterium profundum 3TCK]
          Length = 132

 Score =  100 bits (250), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 76/121 (62%), Gaps = 1/121 (0%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A  I A ++   RVVT +V  + F+ P++
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGAILAKEISGGRVVTVSVDSIAFKAPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP-RNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V D+V  Y + ++IG TS+++  +VW  P  + S     + CEAT   VA++ +G P+ I
Sbjct: 70  VGDVVCCYGECKRIGNTSMSVGLEVWVKPVAHESVGDRYRVCEATFNYVAINSEGRPRPI 129

Query: 150 R 150
           +
Sbjct: 130 K 130


>gi|330830385|ref|YP_004393337.1| acyl-CoA thioester hydrolase YciA [Aeromonas veronii B565]
 gi|328805521|gb|AEB50720.1| Acyl-CoA thioester hydrolase YciA [Aeromonas veronii B565]
          Length = 149

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 81/138 (58%), Gaps = 4/138 (2%)

Query: 15  IITKKEVLMV-CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKC 73
           I  ++ V+MV  + H  G L L+   MP D N +G++FGGWIMSQ+DI  GI A +L K 
Sbjct: 9   IHEREAVMMVDTKRHPDGELLLRTLAMPADTNPNGDIFGGWIMSQMDIGGGIMAKELAKG 68

Query: 74  RVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC-- 131
           R+ T +V  + F  P++V D+V  Y +  KIG++S+ +  +VW  P    +D  Q+ C  
Sbjct: 69  RICTVSVEGMTFHSPVKVGDVVCCYGRCMKIGRSSMKLKLEVWVKPVLRENDA-QRYCVT 127

Query: 132 EATVVMVAVDEKGNPKSI 149
           E     VA+DE+G  + +
Sbjct: 128 EGIFTYVAIDEQGKSRPV 145


>gi|121727337|ref|ZP_01680484.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|121630343|gb|EAX62740.1| conserved hypothetical protein [Vibrio cholerae V52]
          Length = 121

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 73/111 (65%), Gaps = 1/111 (0%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+KP++V D+V  Y 
Sbjct: 1   MPADTNANGDIFGGWIMSQLDLAGGILAKEISCGRIVTVSVSSITFKKPVKVGDVVCCYG 60

Query: 100 QIRKIGKTSVTIYCDVWTCP-RNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  KIG+TS++I  +VW  P +        + CEAT   VA+D  G P++I
Sbjct: 61  ECTKIGRTSMSINLEVWVKPVKEEGVGERFQVCEATFNYVAIDANGRPRAI 111


>gi|260912959|ref|ZP_05919444.1| acyl-CoA thioester hydrolase YciA [Pasteurella dagmatis ATCC 43325]
 gi|260632949|gb|EEX51115.1| acyl-CoA thioester hydrolase YciA [Pasteurella dagmatis ATCC 43325]
          Length = 153

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 77/127 (60%), Gaps = 3/127 (2%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
           ++ G L L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F K
Sbjct: 14  YAKGTLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVDSMTFIK 73

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           PI V D+V  Y Q   +G++S+ I  +VW   + AS  + ++ C  EA    VAVD++G 
Sbjct: 74  PISVGDVVCCYGQCLNVGRSSIKIKVEVWV-KKVASEPIGERYCVTEAIFTFVAVDKEGR 132

Query: 146 PKSIRTE 152
           P+ +  E
Sbjct: 133 PRIVPRE 139


>gi|254473646|ref|ZP_05087042.1| acyl-CoA thioester hydrolase YciA [Pseudovibrio sp. JE062]
 gi|211957358|gb|EEA92562.1| acyl-CoA thioester hydrolase YciA [Pseudovibrio sp. JE062]
          Length = 142

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 72/122 (59%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LT +   MP D N  G++FGGW++SQ+DIA GI ASQ    RVVT A+  + F +P++
Sbjct: 15  GELTTRTMAMPADTNASGDIFGGWVVSQMDIAAGIAASQCAMERVVTVAIDSMTFIRPVK 74

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V D++ +Y+++ ++G+TS+T+  + W           +K   A    VAVD+ G P  I 
Sbjct: 75  VGDVMCVYSRVLRVGRTSITLAIEAWALRHRFG--YREKVTNAQFTFVAVDDNGKPIEIS 132

Query: 151 TE 152
            E
Sbjct: 133 EE 134


>gi|294670851|ref|ZP_06735707.1| hypothetical protein NEIELOOT_02555 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307338|gb|EFE48581.1| hypothetical protein NEIELOOT_02555 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 133

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 73/122 (59%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DIA GI A +    R  T A  +++F +P+ 
Sbjct: 11  GRLLLRTMAMPADTNPNGDIFGGWLMSQMDIAGGILAYETAYGRAATVAADKIVFHRPVS 70

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK---TCEATVVMVAVDEKGNPK 147
           V D+V  Y ++ KIG TS+ I+ +VW    +AS D L +     EA    VA+D+ G P+
Sbjct: 71  VGDVVACYGELIKIGNTSMQIHIEVWV--HSASFDSLNEQRLVTEALFTYVAIDKDGQPR 128

Query: 148 SI 149
            +
Sbjct: 129 PV 130


>gi|220920083|ref|YP_002495384.1| thioesterase superfamily protein [Methylobacterium nodulans ORS
           2060]
 gi|219944689|gb|ACL55081.1| thioesterase superfamily protein [Methylobacterium nodulans ORS
           2060]
          Length = 139

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 77/119 (64%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LT++   MP D N +G++FGGW+MSQ+D A GI   +  + RVVT AV  + F +P++
Sbjct: 14  GDLTVRTIAMPADTNANGDIFGGWVMSQMDQAGGIAGVERAQGRVVTVAVEGMSFIRPVR 73

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V D++ +YT++ ++G+TS+ I  + W   R   + + +K  +A+   VA+D++G P+ +
Sbjct: 74  VGDVLCVYTRVVQVGRTSMRIEIEAWA--RRFRTQLREKVTQASFTFVAIDDEGRPRPV 130


>gi|113866494|ref|YP_724983.1| Acyl-CoA hydrolase [Ralstonia eutropha H16]
 gi|113525270|emb|CAJ91615.1| Acyl-CoA hydrolase [Ralstonia eutropha H16]
          Length = 112

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 66/108 (61%), Gaps = 1/108 (0%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N+ G+VFGGWIM+Q+DIA  I A +  + RV T AV   LF+ P+ V DLV  Y 
Sbjct: 1   MPADANVHGDVFGGWIMAQVDIAGSIPAVERAQGRVATVAVNSFLFKHPVFVGDLVSFYA 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
            I K G+TS+T+  +V+   R   S+ + K  EAT+  VA DE   P+
Sbjct: 61  DIVKTGRTSITVSVEVY-AQRMRHSNEIVKVTEATLTYVATDESRQPR 107


>gi|75677173|ref|YP_319594.1| thioesterase superfamily protein [Nitrobacter winogradskyi Nb-255]
 gi|74422043|gb|ABA06242.1| thioesterase superfamily [Nitrobacter winogradskyi Nb-255]
          Length = 149

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L ++   MP D N +G++FGGW++SQ+DI  G+ AS+L K R VT A+  + F KP+ 
Sbjct: 24  GELCIRTLAMPADTNQNGDIFGGWLLSQMDIGGGVFASKLAKSRTVTVAIEAMNFRKPVY 83

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V DLV ++  + ++G+TS+ ++ + W   R     +L    +     VA+D+ G P+ I
Sbjct: 84  VGDLVSVHATLIRVGRTSIAVHLEAWVMRRKEKQFIL--VTDGKFTYVAIDDNGRPREI 140


>gi|60594417|pdb|1YLI|A Chain A, Crystal Structure Of Hi0827, A Hexameric Broad Specificity
           Acyl-Coenzyme A Thioesterase
 gi|60594418|pdb|1YLI|B Chain B, Crystal Structure Of Hi0827, A Hexameric Broad Specificity
           Acyl-Coenzyme A Thioesterase
          Length = 153

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/127 (41%), Positives = 76/127 (59%), Gaps = 3/127 (2%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            S GVL L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F K
Sbjct: 11  QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIK 70

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           PI V D+V  Y Q  K+G++S+ I  +VW   + AS  + ++ C  +A    VAVD  G 
Sbjct: 71  PISVGDVVCCYGQCLKVGRSSIKIKVEVWV-KKVASEPIGERYCVTDAVFTFVAVDNNGR 129

Query: 146 PKSIRTE 152
            ++I  E
Sbjct: 130 SRTIPRE 136


>gi|16272768|ref|NP_438987.1| hypothetical protein HI0827 [Haemophilus influenzae Rd KW20]
 gi|145632186|ref|ZP_01787921.1| hypothetical protein CGSHi3655_07024 [Haemophilus influenzae 3655]
 gi|145634761|ref|ZP_01790469.1| Trp operon repressor [Haemophilus influenzae PittAA]
 gi|145640932|ref|ZP_01796514.1| hypothetical protein CGSHiR3021_07682 [Haemophilus influenzae
           R3021]
 gi|229844695|ref|ZP_04464834.1| hypothetical protein CGSHi6P18H1_03774 [Haemophilus influenzae
           6P18H1]
 gi|260579919|ref|ZP_05847749.1| Trp operon repressor [Haemophilus influenzae RdAW]
 gi|1175670|sp|P44886|Y827_HAEIN RecName: Full=Uncharacterized acyl-CoA thioester hydrolase HI_0827
 gi|1573841|gb|AAC22485.1| conserved hypothetical [Haemophilus influenzae Rd KW20]
 gi|144987093|gb|EDJ93623.1| hypothetical protein CGSHi3655_07024 [Haemophilus influenzae 3655]
 gi|145267927|gb|EDK07923.1| Trp operon repressor [Haemophilus influenzae PittAA]
 gi|145274446|gb|EDK14310.1| hypothetical protein CGSHiR3021_07682 [Haemophilus influenzae
           22.4-21]
 gi|229812409|gb|EEP48099.1| hypothetical protein CGSHi6P18H1_03774 [Haemophilus influenzae
           6P18H1]
 gi|260093203|gb|EEW77136.1| Trp operon repressor [Haemophilus influenzae RdAW]
          Length = 154

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/127 (41%), Positives = 76/127 (59%), Gaps = 3/127 (2%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            S GVL L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F K
Sbjct: 12  QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIK 71

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           PI V D+V  Y Q  K+G++S+ I  +VW   + AS  + ++ C  +A    VAVD  G 
Sbjct: 72  PISVGDVVCCYGQCLKVGRSSIKIKVEVWV-KKVASEPIGERYCVTDAVFTFVAVDNNGR 130

Query: 146 PKSIRTE 152
            ++I  E
Sbjct: 131 SRTIPRE 137


>gi|148826528|ref|YP_001291281.1| Trp operon repressor [Haemophilus influenzae PittEE]
 gi|229845878|ref|ZP_04465990.1| Trp operon repressor [Haemophilus influenzae 7P49H1]
 gi|148716688|gb|ABQ98898.1| Trp operon repressor [Haemophilus influenzae PittEE]
 gi|229810882|gb|EEP46599.1| Trp operon repressor [Haemophilus influenzae 7P49H1]
 gi|309973681|gb|ADO96882.1| Acyl-CoA thioesterase YciA [Haemophilus influenzae R2846]
          Length = 154

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/127 (41%), Positives = 76/127 (59%), Gaps = 3/127 (2%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            S GVL L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F K
Sbjct: 12  QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIK 71

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           PI V D+V  Y Q  K+G++S+ I  +VW   + AS  + ++ C  +A    VAVD  G 
Sbjct: 72  PISVGDVVCCYGQCLKVGRSSIKIKVEVWV-KKVASEPIGERYCVTDAVFTFVAVDNNGR 130

Query: 146 PKSIRTE 152
            ++I  E
Sbjct: 131 SRTIPRE 137


>gi|170750216|ref|YP_001756476.1| thioesterase superfamily protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656738|gb|ACB25793.1| thioesterase superfamily protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 151

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 74/119 (62%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LT++   MP D N +G++FGGW++SQ+D A GI      + RVVT A+  + F +P++
Sbjct: 23  GDLTVRTIAMPADTNANGDIFGGWVLSQMDQAGGIAGVDRAQGRVVTVALESMTFIRPVR 82

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V D++ +YT++  +G+TS+ I  + W   R   + V ++  +AT   VA+DE G P+ I
Sbjct: 83  VGDVLCVYTRVSHVGRTSMKIEVEAWA--RRFCTQVRERVTQATFTFVAIDEDGRPRPI 139


>gi|84388555|ref|ZP_00991102.1| Acyl-CoA hydrolase [Vibrio splendidus 12B01]
 gi|84377104|gb|EAP93975.1| Acyl-CoA hydrolase [Vibrio splendidus 12B01]
          Length = 132

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 74/121 (61%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP+D N  G +FGGWIMSQ+D+A GI A ++   ++VT +V+ + F++P+ 
Sbjct: 11  GSLLLRTLAMPSDTNAAGQIFGGWIMSQLDLAGGILAKEISNGKIVTVSVSGIEFKQPVS 70

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V +Y    KIG++S+ I  +VW  P   +   D   K C AT   VAVDE G P+ 
Sbjct: 71  VGDVVCVYGDCTKIGRSSMNIDLEVWVKPVLDHGIGD-RYKVCGATFNYVAVDESGKPRP 129

Query: 149 I 149
           I
Sbjct: 130 I 130


>gi|221065059|ref|ZP_03541164.1| thioesterase superfamily protein [Comamonas testosteroni KF-1]
 gi|57116467|gb|AAW33709.1| Ctb1 [Comamonas testosteroni]
 gi|220710082|gb|EED65450.1| thioesterase superfamily protein [Comamonas testosteroni KF-1]
          Length = 170

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 74/117 (63%), Gaps = 1/117 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L LK+  MP DVN +G++FGGW+M+Q+D+A  +   ++   R+VT AV E +F++P++V 
Sbjct: 34  LVLKVVPMPADVNANGDIFGGWVMAQVDLAGSVLPQRISHTRMVTVAVNEFIFKQPVRVG 93

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           D++  Y  ++ +G+TSV +  +V+   R +      K  EA +  VA+D  G P+S+
Sbjct: 94  DILSFYAGVQHVGRTSVAVDVEVF-AERFSDQGKYVKVTEARLTYVAIDATGKPQSL 149


>gi|326318780|ref|YP_004236452.1| thioesterase superfamily protein [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323375616|gb|ADX47885.1| thioesterase superfamily protein [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 154

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 75/117 (64%), Gaps = 1/117 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L LK+  MP D N +G++FGGW+M+Q+D+A  +  ++  + R+ T AV E +F++P++V 
Sbjct: 17  LVLKVIPMPADCNANGDIFGGWVMAQVDLAGSVLPARHVQGRMATVAVNEFVFKQPVRVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           D++  ++ I +IG+TSVT+  +V+   R A+     K  EA +  VA+D  G P+ +
Sbjct: 77  DILSFFSSITRIGRTSVTVEVEVY-AERFAAQGRYVKVTEARLTYVAIDASGKPRPV 132


>gi|109896714|ref|YP_659969.1| thioesterase superfamily protein [Pseudoalteromonas atlantica T6c]
 gi|109698995|gb|ABG38915.1| thioesterase superfamily [Pseudoalteromonas atlantica T6c]
          Length = 142

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 74/122 (60%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LT +   MP D N  G++FGGW++SQ+DIA GI A Q  + RVVT +V  + F +P+ 
Sbjct: 12  GKLTTRTLAMPADTNAAGDIFGGWVLSQMDIAAGICAGQRAQGRVVTVSVESMSFIRPVH 71

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V D++ +YT++ K+G+TS+ I  + W   R     + +K  +     VA+D+KG P  + 
Sbjct: 72  VGDILGLYTRVVKLGRTSMVINVEAWV--RRDRIGLREKVTQGQFKFVAIDDKGVPMPLP 129

Query: 151 TE 152
           +E
Sbjct: 130 SE 131


>gi|262377384|ref|ZP_06070607.1| acyl-CoA hydrolase [Acinetobacter lwoffii SH145]
 gi|262307614|gb|EEY88754.1| acyl-CoA hydrolase [Acinetobacter lwoffii SH145]
          Length = 141

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/128 (37%), Positives = 75/128 (58%), Gaps = 2/128 (1%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
            Q+   G+L+L+   MP D N  G+VFGGWI+SQ+D+A  I A +  K R  T ++ ++ 
Sbjct: 4   SQVRPEGILSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHAERFSKGRCATISINQMT 63

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           F  P++V D++  YT+I K+GKTS+ +  +VW    ++   +  +  E     VAVD KG
Sbjct: 64  FLVPVKVGDVISCYTKILKVGKTSIQMEIEVWDSHDDSRPPI--RVTEGVFTFVAVDVKG 121

Query: 145 NPKSIRTE 152
           N + I  E
Sbjct: 122 NKRLIPEE 129


>gi|259418648|ref|ZP_05742565.1| acyl-CoA thioester hydrolase YciA [Silicibacter sp. TrichCH4B]
 gi|259344870|gb|EEW56724.1| acyl-CoA thioester hydrolase YciA [Silicibacter sp. TrichCH4B]
          Length = 131

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 71/116 (61%), Gaps = 2/116 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           T+++  MPTD N  G++FGGW+MSQ+D+A G  A+++ K R  T +V E+ F +P+ V D
Sbjct: 13  TIRVIAMPTDTNPAGDIFGGWLMSQMDLAAGTVAARVSKGRASTVSVEEIQFHRPVLVGD 72

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +Y ++ KIG+TS+ I    W   R+   +  Q+  EA    VA+D+   P+ +
Sbjct: 73  EVSLYAEMLKIGRTSMRIRVRAWRRARH--QEETQQVTEAIFTFVALDDHARPRPV 126


>gi|192360761|ref|YP_001980721.1| acyl-CoA hydrolase [Cellvibrio japonicus Ueda107]
 gi|190686926|gb|ACE84604.1| acyl-CoA hydrolase [Cellvibrio japonicus Ueda107]
          Length = 131

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 76/121 (62%), Gaps = 2/121 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G LTL+  +MP D N  G++FGGW+M+Q+DIA  I A+++ K RV T AV  + F +P+
Sbjct: 9   TGTLTLQTISMPADTNPFGDIFGGWVMAQMDIAGAIHANEVAKGRVTTVAVGSMSFIRPV 68

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V  ++  YT  R+IG TS+ ++ +VW   ++  +  +    E   + VA+DE+G+ + +
Sbjct: 69  PVGAIISCYTSTRRIGNTSIRVWVEVWI--KDFLTQKISLVTEGEYIYVALDEQGHKRPV 126

Query: 150 R 150
           R
Sbjct: 127 R 127


>gi|264680328|ref|YP_003280238.1| thioesterase superfamily [Comamonas testosteroni CNB-2]
 gi|299532706|ref|ZP_07046094.1| thioesterase superfamily protein [Comamonas testosteroni S44]
 gi|262210844|gb|ACY34942.1| thioesterase superfamily [Comamonas testosteroni CNB-2]
 gi|298719341|gb|EFI60310.1| thioesterase superfamily protein [Comamonas testosteroni S44]
          Length = 155

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 74/117 (63%), Gaps = 1/117 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L LK+  MP DVN +G++FGGW+M+Q+D+A  +   ++   R+VT AV E +F++P++V 
Sbjct: 19  LVLKVVPMPADVNANGDIFGGWVMAQVDLAGSVLPQRISHTRMVTVAVNEFIFKQPVRVG 78

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           D++  Y  ++ +G+TSV +  +V+   R +      K  EA +  VA+D  G P+S+
Sbjct: 79  DILSFYAGVQHVGRTSVAVDVEVF-AERFSDQGKYVKVTEARLTYVAIDATGKPQSL 134


>gi|145299718|ref|YP_001142559.1| acyl-CoA thioester hydrolase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142852490|gb|ABO90811.1| acyl-CoA thioester hydrolase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 138

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 81/135 (60%), Gaps = 4/135 (2%)

Query: 18  KKEVLMV-CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVV 76
           ++ V+MV  + H  G L L+   MP D N +G++FGGWIMSQ+DI  GI A +L K R+ 
Sbjct: 3   ERAVMMVDTKRHPDGELLLRTLAMPADTNPNGDIFGGWIMSQMDIGGGIMAKELAKGRIC 62

Query: 77  TKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EAT 134
           T +V  + F  P++V D+V  Y +  KIG++S+ +  +VW  P   +++  Q+ C  E  
Sbjct: 63  TVSVEGMTFHSPVKVGDVVCCYGRCLKIGRSSMRLKLEVWVKPVLRANEA-QRYCVTEGI 121

Query: 135 VVMVAVDEKGNPKSI 149
              VA+DE+G  + +
Sbjct: 122 FTYVAIDEQGKSRPV 136


>gi|319775241|ref|YP_004137729.1| hydrolase [Haemophilus influenzae F3047]
 gi|317449832|emb|CBY86040.1| predicted hydrolase [Haemophilus influenzae F3047]
          Length = 154

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/127 (40%), Positives = 76/127 (59%), Gaps = 3/127 (2%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            S GVL L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F K
Sbjct: 12  QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIK 71

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           PI V D+V  Y +  K+G++S+ I  +VW   + AS  + ++ C  +A    VAVD  G 
Sbjct: 72  PISVGDVVCCYGECLKVGRSSIKIKVEVWV-KKVASEPIGERYCVTDAVFTFVAVDNNGR 130

Query: 146 PKSIRTE 152
            ++I  E
Sbjct: 131 SRTIPRE 137


>gi|315633861|ref|ZP_07889150.1| acyl-CoA thioester hydrolase YciA [Aggregatibacter segnis ATCC
           33393]
 gi|315477111|gb|EFU67854.1| acyl-CoA thioester hydrolase YciA [Aggregatibacter segnis ATCC
           33393]
          Length = 153

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 76/126 (60%), Gaps = 3/126 (2%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
           S G L L+   MP++ N +G++FGGWIMSQ+DI   I A ++   RVVT AV  + F +P
Sbjct: 14  SHGTLLLRTLAMPSNTNANGDIFGGWIMSQMDIGGAILAKEIAHGRVVTVAVESMNFIQP 73

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGNP 146
           + V D+V  Y Q   +G++S+ I  +VW   + AS  + ++ C  EA    VAVD +G P
Sbjct: 74  VSVGDVVCCYGQCLHVGRSSIKIKVEVWV-KKVASEPIGERYCVTEAQFTFVAVDPQGKP 132

Query: 147 KSIRTE 152
           ++I  E
Sbjct: 133 RAIPRE 138


>gi|307728465|ref|YP_003905689.1| thioesterase superfamily protein [Burkholderia sp. CCGE1003]
 gi|307583000|gb|ADN56398.1| thioesterase superfamily protein [Burkholderia sp. CCGE1003]
          Length = 131

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            L++   P D N+ G+VFGGWIM+Q+DIA  I AS+    RV T AV   LF++P+ V D
Sbjct: 13  ALRVMPQPADANIHGDVFGGWIMAQVDIAGSIPASRRANGRVATIAVNSFLFKQPVFVGD 72

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           L+  Y  I K G TS+T+  +V+    + + D++ K  EAT+  VA D    P+++
Sbjct: 73  LLSFYADIVKTGNTSITVSVEVYAQRMSLAQDIV-KVTEATLTYVATDSDRRPRAL 127


>gi|120612717|ref|YP_972395.1| thioesterase superfamily protein [Acidovorax citrulli AAC00-1]
 gi|120591181|gb|ABM34621.1| thioesterase superfamily protein [Acidovorax citrulli AAC00-1]
          Length = 150

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 75/117 (64%), Gaps = 1/117 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L LK+  MP D N +G++FGGW+M+Q+D+A  +  ++  + R+ T AV E +F++P++V 
Sbjct: 17  LVLKVIPMPADCNANGDIFGGWVMAQVDLAGSVLPARHVQGRMATVAVNEFVFKQPVRVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           D++  ++ I +IG+TSVT+  +V+   R A+     K  EA +  VA+D  G P+ +
Sbjct: 77  DILSFFSTITRIGRTSVTVEVEVY-AERFAAQGRYVKVTEARLTYVAIDASGKPRPV 132


>gi|27904750|ref|NP_777876.1| putative acyl-CoA thioester hydrolase YciA [Buchnera aphidicola
           str. Bp (Baizongia pistaciae)]
 gi|32363302|sp|Q89AL4|Y254_BUCBP RecName: Full=Uncharacterized acyl-CoA thioester hydrolase bbp_254
 gi|27904147|gb|AAO26981.1| putative acyl-CoA thioester hydrolase YciA [Buchnera aphidicola
           str. Bp (Baizongia pistaciae)]
          Length = 135

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 73/122 (59%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + L+   MP D N +G++FGGWIMSQ+DI   I A ++ + RVVT +V  + F K + 
Sbjct: 10  GKMVLRTLAMPADTNANGDIFGGWIMSQMDIGGAILAKEIARGRVVTVSVNGMTFLKSVS 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK---TCEATVVMVAVDEKGNPK 147
           V D+V  Y    + G TS+TI  +VW   +  SS+ L K   T EA  V VAVDE G PK
Sbjct: 70  VGDVVSCYAHCIRTGNTSITIKIEVWI--KKVSSEPLGKFYCTTEAIFVYVAVDEFGQPK 127

Query: 148 SI 149
           ++
Sbjct: 128 TL 129


>gi|170691418|ref|ZP_02882583.1| thioesterase superfamily protein [Burkholderia graminis C4D1M]
 gi|170143623|gb|EDT11786.1| thioesterase superfamily protein [Burkholderia graminis C4D1M]
          Length = 131

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            L++   P D N+ G+VFGGWIM+Q+DIA  I AS+    RV T AV   LF++P+ V D
Sbjct: 13  ALRVMPQPADANIHGDVFGGWIMAQVDIAGSIPASRRANGRVATIAVNSFLFKQPVFVGD 72

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           L+  Y  I K G TS+T+  +V+    + + D++ K  EAT+  VA D    P+++
Sbjct: 73  LLSFYADIVKTGNTSITVSVEVYAQRMSLAEDIV-KVTEATLTYVATDSDRRPRAL 127


>gi|99080699|ref|YP_612853.1| thioesterase superfamily protein [Ruegeria sp. TM1040]
 gi|99036979|gb|ABF63591.1| thioesterase superfamily [Ruegeria sp. TM1040]
          Length = 136

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 72/119 (60%), Gaps = 2/119 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           T+++  MPTD N  G++FGGW+MSQ+D+A G  A+++ K R  T +V E+ F +P+ V D
Sbjct: 19  TIRVIAMPTDTNPAGDIFGGWLMSQMDLAAGTIAARVSKGRASTVSVEEIQFHRPVLVGD 78

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
            V +Y ++ KIG+TS+ I    W   R+   +  Q+  EA    VA+D+   P+ +  E
Sbjct: 79  EVSLYAEMLKIGRTSMRIRVRAWRRARH--QEETQQVTEAIFTFVALDDHARPRPVLRE 135


>gi|323524752|ref|YP_004226905.1| thioesterase superfamily protein [Burkholderia sp. CCGE1001]
 gi|323381754|gb|ADX53845.1| thioesterase superfamily protein [Burkholderia sp. CCGE1001]
          Length = 131

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            L++   P D N+ G+VFGGWIM+Q+DIA  I AS+    RV T AV   LF++P+ V D
Sbjct: 13  ALRVMPQPADANIHGDVFGGWIMAQVDIAGSIPASRRANGRVATIAVNSFLFKQPVFVGD 72

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           L+  Y  I K G TS+T+  +V+    + + D++ K  EAT+  VA D    P+++
Sbjct: 73  LLSFYADIVKTGNTSITVSVEVYAQRMSLAQDIV-KVTEATLTYVATDSDRRPRAL 127


>gi|254491921|ref|ZP_05105100.1| thioesterase family protein [Methylophaga thiooxidans DMS010]
 gi|224463399|gb|EEF79669.1| thioesterase family protein [Methylophaga thiooxydans DMS010]
          Length = 128

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 70/115 (60%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L+I   P DVN+ G++FGGW+MSQ DIA GI AS+    RVVT AV +  F  P+ VSD+
Sbjct: 11  LRIMARPNDVNVAGDIFGGWLMSQCDIAGGIIASRKAGGRVVTVAVKDFQFLAPVLVSDI 70

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V IY    +IG TSVTI  +V++  R A  + + K   A +V V +D+   P  I
Sbjct: 71  VSIYAHDVQIGTTSVTIGIEVFSERRQAGQEQIIKVATALIVYVHIDDHRQPTPI 125


>gi|262374177|ref|ZP_06067453.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262310735|gb|EEY91823.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 140

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 71/125 (56%), Gaps = 2/125 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
           H  G L+L+   MP D N  G+VFGGWI+SQ+D+A  I   +  K R  T A+ ++ F  
Sbjct: 7   HPEGTLSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHVERFSKGRCATIAINQMAFLV 66

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           P++V +++  YT+I K+G TSV +  +VW    ++   V  +  E     VAVD KGN +
Sbjct: 67  PVKVGNVISCYTKILKVGNTSVQVQIEVWNSHDDSREPV--RITEGVFTFVAVDVKGNKR 124

Query: 148 SIRTE 152
            I  E
Sbjct: 125 QISEE 129


>gi|68249422|ref|YP_248534.1| putative acyl-CoA thioester hydrolase [Haemophilus influenzae
           86-028NP]
 gi|145630576|ref|ZP_01786356.1| putative acyl-CoA thioester hydrolase [Haemophilus influenzae
           R3021]
 gi|145636613|ref|ZP_01792280.1| Trp operon repressor [Haemophilus influenzae PittHH]
 gi|145638371|ref|ZP_01793981.1| Trp operon repressor [Haemophilus influenzae PittII]
 gi|260581644|ref|ZP_05849441.1| acyl-CoA hydrolase [Haemophilus influenzae NT127]
 gi|329122834|ref|ZP_08251406.1| thioesterase [Haemophilus aegyptius ATCC 11116]
 gi|68057621|gb|AAX87874.1| putative acyl-CoA thioester hydrolase [Haemophilus influenzae
           86-028NP]
 gi|144983966|gb|EDJ91408.1| putative acyl-CoA thioester hydrolase [Haemophilus influenzae
           R3021]
 gi|145270139|gb|EDK10075.1| Trp operon repressor [Haemophilus influenzae PittHH]
 gi|145272700|gb|EDK12607.1| Trp operon repressor [Haemophilus influenzae PittII]
 gi|260095237|gb|EEW79128.1| acyl-CoA hydrolase [Haemophilus influenzae NT127]
 gi|301169546|emb|CBW29147.1| predicted hydrolase [Haemophilus influenzae 10810]
 gi|309751511|gb|ADO81495.1| Acyl-CoA thioesterase YciA [Haemophilus influenzae R2866]
 gi|327472098|gb|EGF17536.1| thioesterase [Haemophilus aegyptius ATCC 11116]
          Length = 154

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/127 (40%), Positives = 76/127 (59%), Gaps = 3/127 (2%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            S GVL L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F K
Sbjct: 12  QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIK 71

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           PI V D+V  Y +  K+G++S+ I  +VW   + AS  + ++ C  +A    VAVD  G 
Sbjct: 72  PISVGDVVCCYGECLKVGRSSIKIKVEVWV-KKVASEPIGERYCVTDAVFTFVAVDNNGR 130

Query: 146 PKSIRTE 152
            ++I  E
Sbjct: 131 SRTIPRE 137


>gi|84687308|ref|ZP_01015188.1| thioesterase family protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84664741|gb|EAQ11225.1| thioesterase family protein [Rhodobacterales bacterium HTCC2654]
          Length = 147

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 77/133 (57%), Gaps = 3/133 (2%)

Query: 17  TKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVV 76
           ++KE+ M  ++   G   L+   MP DVN  G++FGGW++SQ+DIA GI A +    RV 
Sbjct: 15  SQKEIAM-SEIMPEGHAVLRTVAMPADVNSAGDIFGGWVLSQMDIAGGIIAGERASGRVA 73

Query: 77  TKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVV 136
           T AV  + F +P+++ D++ IY ++ ++G TSV +  D W       ++  +K  E    
Sbjct: 74  TVAVEAMKFIRPVKIGDILCIYGEVARVGTTSVAVRLDAWVVRGQGKTN--EKVTEGIFT 131

Query: 137 MVAVDEKGNPKSI 149
            VA+D +GN + I
Sbjct: 132 FVALDHEGNKRPI 144


>gi|332289904|ref|YP_004420756.1| acyl-CoA thioester hydrolase [Gallibacterium anatis UMN179]
 gi|330432800|gb|AEC17859.1| acyl-CoA thioester hydrolase [Gallibacterium anatis UMN179]
          Length = 151

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 73/126 (57%), Gaps = 5/126 (3%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           SG L L+   MP+D N +G++FGGWIMSQ+DI   I A+++   RVVT  V  + F KP+
Sbjct: 9   SGTLLLRTLAMPSDTNANGDIFGGWIMSQMDIGGAILANEIAHRRVVTVHVNNITFHKPV 68

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK---TCEATVVMVAVDEKGNP 146
            V D+V  Y +  ++G TS+ I  +VW   ++A  D + +     EA    VA+DE G P
Sbjct: 69  SVGDIVCCYGRCTRVGNTSLQIEVEVWV--KHAFRDFVSERDLVTEAVFTYVAIDENGKP 126

Query: 147 KSIRTE 152
             I  E
Sbjct: 127 YPIPKE 132


>gi|330445580|ref|ZP_08309232.1| acyl-CoA thioesterase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489771|dbj|GAA03729.1| acyl-CoA thioesterase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 132

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 75/120 (62%), Gaps = 1/120 (0%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A  I A ++   RVVT +V ++ F+ P+ 
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGAILAKEISGGRVVTVSVDKIEFKAPVS 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASS-DVLQKTCEATVVMVAVDEKGNPKSI 149
           V D+V  Y + ++IG TS+++  +VW  P +  +     + CEAT   VA++ +G P+ I
Sbjct: 70  VGDVVCCYGECKRIGNTSMSVALEVWVKPVDVEAVGDRYRVCEATFNYVAINSEGRPRPI 129


>gi|85715303|ref|ZP_01046286.1| thioesterase superfamily protein [Nitrobacter sp. Nb-311A]
 gi|85697949|gb|EAQ35823.1| thioesterase superfamily protein [Nitrobacter sp. Nb-311A]
          Length = 148

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L  +   MP D N +G++FGGW++SQ+DI  G+ AS+L K R VT A+  + F KP+ 
Sbjct: 23  GELCTRTLAMPADTNQNGDIFGGWLLSQMDIGGGVFASKLAKSRTVTVAIDAMNFRKPVF 82

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V DLV ++  + +IG+TS+T++ + W   R     +L    +     V++D+ G P+ I
Sbjct: 83  VGDLVSVHATLVRIGRTSITVHLEAWVMRRKEKLFIL--VTDGKFTYVSIDDNGRPREI 139


>gi|262380846|ref|ZP_06073997.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|262297481|gb|EEY85399.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 140

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 74/126 (58%), Gaps = 2/126 (1%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           +   GVL+L+   MP D N  G+VFGGWI+SQ+D+A  I A +  K R  T ++ ++ F 
Sbjct: 6   LKPEGVLSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHAERFSKGRCATISINQMTFL 65

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            P++V D++  YT+I K+G TS+ +  +VW    + SS   ++  E     VAVD KGN 
Sbjct: 66  VPVKVGDVISCYTKILKVGNTSIQMQIEVWDS--HDSSRPAKRVTEGVFTFVAVDVKGNK 123

Query: 147 KSIRTE 152
           + I  E
Sbjct: 124 RIIPEE 129


>gi|255319382|ref|ZP_05360598.1| acyl-CoA thioester hydrolase YciA [Acinetobacter radioresistens
           SK82]
 gi|255303518|gb|EET82719.1| acyl-CoA thioester hydrolase YciA [Acinetobacter radioresistens
           SK82]
          Length = 140

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 74/126 (58%), Gaps = 2/126 (1%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           +   GVL+L+   MP D N  G+VFGGWI+SQ+D+A  I A +  K R  T ++ ++ F 
Sbjct: 6   LKPEGVLSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHAERFSKGRCATISINQMTFL 65

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            P++V D++  YT+I K+G TS+ +  +VW    + SS   ++  E     VAVD KGN 
Sbjct: 66  VPVKVGDVISCYTKILKVGNTSIQMQIEVWDS--HDSSRPAKRVTEGVFTFVAVDVKGNK 123

Query: 147 KSIRTE 152
           + I  E
Sbjct: 124 RIIPEE 129


>gi|239813831|ref|YP_002942741.1| thioesterase superfamily protein [Variovorax paradoxus S110]
 gi|239800408|gb|ACS17475.1| thioesterase superfamily protein [Variovorax paradoxus S110]
          Length = 141

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 76/120 (63%), Gaps = 1/120 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L LK+  MP D N +G++FGGW+M+Q D+A  +  ++  K R  T AV E +F++P+++ 
Sbjct: 22  LVLKVIPMPADCNANGDIFGGWVMAQCDLAGSVIPARYAKGRQATVAVNEFIFKQPVRLG 81

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           D++  Y+++ +IG+TSVT+  +V+     A  + + K  +AT   VA+D+ G P+ I  +
Sbjct: 82  DILSFYSKLVRIGRTSVTVTVEVFAERFRAQGEYI-KVTQATFTYVAIDDNGRPRPIEQQ 140


>gi|90408653|ref|ZP_01216805.1| acyl-CoA hydrolase [Psychromonas sp. CNPT3]
 gi|90310229|gb|EAS38362.1| acyl-CoA hydrolase [Psychromonas sp. CNPT3]
          Length = 139

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/125 (40%), Positives = 75/125 (60%), Gaps = 1/125 (0%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q   +G + L+   MP D N +G++FGGWIMSQ+D+A  I A ++   RVVT +V+ + F
Sbjct: 8   QKSPTGEVLLRTLAMPADTNANGDIFGGWIMSQLDLAGAILAKEISIGRVVTVSVSSITF 67

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASS-DVLQKTCEATVVMVAVDEKG 144
           +KP+ V D+V  Y    +IG+TS++I+ +VW    N  S     K CEA    VA+D  G
Sbjct: 68  KKPVNVGDVVCCYGICDRIGRTSMSIHLEVWVKKINHDSVSEPMKVCEAIFNYVAIDSTG 127

Query: 145 NPKSI 149
            P+ I
Sbjct: 128 TPRVI 132


>gi|91226942|ref|ZP_01261539.1| putative acyl-CoA hydrolase [Vibrio alginolyticus 12G01]
 gi|269967032|ref|ZP_06181100.1| Putative acyl-CoA thioester hydrolase yciA [Vibrio alginolyticus
           40B]
 gi|91188905|gb|EAS75190.1| putative acyl-CoA hydrolase [Vibrio alginolyticus 12G01]
 gi|269828291|gb|EEZ82557.1| Putative acyl-CoA thioester hydrolase yciA [Vibrio alginolyticus
           40B]
          Length = 131

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 78/122 (63%), Gaps = 3/122 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + L+   MP D N +G++FGGWIMSQ+D+A  I A ++   RVVT +V+ + F+KP+ 
Sbjct: 10  GQMLLRTLAMPADTNANGDIFGGWIMSQLDLAGAILAKEISCGRVVTVSVSSITFKKPVG 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK--TCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  KIG+TS+++  +VW  P  A   V ++   C+AT   VA+D +G P+ 
Sbjct: 70  VGDVVCCYGECTKIGRTSMSVDLEVWVKPVKAHG-VGERFMVCDATFNYVAIDSEGKPRP 128

Query: 149 IR 150
           ++
Sbjct: 129 VQ 130


>gi|258541655|ref|YP_003187088.1| acyl-CoA thioester hydrolase cytosolic long-chain [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632733|dbj|BAH98708.1| acyl-CoA thioester hydrolase cytosolic long-chain [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256635790|dbj|BAI01759.1| acyl-CoA thioester hydrolase cytosolic long-chain [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256638845|dbj|BAI04807.1| acyl-CoA thioester hydrolase cytosolic long-chain [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256641899|dbj|BAI07854.1| acyl-CoA thioester hydrolase cytosolic long-chain [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256644954|dbj|BAI10902.1| acyl-CoA thioester hydrolase cytosolic long-chain [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648009|dbj|BAI13950.1| acyl-CoA thioester hydrolase cytosolic long-chain [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651062|dbj|BAI16996.1| acyl-CoA thioester hydrolase cytosolic long-chain [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654053|dbj|BAI19980.1| acyl-CoA thioester hydrolase cytosolic long-chain [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 146

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 71/118 (60%), Gaps = 2/118 (1%)

Query: 32  VLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
           + T+++  MPTD N  G+VFGGWI+SQ+D+A G  A+     R  T A+  L+F +P+ V
Sbjct: 13  IPTIRVVAMPTDTNPAGDVFGGWIVSQMDLAAGTTAAFRANGRCATIAINSLVFMEPVMV 72

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            D V IYT+I + G+TS+TI+ + W   R   + +  K  E   + VA+DE   P+ +
Sbjct: 73  GDEVSIYTRIIRAGRTSLTIHVETWR--RARHTHLTSKVTEGEFIFVALDENRRPRQL 128


>gi|89074045|ref|ZP_01160546.1| putative acyl-CoA hydrolase [Photobacterium sp. SKA34]
 gi|90581211|ref|ZP_01237009.1| putative acyl-CoA hydrolase [Vibrio angustum S14]
 gi|89050183|gb|EAR55694.1| putative acyl-CoA hydrolase [Photobacterium sp. SKA34]
 gi|90437582|gb|EAS62775.1| putative acyl-CoA hydrolase [Vibrio angustum S14]
          Length = 133

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 76/121 (62%), Gaps = 1/121 (0%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A  I A ++   RVVT +V ++ F+ P+ 
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGAILAKEISGGRVVTVSVDKIEFKAPVG 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASS-DVLQKTCEATVVMVAVDEKGNPKSI 149
           V D+V  Y + ++IG TS+++  +VW  P +  +     + CEAT   VA++ +G P+ I
Sbjct: 70  VGDVVCCYGECKRIGNTSMSVGLEVWVKPVDVEAVGDRYRVCEATFNYVAINSEGRPRPI 129

Query: 150 R 150
           +
Sbjct: 130 Q 130


>gi|91781817|ref|YP_557023.1| thioesterase domain-containing protein [Burkholderia xenovorans
           LB400]
 gi|91685771|gb|ABE28971.1| Putative thioesterase domain protein [Burkholderia xenovorans
           LB400]
          Length = 131

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/131 (39%), Positives = 78/131 (59%), Gaps = 5/131 (3%)

Query: 21  VLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAV 80
           +L + Q H +    L++   P+D N+ G+VFGGWIM+Q+DIA  I AS+    RV T AV
Sbjct: 4   LLQLPQKHCA----LRVVPQPSDANVHGDVFGGWIMAQVDIAGSIPASRRANGRVATIAV 59

Query: 81  TELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAV 140
              +F++P+ V DL+  Y  I K G TSVT+  +V+   R + ++ L K  EAT+  VA 
Sbjct: 60  NSFVFKQPVFVGDLLSFYADIVKTGNTSVTVEVEVY-AQRMSLTEDLVKVTEATLTYVAT 118

Query: 141 DEKGNPKSIRT 151
           D    P+++ T
Sbjct: 119 DSDRRPRALPT 129


>gi|326387770|ref|ZP_08209376.1| acyl-CoA hydrolase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207816|gb|EGD58627.1| acyl-CoA hydrolase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 144

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 67/119 (56%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G   ++I  MP D N  G++FGGW+M+Q+D+A GI A++ C  R  T AV  + F  P+ 
Sbjct: 13  GEPAIRITAMPADANPSGDIFGGWLMAQMDMAAGIIAARHCHGRAATIAVEGMKFHHPVH 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           + D V +Y  +  +G+TS+ I  + W   R  + D  ++  +A    VA+DE   P+ +
Sbjct: 73  IGDEVSVYAGLASVGRTSMVINVEAWR--RARTGDERERVTQARFFFVAIDEDRRPRHV 129


>gi|332304840|ref|YP_004432691.1| thioesterase superfamily protein [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172169|gb|AEE21423.1| thioesterase superfamily protein [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 138

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 71/122 (58%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LT +   MP D N  G++FGGW++SQ+DIA GI A Q  + RVVT +V  + F +P+ 
Sbjct: 8   GKLTTRTLAMPADTNAAGDIFGGWVLSQMDIAAGICAGQRAQGRVVTVSVDSMSFIRPVH 67

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V D++ +YT + ++G+TS+ I  + W   R     + +K  +     VA+DE G P  + 
Sbjct: 68  VGDILGLYTSVAELGRTSMVINVEAWV--RRDRIGLREKVTQGRFKFVAIDENGVPSQLP 125

Query: 151 TE 152
            E
Sbjct: 126 PE 127


>gi|56476720|ref|YP_158309.1| acyl-CoA thioesterase [Aromatoleum aromaticum EbN1]
 gi|56312763|emb|CAI07408.1| Acyl-CoA thioesterase [Aromatoleum aromaticum EbN1]
          Length = 136

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 68/116 (58%), Gaps = 1/116 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            L++  MP D+N  G+VFGGWIMS +DIA GI A    + R  T AV    F++P+ V D
Sbjct: 18  ALRVMPMPGDLNPAGDVFGGWIMSMVDIAGGIAAHYRARGRCATVAVNAFTFKQPVSVGD 77

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           LV  Y  +  +G+TS+T+   V+   RN  S  + K  EA +  VA+D+ GN + +
Sbjct: 78  LVSFYADVVSVGRTSITVDVQVF-AERNPESLFVVKVTEAKLTYVALDDHGNKRPV 132


>gi|254502056|ref|ZP_05114207.1| thioesterase family protein [Labrenzia alexandrii DFL-11]
 gi|222438127|gb|EEE44806.1| thioesterase family protein [Labrenzia alexandrii DFL-11]
          Length = 118

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 68/111 (61%), Gaps = 2/111 (1%)

Query: 39  TMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIY 98
            MP D N  G++FGGW++SQ+D+A GI A Q  + RVVT AV ++ F +P+ V D++ +Y
Sbjct: 2   AMPADTNASGDIFGGWVLSQMDLAGGIAAGQRAQGRVVTIAVDKMKFIRPVHVGDVLCVY 61

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           T + ++G +S+ I  + W           +K  EA   MVAVD++G P+ +
Sbjct: 62  TSVGRVGTSSMEIKLEAWALRHRFGG--REKVTEAIFTMVAVDDQGKPRPV 110


>gi|167718158|ref|ZP_02401394.1| thioesterase domain protein [Burkholderia pseudomallei DM98]
 gi|167737188|ref|ZP_02409962.1| thioesterase domain protein [Burkholderia pseudomallei 14]
 gi|167822797|ref|ZP_02454268.1| thioesterase domain protein [Burkholderia pseudomallei 9]
 gi|167844371|ref|ZP_02469879.1| thioesterase domain protein [Burkholderia pseudomallei B7210]
 gi|167892884|ref|ZP_02480286.1| thioesterase domain protein [Burkholderia pseudomallei 7894]
 gi|167901370|ref|ZP_02488575.1| thioesterase domain protein [Burkholderia pseudomallei NCTC 13177]
 gi|167909600|ref|ZP_02496691.1| thioesterase domain protein [Burkholderia pseudomallei 112]
 gi|167917615|ref|ZP_02504706.1| thioesterase domain protein [Burkholderia pseudomallei BCC215]
 gi|254187690|ref|ZP_04894202.1| thioesterase family protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254203724|ref|ZP_04910084.1| thioesterase family protein [Burkholderia mallei FMH]
 gi|254208699|ref|ZP_04915047.1| thioesterase family protein [Burkholderia mallei JHU]
 gi|254296198|ref|ZP_04963655.1| thioesterase family protein [Burkholderia pseudomallei 406e]
 gi|254360247|ref|ZP_04976517.1| thioesterase family protein [Burkholderia mallei 2002721280]
 gi|147745236|gb|EDK52316.1| thioesterase family protein [Burkholderia mallei FMH]
 gi|147750575|gb|EDK57644.1| thioesterase family protein [Burkholderia mallei JHU]
 gi|148029487|gb|EDK87392.1| thioesterase family protein [Burkholderia mallei 2002721280]
 gi|157806179|gb|EDO83349.1| thioesterase family protein [Burkholderia pseudomallei 406e]
 gi|157935370|gb|EDO91040.1| thioesterase family protein [Burkholderia pseudomallei Pasteur
           52237]
          Length = 137

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 71/115 (61%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P+D N+ G+VFGGWIM+Q+DIA  I AS+    RV T AV   LF++P+ V DL
Sbjct: 20  LRVVPQPSDANVHGDVFGGWIMAQVDIAGSIPASRRANGRVATVAVNSFLFKQPVFVGDL 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I K G TSVT+  +V+    +  S+++ K  EAT+  VA D    P+++
Sbjct: 80  LSFYASIVKTGNTSVTVDVEVYAQRMSLMSEIV-KVTEATLTYVATDSDRRPRAL 133


>gi|187922677|ref|YP_001894319.1| thioesterase superfamily protein [Burkholderia phytofirmans PsJN]
 gi|187713871|gb|ACD15095.1| thioesterase superfamily protein [Burkholderia phytofirmans PsJN]
          Length = 131

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 78/130 (60%), Gaps = 5/130 (3%)

Query: 20  EVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKA 79
           ++L + Q H +    L++   P+D N+ G+VFGGWIM+Q+DIA  I AS+    RV T A
Sbjct: 3   DMLQLPQKHCA----LRVVPQPSDANVHGDVFGGWIMAQVDIAGSIPASRRANGRVATIA 58

Query: 80  VTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVA 139
           V   +F++P+ V DL+  Y  I K G TSVT+  +V+   R + ++ L K  EAT+  VA
Sbjct: 59  VNSFVFKQPVFVGDLLSFYADIVKTGNTSVTVAVEVY-AQRMSLTEDLVKVTEATLTYVA 117

Query: 140 VDEKGNPKSI 149
            D    P+++
Sbjct: 118 TDSDRRPRAL 127


>gi|149189550|ref|ZP_01867834.1| hypothetical protein VSAK1_00972 [Vibrio shilonii AK1]
 gi|148836707|gb|EDL53660.1| hypothetical protein VSAK1_00972 [Vibrio shilonii AK1]
          Length = 133

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 74/121 (61%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G   ++   MP + N +G++FGGWIMSQ+D+A GI A ++   R+VT +V+ + F+ P++
Sbjct: 11  GQPIIRTLAMPENTNANGDIFGGWIMSQLDLAGGILAKEISHGRIVTVSVSGITFKHPVK 70

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRN--ASSDVLQKTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  KIG TS+TI  +VW  P +     D  Q  CEAT   VA+D  G P+ 
Sbjct: 71  VGDVVCCYGECTKIGNTSMTINLEVWVKPVSLEGVGDRYQ-VCEATFHYVAIDANGRPRP 129

Query: 149 I 149
           I
Sbjct: 130 I 130


>gi|295675481|ref|YP_003604005.1| thioesterase superfamily protein [Burkholderia sp. CCGE1002]
 gi|295435324|gb|ADG14494.1| thioesterase superfamily protein [Burkholderia sp. CCGE1002]
          Length = 131

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            L++   P+D N+ G+VFGGWIM+Q+DIA  I AS+    RV T AV   LF++P+ V D
Sbjct: 13  ALRVMPQPSDANIHGDVFGGWIMAQVDIAGSIPASRRANGRVATIAVNSFLFKQPVFVGD 72

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           L+  Y  I K G TSVT+  +V+    + S +V+ K  EA +  VA D    P+++
Sbjct: 73  LLSFYADIVKTGNTSVTVSVEVYAQRMSLSQEVV-KVTEAILTYVATDSDRRPRAL 127


>gi|15602193|ref|NP_245265.1| hypothetical protein PM0328 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720565|gb|AAK02412.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 147

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 77/126 (61%), Gaps = 3/126 (2%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
           + G L L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F +P
Sbjct: 13  TRGTLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTIAVDSMTFIRP 72

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGNP 146
           I V D+V  Y +   +G++S+ I  +VW   + AS  + ++ C  EA    VAVD++G P
Sbjct: 73  IAVGDVVCCYGKCLSVGRSSIKIKVEVWV-KKVASEPIGERYCVTEAVFTFVAVDKEGRP 131

Query: 147 KSIRTE 152
           +++  E
Sbjct: 132 RAVPRE 137


>gi|53725010|ref|YP_102038.1| thioesterase domain-containing protein [Burkholderia mallei ATCC
           23344]
 gi|67641447|ref|ZP_00440225.1| thioesterase family protein [Burkholderia mallei GB8 horse 4]
 gi|76810673|ref|YP_332279.1| thioesterase superfamily protein [Burkholderia pseudomallei 1710b]
 gi|121599454|ref|YP_994038.1| thioesterase family protein [Burkholderia mallei SAVP1]
 gi|124386094|ref|YP_001028298.1| thioesterase domain-containing protein [Burkholderia mallei NCTC
           10229]
 gi|126439292|ref|YP_001057738.1| thioesterase family protein [Burkholderia pseudomallei 668]
 gi|126449406|ref|YP_001081942.1| thioesterase family protein [Burkholderia mallei NCTC 10247]
 gi|126454934|ref|YP_001064983.1| thioesterase family protein [Burkholderia pseudomallei 1106a]
 gi|134279821|ref|ZP_01766533.1| thioesterase family protein [Burkholderia pseudomallei 305]
 gi|217420117|ref|ZP_03451623.1| thioesterase family protein [Burkholderia pseudomallei 576]
 gi|226196666|ref|ZP_03792246.1| thioesterase family protein [Burkholderia pseudomallei Pakistan 9]
 gi|237810888|ref|YP_002895339.1| thioesterase family protein [Burkholderia pseudomallei MSHR346]
 gi|242315875|ref|ZP_04814891.1| thioesterase family protein [Burkholderia pseudomallei 1106b]
 gi|251767817|ref|ZP_02268503.2| thioesterase family protein [Burkholderia mallei PRL-20]
 gi|254176724|ref|ZP_04883381.1| thioesterase family protein [Burkholderia mallei ATCC 10399]
 gi|254181762|ref|ZP_04888359.1| thioesterase family protein [Burkholderia pseudomallei 1655]
 gi|254196724|ref|ZP_04903148.1| thioesterase family protein [Burkholderia pseudomallei S13]
 gi|254260061|ref|ZP_04951115.1| thioesterase family protein [Burkholderia pseudomallei 1710a]
 gi|52428433|gb|AAU49026.1| thioesterase domain protein [Burkholderia mallei ATCC 23344]
 gi|76580126|gb|ABA49601.1| thioesterase superfamily protein [Burkholderia pseudomallei 1710b]
 gi|121228264|gb|ABM50782.1| thioesterase family protein [Burkholderia mallei SAVP1]
 gi|124294114|gb|ABN03383.1| thioesterase domain protein [Burkholderia mallei NCTC 10229]
 gi|126218785|gb|ABN82291.1| thioesterase family protein [Burkholderia pseudomallei 668]
 gi|126228576|gb|ABN92116.1| thioesterase family protein [Burkholderia pseudomallei 1106a]
 gi|126242276|gb|ABO05369.1| thioesterase family protein [Burkholderia mallei NCTC 10247]
 gi|134249021|gb|EBA49103.1| thioesterase family protein [Burkholderia pseudomallei 305]
 gi|160697765|gb|EDP87735.1| thioesterase family protein [Burkholderia mallei ATCC 10399]
 gi|169653467|gb|EDS86160.1| thioesterase family protein [Burkholderia pseudomallei S13]
 gi|184212300|gb|EDU09343.1| thioesterase family protein [Burkholderia pseudomallei 1655]
 gi|217397421|gb|EEC37437.1| thioesterase family protein [Burkholderia pseudomallei 576]
 gi|225931197|gb|EEH27204.1| thioesterase family protein [Burkholderia pseudomallei Pakistan 9]
 gi|237503367|gb|ACQ95685.1| thioesterase family protein [Burkholderia pseudomallei MSHR346]
 gi|238522386|gb|EEP85830.1| thioesterase family protein [Burkholderia mallei GB8 horse 4]
 gi|242139114|gb|EES25516.1| thioesterase family protein [Burkholderia pseudomallei 1106b]
 gi|243061652|gb|EES43838.1| thioesterase family protein [Burkholderia mallei PRL-20]
 gi|254218750|gb|EET08134.1| thioesterase family protein [Burkholderia pseudomallei 1710a]
          Length = 132

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 71/115 (61%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P+D N+ G+VFGGWIM+Q+DIA  I AS+    RV T AV   LF++P+ V DL
Sbjct: 15  LRVVPQPSDANVHGDVFGGWIMAQVDIAGSIPASRRANGRVATVAVNSFLFKQPVFVGDL 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I K G TSVT+  +V+    +  S+++ K  EAT+  VA D    P+++
Sbjct: 75  LSFYASIVKTGNTSVTVDVEVYAQRMSLMSEIV-KVTEATLTYVATDSDRRPRAL 128


>gi|209519029|ref|ZP_03267837.1| thioesterase superfamily protein [Burkholderia sp. H160]
 gi|209500541|gb|EEA00589.1| thioesterase superfamily protein [Burkholderia sp. H160]
          Length = 131

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            L++   P+D N+ G+VFGGWIM+Q+DIA  I AS+    RV T AV   LF++P+ V D
Sbjct: 13  ALRVMPQPSDANIHGDVFGGWIMAQVDIAGSIPASRRANGRVATIAVNSFLFKQPVFVGD 72

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           L+  Y  I K G TSVT+  +V+    + S +V+ K  EA +  VA D    P+++
Sbjct: 73  LLSFYADIVKTGNTSVTVSVEVYAQRLSVSQEVV-KVTEAILTYVATDSDRRPRAL 127


>gi|167579877|ref|ZP_02372751.1| thioesterase domain protein [Burkholderia thailandensis TXDOH]
 gi|167617953|ref|ZP_02386584.1| thioesterase domain protein [Burkholderia thailandensis Bt4]
 gi|167835483|ref|ZP_02462366.1| thioesterase domain protein [Burkholderia thailandensis MSMB43]
          Length = 137

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 71/115 (61%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P+D N+ G+VFGGWIM+Q+DIA  I AS+    RV T AV   LF++P+ V DL
Sbjct: 20  LRVVPQPSDANVHGDVFGGWIMAQVDIAGSIPASRRANGRVATVAVNSFLFKQPVFVGDL 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I K G TSVT+  +V+    +  S+++ K  EAT+  VA D    P+++
Sbjct: 80  LSFYASIVKTGNTSVTVDVEVYAQRMSLMSEIV-KVTEATLTYVATDADRRPRAL 133


>gi|152997241|ref|YP_001342076.1| thioesterase superfamily protein [Marinomonas sp. MWYL1]
 gi|150838165|gb|ABR72141.1| thioesterase superfamily protein [Marinomonas sp. MWYL1]
          Length = 143

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 72/124 (58%), Gaps = 2/124 (1%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
           + G LT +   MP D N  G++FGGW++SQ+DIA GI A Q  + RVVT A+  + F +P
Sbjct: 8   AKGRLTTRTVAMPGDTNPAGDIFGGWVVSQMDIAAGICAGQRAQSRVVTVALDGMSFIRP 67

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           ++V D++ +YT++  +G+TS+ I  + W   R       +K  E     V++DE G  K 
Sbjct: 68  VKVGDILGVYTRVESVGRTSMNILVEAWV--RRGRIGKREKVTEGMFKFVSIDETGASKP 125

Query: 149 IRTE 152
           I  E
Sbjct: 126 IPKE 129


>gi|52843029|ref|YP_096828.1| acyl-CoA thioester hydrolase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54295657|ref|YP_128072.1| hypothetical protein lpl2745 [Legionella pneumophila str. Lens]
 gi|54298823|ref|YP_125192.1| hypothetical protein lpp2890 [Legionella pneumophila str. Paris]
 gi|148361143|ref|YP_001252350.1| acyl-CoA thioester hydrolase [Legionella pneumophila str. Corby]
 gi|296108477|ref|YP_003620178.1| acyl-CoA thioesterase YciA [Legionella pneumophila 2300/99 Alcoy]
 gi|52630140|gb|AAU28881.1| acyl-CoA thioester hydrolase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53752608|emb|CAH14043.1| hypothetical protein lpp2890 [Legionella pneumophila str. Paris]
 gi|53755489|emb|CAH16988.1| hypothetical protein lpl2745 [Legionella pneumophila str. Lens]
 gi|148282916|gb|ABQ57004.1| acyl-CoA thioester hydrolase [Legionella pneumophila str. Corby]
 gi|295650379|gb|ADG26226.1| acyl-CoA thioesterase YciA [Legionella pneumophila 2300/99 Alcoy]
 gi|307611705|emb|CBX01400.1| hypothetical protein LPW_30931 [Legionella pneumophila 130b]
          Length = 126

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 74/121 (61%), Gaps = 6/121 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LT++   MP + N +G++FGGWI+SQ+D+A G+ A ++   RV T A+  + F KP+ 
Sbjct: 6   GELTIQTLAMPLNTNANGDIFGGWIVSQMDLAAGVLAKRISHGRVATVAINSMTFLKPVH 65

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK--TCEATVVMVAVDEKGNPKS 148
           V D+V  + ++ K+G TS+TI  +VW      SS  ++K    E   V VA+DE G P+ 
Sbjct: 66  VGDVVSCHVELVKVGNTSMTIRVEVWAY----SSIKMEKYQVTEGIFVFVAIDENGKPRQ 121

Query: 149 I 149
           +
Sbjct: 122 V 122


>gi|329115232|ref|ZP_08243987.1| Putative acyl-CoA thioester hydrolase [Acetobacter pomorum DM001]
 gi|326695675|gb|EGE47361.1| Putative acyl-CoA thioester hydrolase [Acetobacter pomorum DM001]
          Length = 146

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 71/118 (60%), Gaps = 2/118 (1%)

Query: 32  VLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
           + T+++  MPTD N  G+VFGGWI+SQ+D+A G  A+     R  T A+  L+F +P+ V
Sbjct: 13  IPTIRVVAMPTDTNPAGDVFGGWIVSQMDLAAGTTAAFRANGRCATIAINSLVFMEPVVV 72

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            D V IYT+I + G+TS+TI+ + W   R   + +  K  E   + VA+DE   P+ +
Sbjct: 73  GDEVSIYTRIIRAGRTSLTIHVETWR--RARHTHLTSKVTEGEFIFVALDENRRPRPL 128


>gi|257140210|ref|ZP_05588472.1| thioesterase domain-containing protein [Burkholderia thailandensis
           E264]
          Length = 132

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 71/115 (61%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P+D N+ G+VFGGWIM+Q+DIA  I AS+    RV T AV   LF++P+ V DL
Sbjct: 15  LRVVPQPSDANVHGDVFGGWIMAQVDIAGSIPASRRANGRVATVAVNSFLFKQPVFVGDL 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I K G TSVT+  +V+    +  S+++ K  EAT+  VA D    P+++
Sbjct: 75  LSFYASIVKTGNTSVTVDVEVYAQRMSLMSEIV-KVTEATLTYVATDADRRPRAL 128


>gi|117618600|ref|YP_856099.1| acyl-CoA thioester hydrolase YciA [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560007|gb|ABK36955.1| acyl-CoA thioester hydrolase YciA [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 160

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 15  IITKKEVLMV-CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKC 73
           I  ++ V MV  + H  G L L+   MP D N +G++FGGWIMSQ+DI  GI A +L K 
Sbjct: 22  IHIERAVQMVDTRRHPDGELLLRTLAMPADTNPNGDIFGGWIMSQMDIGGGIMAKELAKG 81

Query: 74  RVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC-- 131
           R+ T +V  + F  P++V D+V  Y +  KIG++S+ +  +VW  P    ++  Q+ C  
Sbjct: 82  RICTVSVEGMTFHSPVKVGDVVCCYGRCLKIGRSSMRLKLEVWVKPVLRENEA-QRYCVT 140

Query: 132 EATVVMVAVDEKGNPKSI 149
           E     VA+DE+G  + +
Sbjct: 141 EGIFTYVAIDEQGKSRPV 158


>gi|254496033|ref|ZP_05108935.1| acyl-CoA thioester hydrolase [Legionella drancourtii LLAP12]
 gi|254354744|gb|EET13377.1| acyl-CoA thioester hydrolase [Legionella drancourtii LLAP12]
          Length = 127

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LT++   MP + N +G++FGGWI+S +D+A G+ A ++   RV T A+  + F KP+ 
Sbjct: 7   GELTIQTLAMPANTNANGDIFGGWIVSHMDLAAGVLAKKVALGRVATVAIHSMAFLKPVH 66

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V DL+  Y  + K G TS+T+  +VW  P    SD  Q T E   + VA+D+ G P+ +
Sbjct: 67  VGDLISCYVTLIKQGNTSMTMSVEVWALPAT-QSDPYQVT-EGVFIFVAIDDDGRPRQV 123


>gi|319791535|ref|YP_004153175.1| thioesterase [Variovorax paradoxus EPS]
 gi|315593998|gb|ADU35064.1| thioesterase superfamily protein [Variovorax paradoxus EPS]
          Length = 141

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 75/117 (64%), Gaps = 1/117 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L LK+  MP D N +G++FGGW+M+Q D+A  +  ++  K R  T AV E +F++P+++ 
Sbjct: 22  LVLKVIPMPADCNANGDIFGGWVMAQCDLAGSVIPARYAKGRQATVAVNEFIFKQPVRLG 81

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           D++  Y+++ +IG+TSVT+  +V+     A  + + K  +AT   VA+D+ G P+ I
Sbjct: 82  DILSFYSKLVRIGRTSVTVTVEVFAERFRAQGEYI-KVTQATFTYVAIDDNGRPRVI 137


>gi|301155689|emb|CBW15157.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 156

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/127 (40%), Positives = 74/127 (58%), Gaps = 3/127 (2%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            S GVL L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F K
Sbjct: 12  QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIK 71

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           PI V D+V  Y Q   +G++S+ I  +VW   + AS  + ++ C  EA    VAV + G 
Sbjct: 72  PIAVGDVVCCYGQCLSVGRSSIKIKVEVWV-KKVASEPIGERYCVTEAVFTFVAVGKDGK 130

Query: 146 PKSIRTE 152
            + I  E
Sbjct: 131 ARGIPRE 137


>gi|238028602|ref|YP_002912833.1| thioesterase family protein [Burkholderia glumae BGR1]
 gi|237877796|gb|ACR30129.1| Thioesterase family protein [Burkholderia glumae BGR1]
          Length = 132

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/115 (42%), Positives = 69/115 (60%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P++ N+ G+VFGGWIMSQ+DIA  I AS+    RV T AV   LF++P+ V DL
Sbjct: 15  LRVVPQPSEANVHGDVFGGWIMSQVDIAGSIPASRRANGRVATIAVNSFLFKQPVFVGDL 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V  Y  I K G TSVT+  +V+      +  V+ K  EAT+  VA D    P+++
Sbjct: 75  VSFYANIVKTGNTSVTVGVEVYAQRMGLTGQVV-KVTEATLTYVATDSDRRPRAL 128


>gi|50086142|ref|YP_047652.1| hypothetical protein ACIAD3139 [Acinetobacter sp. ADP1]
 gi|49532118|emb|CAG69830.1| putative acyl-CoA thioester hydrolase [Acinetobacter sp. ADP1]
          Length = 139

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 75/128 (58%), Gaps = 2/128 (1%)

Query: 22  LMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVT 81
           ++   +   G L+L+   MP D N  G+VFGGWI+SQ+D+A  I A +  K R  T ++ 
Sbjct: 1   MLDAHISPEGTLSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHAERFSKGRCATISIN 60

Query: 82  ELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVD 141
           ++ F  P++V D++  YT+I K+G TS+ +  +VW    + SS   ++  E     VAVD
Sbjct: 61  QMTFLVPVKVGDVISCYTKILKVGNTSIQMQIEVWDS--HDSSRPPKRVTEGVFTFVAVD 118

Query: 142 EKGNPKSI 149
            KGN ++I
Sbjct: 119 VKGNKRTI 126


>gi|53718297|ref|YP_107283.1| thioesterase superfamily protein [Burkholderia pseudomallei K96243]
 gi|167814320|ref|ZP_02446000.1| thioesterase domain protein [Burkholderia pseudomallei 91]
 gi|52208711|emb|CAH34647.1| thioesterase superfamily protein [Burkholderia pseudomallei K96243]
          Length = 137

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 71/115 (61%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P+D N+ G+VFGGWIM+Q+D+A  I AS+    RV T AV   LF++P+ V DL
Sbjct: 20  LRVVPQPSDANVHGDVFGGWIMAQVDVAGSIPASRRANGRVATVAVNSFLFKQPVFVGDL 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I K G TSVT+  +V+    +  S+++ K  EAT+  VA D    P+++
Sbjct: 80  LSFYASIVKTGNTSVTVDVEVYAQRMSLMSEIV-KVTEATLTYVATDSDRRPRAL 133


>gi|168988889|pdb|3BJK|A Chain A, Crystal Structure Of Hi0827, A Hexameric Broad Specificity
           Acyl-Coenzyme A Thioesterase: The Asp44ala Mutant Enzyme
 gi|168988890|pdb|3BJK|B Chain B, Crystal Structure Of Hi0827, A Hexameric Broad Specificity
           Acyl-Coenzyme A Thioesterase: The Asp44ala Mutant Enzyme
 gi|168988891|pdb|3BJK|C Chain C, Crystal Structure Of Hi0827, A Hexameric Broad Specificity
           Acyl-Coenzyme A Thioesterase: The Asp44ala Mutant Enzyme
 gi|168988892|pdb|3BJK|D Chain D, Crystal Structure Of Hi0827, A Hexameric Broad Specificity
           Acyl-Coenzyme A Thioesterase: The Asp44ala Mutant Enzyme
 gi|168988893|pdb|3BJK|E Chain E, Crystal Structure Of Hi0827, A Hexameric Broad Specificity
           Acyl-Coenzyme A Thioesterase: The Asp44ala Mutant Enzyme
 gi|168988894|pdb|3BJK|F Chain F, Crystal Structure Of Hi0827, A Hexameric Broad Specificity
           Acyl-Coenzyme A Thioesterase: The Asp44ala Mutant Enzyme
          Length = 153

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/127 (40%), Positives = 75/127 (59%), Gaps = 3/127 (2%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            S GVL L+   MP+D N +G++FGGWIMSQ+ +   I A ++   RVVT AV  + F K
Sbjct: 11  QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIK 70

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           PI V D+V  Y Q  K+G++S+ I  +VW   + AS  + ++ C  +A    VAVD  G 
Sbjct: 71  PISVGDVVCCYGQCLKVGRSSIKIKVEVWV-KKVASEPIGERYCVTDAVFTFVAVDNNGR 129

Query: 146 PKSIRTE 152
            ++I  E
Sbjct: 130 SRTIPRE 136


>gi|187927456|ref|YP_001897943.1| thioesterase superfamily protein [Ralstonia pickettii 12J]
 gi|309779842|ref|ZP_07674597.1| thioesterase family protein [Ralstonia sp. 5_7_47FAA]
 gi|187724346|gb|ACD25511.1| thioesterase superfamily protein [Ralstonia pickettii 12J]
 gi|308921419|gb|EFP67061.1| thioesterase family protein [Ralstonia sp. 5_7_47FAA]
          Length = 145

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 68/114 (59%), Gaps = 1/114 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           +++  MP+D N+ G+VFGGWIMSQ+DIA  I A      RV T AV   +F++P+ V DL
Sbjct: 27  VRVMPMPSDANVHGDVFGGWIMSQVDIAGSIPAVVRANGRVATIAVNSFVFKQPVYVGDL 86

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASS-DVLQKTCEATVVMVAVDEKGNPK 147
           V  Y  + K G+TS+T+  +V+    +AS      K  EAT+  VA DE   P+
Sbjct: 87  VSFYANVVKTGRTSITVDVEVYAQRMHASGRHATVKVTEATLTYVATDETRKPR 140


>gi|296161006|ref|ZP_06843817.1| thioesterase superfamily protein [Burkholderia sp. Ch1-1]
 gi|295888705|gb|EFG68512.1| thioesterase superfamily protein [Burkholderia sp. Ch1-1]
          Length = 131

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 71/115 (61%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P+D N+ G+VFGGWIM+Q+DIA  I AS+    RV T AV   +F++P+ V DL
Sbjct: 14  LRVVPQPSDANVHGDVFGGWIMAQVDIAGSIPASRRANGRVATIAVNSFVFKQPVFVGDL 73

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I K G TSVT+  +V+   R + ++ L K  EAT+  VA D    P+++
Sbjct: 74  LSFYADIVKTGNTSVTVEVEVY-AQRMSLTEDLVKVTEATLTYVATDSDRRPRAL 127


>gi|146338961|ref|YP_001204009.1| Acyl-CoA thioester hydrolase [Bradyrhizobium sp. ORS278]
 gi|146191767|emb|CAL75772.1| Acyl-CoA thioester hydrolase [Bradyrhizobium sp. ORS278]
          Length = 139

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 72/122 (59%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L ++   MP D N +G++FGGW++SQ+D+  G+ A+++ K R VT A+  + F K + 
Sbjct: 15  GDLCIRTLAMPADTNANGDIFGGWLLSQMDVGGGVFAAKVAKSRTVTVAIEAMNFRKAVY 74

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V DLV +Y  + +IG+TS+T+  + W   R     +L    +     V++D+ G P+ I+
Sbjct: 75  VGDLVSVYAHLVRIGRTSMTVRLEAWVVRRREEQPIL--VTDGNFTYVSIDDDGRPQPIK 132

Query: 151 TE 152
            +
Sbjct: 133 RD 134


>gi|331006948|ref|ZP_08330193.1| thioesterase superfamily [gamma proteobacterium IMCC1989]
 gi|330419268|gb|EGG93689.1| thioesterase superfamily [gamma proteobacterium IMCC1989]
          Length = 140

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 70/115 (60%), Gaps = 2/115 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LT +   MP+D N  G++FGGW++SQ+DIA GI A Q  + RVVT AV  + F + ++
Sbjct: 8   GRLTTRTLAMPSDTNASGDIFGGWVLSQMDIAAGICAGQRAQGRVVTVAVESMSFIRAVK 67

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V D++ +YT I ++G+TS+ ++ + W   R     + +K  E     VA+DE G 
Sbjct: 68  VGDILGLYTHIAELGRTSMVVHVEAWV--RRDRIGLREKVTEGKFKFVALDENGQ 120


>gi|241765891|ref|ZP_04763823.1| thioesterase superfamily protein [Acidovorax delafieldii 2AN]
 gi|241364166|gb|EER59366.1| thioesterase superfamily protein [Acidovorax delafieldii 2AN]
          Length = 131

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 74/122 (60%), Gaps = 1/122 (0%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
             + S   L LK+  MP D N +G++FGGW+M+Q+D+A  +  ++  + R+ T AV E +
Sbjct: 10  AALPSDKELVLKVIPMPADTNGNGDIFGGWVMAQVDLAGSVLPARYIQGRMATVAVNEFI 69

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           F++P++V D++  +  I ++G TSVT+  +V+   R +      K  EA +  VA+D++G
Sbjct: 70  FKQPVRVGDILSFFASITRVGNTSVTVQVEVF-AERFSDQGKYVKVTEARLTYVAIDDQG 128

Query: 145 NP 146
            P
Sbjct: 129 RP 130


>gi|148253718|ref|YP_001238303.1| acyl-CoA thioester hydrolase [Bradyrhizobium sp. BTAi1]
 gi|146405891|gb|ABQ34397.1| Acyl-CoA thioester hydrolase [Bradyrhizobium sp. BTAi1]
          Length = 143

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 72/122 (59%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L ++   MP D N +G++FGGW++SQ+D+  G+ A+++ K R VT A+  + F K + 
Sbjct: 18  GDLCIRTLAMPADTNANGDIFGGWLLSQMDVGGGVFAAKIAKSRTVTVAIEAMNFRKAVY 77

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V DLV +Y  + ++G+TS+T+  + W   R     +L    +     V++D+ G P+ ++
Sbjct: 78  VGDLVSVYAHLVRVGRTSLTVRLEAWVLRRREEQPIL--VTDGNFTYVSIDDDGRPQPVK 135

Query: 151 TE 152
            +
Sbjct: 136 RD 137


>gi|242239374|ref|YP_002987555.1| acyl-CoA thioester hydrolase [Dickeya dadantii Ech703]
 gi|242131431|gb|ACS85733.1| thioesterase superfamily protein [Dickeya dadantii Ech703]
          Length = 139

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 73/122 (59%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++ + RVVT  V E+ F KP+ 
Sbjct: 10  GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAEGRVVTVKVDEMTFLKPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEKGNPK 147
           V D+V  Y +  + G+TS+++  +VW   +  SSD +    +  EA    VA+DE G P+
Sbjct: 70  VGDVVCCYARCVRTGRTSMSVNVEVWV--KKVSSDPIGHRYRATEALFTYVAIDEDGKPR 127

Query: 148 SI 149
            +
Sbjct: 128 EL 129


>gi|291614317|ref|YP_003524474.1| thioesterase superfamily protein [Sideroxydans lithotrophicus ES-1]
 gi|291584429|gb|ADE12087.1| thioesterase superfamily protein [Sideroxydans lithotrophicus ES-1]
          Length = 132

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           TL++  MP+D N  G++FGGW+M Q+DIA  I A    K RV T AV   +F++PI V D
Sbjct: 14  TLRVAAMPSDANYTGDIFGGWLMGQVDIAGSIPAVHRAKGRVATIAVNSFVFKQPIFVGD 73

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +V  Y++I K G TS+T+  +V+   R+  +    K  EAT+  VAV +   P+ +
Sbjct: 74  VVSFYSRIVKTGTTSITVDVEVYVQ-RDPENPTCLKVTEATLTYVAVGDDRKPRPL 128


>gi|83719871|ref|YP_441128.1| thioesterase domain-containing protein [Burkholderia thailandensis
           E264]
 gi|83653696|gb|ABC37759.1| thioesterase domain protein [Burkholderia thailandensis E264]
          Length = 228

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 71/116 (61%), Gaps = 1/116 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            L++   P+D N+ G+VFGGWIM+Q+DIA  I AS+    RV T AV   LF++P+ V D
Sbjct: 110 ALRVVPQPSDANVHGDVFGGWIMAQVDIAGSIPASRRANGRVATVAVNSFLFKQPVFVGD 169

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           L+  Y  I K G TSVT+  +V+    +  S+++ K  EAT+  VA D    P+++
Sbjct: 170 LLSFYASIVKTGNTSVTVDVEVYAQRMSLMSEIV-KVTEATLTYVATDADRRPRAL 224


>gi|117926368|ref|YP_866985.1| thioesterase [Magnetococcus sp. MC-1]
 gi|117610124|gb|ABK45579.1| thioesterase superfamily protein [Magnetococcus sp. MC-1]
          Length = 129

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 71/117 (60%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT++   MP D N  G++FGGW+MSQ+D+A GI A Q  + RVVT AV  + F +P++V 
Sbjct: 9   LTIRTLAMPADTNPSGDIFGGWVMSQMDLAAGICAGQRARRRVVTVAVDAMSFIQPVRVG 68

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           D + +YTQ+  +G+TS+TI  + W         V  K  +A    VA+D++G P  I
Sbjct: 69  DDLCVYTQVVTVGRTSMTIQVEAWARRDRIGERV--KVTQAHFKFVALDDEGRPTPI 123


>gi|270158183|ref|ZP_06186840.1| thioesterase family protein [Legionella longbeachae D-4968]
 gi|289163557|ref|YP_003453695.1| hydrolase [Legionella longbeachae NSW150]
 gi|269990208|gb|EEZ96462.1| thioesterase family protein [Legionella longbeachae D-4968]
 gi|288856730|emb|CBJ10541.1| putative hydrolase [Legionella longbeachae NSW150]
          Length = 127

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L ++   MP + N +G++FGGWI+SQ+D+A GI A +L   RV T A+  + F KP+ 
Sbjct: 7   GDLAIQTLAMPANTNANGDIFGGWIVSQMDLAAGILAKRLALGRVATVAIHSMSFLKPVH 66

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V DLV  Y  + K G TS+TI  +VW  P  A      +  E   V VA+DEKG  + +
Sbjct: 67  VGDLVSCYVNLVKQGNTSMTICVEVWAHP--AIQREAYQVTEGVFVFVALDEKGKARQV 123


>gi|82701231|ref|YP_410797.1| thioesterase superfamily protein [Nitrosospira multiformis ATCC
           25196]
 gi|82409296|gb|ABB73405.1| Thioesterase superfamily [Nitrosospira multiformis ATCC 25196]
          Length = 139

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 70/115 (60%), Gaps = 2/115 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++  MPTD N  G+VFGGWIM+Q+DIA  + A +  + RVVT AV   +F++P+ V D+
Sbjct: 20  LRLVPMPTDTNYAGDVFGGWIMAQVDIAGSLPAIRRARGRVVTVAVNSFVFKQPVFVGDV 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWT--CPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           V  Y  I +IG+TS+T+   V+     R    ++  +  EA +  VAVDE   P+
Sbjct: 80  VSFYADIVRIGRTSITVDVVVYAQRGLRQGDKEICYRVTEAVLTYVAVDEHRKPR 134


>gi|300705166|ref|YP_003746769.1| acyl-CoA thioester hydrolase [Ralstonia solanacearum CFBP2957]
 gi|299072830|emb|CBJ44186.1| putative Acyl-CoA thioester hydrolase [Ralstonia solanacearum
           CFBP2957]
          Length = 139

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 70/117 (59%), Gaps = 3/117 (2%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           +++  MP D N+ G+VFGGWIM+Q+DIA  I A      RV T AV   +F++P+ V DL
Sbjct: 21  VRVMPMPADANVHGDVFGGWIMAQVDIAGSIPAVVRANGRVATVAVNSFVFKQPVYVGDL 80

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKSI 149
           V  Y  + K G+TS+T+  +V+   R  S+   +  K  EAT+  VA DE   P+++
Sbjct: 81  VSFYASVAKTGRTSITVDVEVYAQ-RMGSNGRHETVKVTEATLTYVATDESRKPRAL 136


>gi|284007486|emb|CBA72960.1| acyl-CoA thioester hydrolase [Arsenophonus nasoniae]
          Length = 155

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 74/132 (56%), Gaps = 3/132 (2%)

Query: 18  KKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVT 77
           + +  M  Q    G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT
Sbjct: 5   RSKFFMTQQQLPQGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIALGRVVT 64

Query: 78  KAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATV 135
            AV  + F+KP+ V D++  Y    K G TS+TI  +VW   + AS  V Q  +  EA  
Sbjct: 65  VAVNGITFQKPVSVGDVICCYAHCIKTGNTSITINIEVWV-KKVASEPVGQHYRATEAIF 123

Query: 136 VMVAVDEKGNPK 147
             VAV+E  +P+
Sbjct: 124 TYVAVNEDNSPR 135


>gi|320352183|ref|YP_004193522.1| thioesterase superfamily protein [Desulfobulbus propionicus DSM
           2032]
 gi|320120685|gb|ADW16231.1| thioesterase superfamily protein [Desulfobulbus propionicus DSM
           2032]
          Length = 145

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 74/130 (56%), Gaps = 3/130 (2%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q    G L L+   MP D + +G++FGGWIM+Q+D+A  + A ++ + R  T AV  + F
Sbjct: 7   QQGPQGELLLRTMPMPADTSFNGDIFGGWIMAQMDLAGSMMAKEVTRTRTATVAVESMKF 66

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCP-RNASSDVLQ--KTCEATVVMVAVDE 142
            KP++V D+V  Y ++ ++G TSVTI  +VW  P  +A  D     K  EA +  VA+ E
Sbjct: 67  IKPVRVGDVVCCYGRVLRVGTTSVTIMLEVWVRPILHAGKDQFTTFKVTEAAITYVAIGE 126

Query: 143 KGNPKSIRTE 152
            G  + I  E
Sbjct: 127 DGKKQPINRE 136


>gi|262276089|ref|ZP_06053898.1| acyl-CoA hydrolase [Grimontia hollisae CIP 101886]
 gi|262219897|gb|EEY71213.1| acyl-CoA hydrolase [Grimontia hollisae CIP 101886]
          Length = 114

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N +G++FGGWIMSQ+D+A  I A ++   RVVT +V E++F+ P+ V D+V  Y 
Sbjct: 1   MPADTNANGDIFGGWIMSQLDLAGAILAKEISHGRVVTVSVQEIVFKHPVSVGDVVCCYG 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASS-DVLQKTCEATVVMVAVDEKGNPKSI 149
           +   IG+TS+++  +VW  P          K CEA    VA+D  G P+ I
Sbjct: 61  ECTHIGRTSMSVSLEVWVKPVAIDGIGTRHKVCEAIFNYVAIDGNGRPRPI 111


>gi|270262130|ref|ZP_06190402.1| putative hydrolase [Serratia odorifera 4Rx13]
 gi|270044006|gb|EFA17098.1| putative hydrolase [Serratia odorifera 4Rx13]
          Length = 142

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 77/122 (63%), Gaps = 3/122 (2%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           SG + L+   MP D N +G++FGGW+MSQ+DI   I+A ++ + RVVT  V  + F KP+
Sbjct: 9   SGEMVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAEGRVVTVRVDGMTFLKPV 68

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPK 147
            V D+V  Y Q  + G++S+TI  +VW   + +S+ + Q  +  EA    VAVD++GN +
Sbjct: 69  AVGDVVCCYAQCIRTGRSSITINIEVW-VKKVSSAPIGQRYRATEAVFTYVAVDDEGNSR 127

Query: 148 SI 149
           ++
Sbjct: 128 AL 129


>gi|217969084|ref|YP_002354318.1| thioesterase superfamily protein [Thauera sp. MZ1T]
 gi|217506411|gb|ACK53422.1| thioesterase superfamily protein [Thauera sp. MZ1T]
          Length = 270

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 71/110 (64%), Gaps = 1/110 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L L++  MP D+N  G+VFGGWIMS +DIA  + A ++ + +V T AV   +F +P+ + 
Sbjct: 152 LVLRVVPMPADLNPSGDVFGGWIMSMVDIAGAVPAIRVARSKVATVAVDSFVFRQPVSMG 211

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           D+V  + ++ ++G+TS+T+  +V+   R+  + V+ K  EA +  VAVDE
Sbjct: 212 DIVSFHAEVVRVGRTSITVDVEVYAQ-RHPENPVVVKVTEARLTYVAVDE 260



 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            L++  MP D+N  G+VFGGW+M+ +DIA  + A +  +  VVT AV   +F +PI V D
Sbjct: 19  ALRLMPMPADLNSAGDVFGGWVMAMVDIAGALPAIRRARSHVVTMAVNSFVFRQPISVGD 78

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           +V  +  +  +GK+S+T+   V+   R+ +  V+ K  EA +  VAVD  G
Sbjct: 79  IVSFHADVVAVGKSSITVDVHVFAE-RHPADPVVVKVTEARMTYVAVDRAG 128


>gi|325579088|ref|ZP_08149044.1| acyl-CoA thioester hydrolase YciA [Haemophilus parainfluenzae ATCC
           33392]
 gi|325159323|gb|EGC71457.1| acyl-CoA thioester hydrolase YciA [Haemophilus parainfluenzae ATCC
           33392]
          Length = 154

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 82/143 (57%), Gaps = 8/143 (5%)

Query: 12  LINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLC 71
           +I+ +T KE        S G+L L+   MP+D N +G++FGGWIMSQ+D+   I A ++ 
Sbjct: 1   MISNLTDKE-----GRQSKGILLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIA 55

Query: 72  KCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC 131
             RVVT AV  + F KPI V D+V  Y Q   +G++S+ I  +VW   + AS  + ++ C
Sbjct: 56  HGRVVTVAVESMNFIKPIAVGDVVCCYGQCLSVGRSSIKIKVEVWV-KKVASEPIGERYC 114

Query: 132 --EATVVMVAVDEKGNPKSIRTE 152
             +A    VAV + G  ++I  E
Sbjct: 115 VTDAVFTFVAVGKDGKSRAIPRE 137


>gi|222824265|ref|YP_002575839.1| acyl-coA thioester hydrolase [Campylobacter lari RM2100]
 gi|222539487|gb|ACM64588.1| conserved hypothetical protein, putative acyl-coA thioester
           hydrolase [Campylobacter lari RM2100]
          Length = 134

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 71/120 (59%), Gaps = 1/120 (0%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M   G   L++  MP++ N  GN+FGGWIMSQID+A  I A +L   RVVT AV +++F+
Sbjct: 1   MKDMGEPKLRVIAMPSNTNPAGNIFGGWIMSQIDLAGAIAARELSPQRVVTVAVDKIIFK 60

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL-QKTCEATVVMVAVDEKGN 145
           +PI V DLV  Y +I K G TS+T+  +V T   N    V       A V  V+VD+ GN
Sbjct: 61  EPIFVGDLVSCYAKIIKAGNTSITVAVEVVTQRANEYGRVYCMHVTSAVVTYVSVDKDGN 120


>gi|206576509|ref|YP_002239024.1| acyl-CoA thioester hydrolase YciA [Klebsiella pneumoniae 342]
 gi|288935929|ref|YP_003439988.1| thioesterase superfamily protein [Klebsiella variicola At-22]
 gi|290512923|ref|ZP_06552287.1| acyl-CoA thioesterase YciA [Klebsiella sp. 1_1_55]
 gi|206565567|gb|ACI07343.1| acyl-CoA thioester hydrolase YciA [Klebsiella pneumoniae 342]
 gi|288890638|gb|ADC58956.1| thioesterase superfamily protein [Klebsiella variicola At-22]
 gi|289774536|gb|EFD82540.1| acyl-CoA thioesterase YciA [Klebsiella sp. 1_1_55]
          Length = 132

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/129 (38%), Positives = 75/129 (58%), Gaps = 5/129 (3%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           +   G + L+   MP D N +G++FGGW+MSQ+DI   I A ++ + RVVT  V  + F 
Sbjct: 6   LAPKGEMVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIMAKEIAQGRVVTVRVDGMTFL 65

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEK 143
           +P+ V D+V  Y +  K G TSVTI  +VW   +  SS+ +    K  EA  + VAVD +
Sbjct: 66  RPVAVGDVVCCYARCVKRGNTSVTINIEVWV--KKVSSEPIGQRYKATEALFIYVAVDNQ 123

Query: 144 GNPKSIRTE 152
           G P+++  E
Sbjct: 124 GKPRALPAE 132


>gi|52424791|ref|YP_087928.1| hypothetical protein MS0736 [Mannheimia succiniciproducens MBEL55E]
 gi|52306843|gb|AAU37343.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 154

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 76/127 (59%), Gaps = 4/127 (3%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
              G L L+   MP+D N +G++FGGWIMSQ+D+   I A ++ K RVVT  V ++ F +
Sbjct: 10  EPEGSLILRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIGKGRVVTVCVDKMTFLR 69

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           PI V D+V  Y ++ KIG++S+ +  +VW   +     V  + C  EA    VA+D++G 
Sbjct: 70  PISVGDVVCCYGKLVKIGRSSMQVKVEVWI--KKVYDGVRDRHCVTEALFTYVAIDKEGK 127

Query: 146 PKSIRTE 152
           P+++  E
Sbjct: 128 PRAVPRE 134


>gi|222055691|ref|YP_002538053.1| thioesterase [Geobacter sp. FRC-32]
 gi|221564980|gb|ACM20952.1| thioesterase superfamily protein [Geobacter sp. FRC-32]
          Length = 136

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/133 (42%), Positives = 76/133 (57%), Gaps = 17/133 (12%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
              G L L+   MP+D N +G+VFGGWIMSQ+DIA G+ A ++   R VT AV  + F K
Sbjct: 7   RPDGELLLRTSPMPSDTNANGDVFGGWIMSQMDIAGGMMAIEITCGRCVTIAVDAMKFIK 66

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC-----------EATVV 136
           P++V D+V  Y +  KIG TSVTI  +VW  P      VL+ TC           EA+  
Sbjct: 67  PVKVGDVVCCYGKAVKIGNTSVTIRLEVWVKP------VLRATCYGKEHPLFMVTEASFT 120

Query: 137 MVAVDEKGNPKSI 149
            VAVD++G  + I
Sbjct: 121 YVAVDDEGLKRPI 133


>gi|46201804|ref|ZP_00054301.2| COG1607: Acyl-CoA hydrolase [Magnetospirillum magnetotacticum MS-1]
          Length = 139

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 70/122 (57%), Gaps = 1/122 (0%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L+ +   MP D N  G+VFGGW+MSQ+D+A G  + +  +    T AV  + F +P+ 
Sbjct: 18  GRLSTRAIAMPADTNPFGHVFGGWLMSQMDLAGGTHSYRRARGHTPTVAVEGMEFHQPVY 77

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V D V  YT++ ++G+TS++I  + W   R+  SD L +   A    VAVD++G  + + 
Sbjct: 78  VGDEVSCYTEVIRVGRTSISIRVEAWVR-RHGGSDALVRVTSAVFTYVAVDDQGKKRPVP 136

Query: 151 TE 152
            E
Sbjct: 137 PE 138


>gi|299131942|ref|ZP_07025137.1| thioesterase superfamily protein [Afipia sp. 1NLS2]
 gi|298592079|gb|EFI52279.1| thioesterase superfamily protein [Afipia sp. 1NLS2]
          Length = 145

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 73/120 (60%), Gaps = 4/120 (3%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L ++   MP D N +G++FGGW++SQ+D+A  + A +    R VT A+  + F KP+ 
Sbjct: 23  GELCVRTIAMPADTNQNGDIFGGWLLSQMDLAGSVFAYKTTLARNVTVAIEAMTFRKPVF 82

Query: 91  VSDLVHIY-TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V DLV +Y TQ+R +G+TS+T++ + W   RN    +L    +     VA+DEKG P+ I
Sbjct: 83  VGDLVSVYGTQVR-VGRTSITVHIEAWVQRRNEMGIIL--VTDGNFTYVAIDEKGQPQPI 139


>gi|134093505|ref|YP_001098580.1| thioesterase/thiol ester dehydrase-isomerase domain-containing
           protein [Herminiimonas arsenicoxydans]
 gi|133737408|emb|CAL60451.1| Acyl-CoA thioester hydrolase [Herminiimonas arsenicoxydans]
          Length = 138

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 71/115 (61%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           +++  MP D N+ G+VFGGWIM+Q+D+A  + A++    RVVT AV   LF+ P+ V DL
Sbjct: 17  MRVVPMPHDSNMHGDVFGGWIMAQVDLAGAVCATRRANGRVVTIAVNSFLFKHPVFVGDL 76

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           + IY +I K+G TS+T+  + +   RN     + K  EAT+  VA D+   P+ +
Sbjct: 77  LSIYAEIVKVGNTSITVNVECY-AERNRLEVEIVKVTEATLTYVATDDNRKPRHL 130


>gi|261377680|ref|ZP_05982253.1| acyl-CoA thioester hydrolase YciA [Neisseria cinerea ATCC 14685]
 gi|269145947|gb|EEZ72365.1| acyl-CoA thioester hydrolase YciA [Neisseria cinerea ATCC 14685]
          Length = 145

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 76/126 (60%), Gaps = 2/126 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           ++H  G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F
Sbjct: 8   RLHPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIAQGRIVTVAVQEMNF 67

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEK 143
            +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++      EA    VA+D +
Sbjct: 68  IRPVKVGNVVCCYGHCVRVGNTSLQLKIEVWVKTLMNDHVTEERHLVTEAVFTYVAIDAE 127

Query: 144 GNPKSI 149
           GNP+ I
Sbjct: 128 GNPRPI 133


>gi|167855115|ref|ZP_02477887.1| YciI-like protein [Haemophilus parasuis 29755]
 gi|167853750|gb|EDS24992.1| YciI-like protein [Haemophilus parasuis 29755]
          Length = 146

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 73/127 (57%), Gaps = 4/127 (3%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
              G L L+   MP+D N +G++FGGWIMSQ+D+   I A +L K RVVT +V ++ F  
Sbjct: 8   QPEGTLILRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKELVKGRVVTVSVDKMSFLL 67

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           P+ V D+V  Y +  K+G+TS+ I  +VW   +     + ++ C  EA    VAVD  G 
Sbjct: 68  PVSVGDVVCCYGKCTKVGRTSLQIKVEVWI--KKVYEGMRERHCVTEALFTFVAVDSNGK 125

Query: 146 PKSIRTE 152
           P+ I  E
Sbjct: 126 PRVIPRE 132


>gi|329916041|ref|ZP_08276347.1| Acyl-CoA hydrolase [Oxalobacteraceae bacterium IMCC9480]
 gi|327544785|gb|EGF30183.1| Acyl-CoA hydrolase [Oxalobacteraceae bacterium IMCC9480]
          Length = 135

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 67/115 (58%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++  MP D N+ G+VFGGWIMSQ+DIA  + A++    RV T AV   LF+ P+ V DL
Sbjct: 17  LRMLPMPADANVYGDVFGGWIMSQVDIAGSLPATRRANGRVATIAVNSFLFKNPVFVGDL 76

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y +I K+G TS+T+  +V+   RN       K  EAT+  VA      P+ +
Sbjct: 77  LSFYAEIVKVGNTSITVNVEVF-AERNRLQAETVKVTEATLTYVATGPDRKPRPL 130


>gi|241661986|ref|YP_002980346.1| thioesterase superfamily protein [Ralstonia pickettii 12D]
 gi|240864013|gb|ACS61674.1| thioesterase superfamily protein [Ralstonia pickettii 12D]
          Length = 145

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 68/114 (59%), Gaps = 1/114 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           +++  MP+D N+ G+VFGGWIMSQ+DIA  I A      RV T AV   +F++P+ V DL
Sbjct: 27  VRVMPMPSDANVHGDVFGGWIMSQVDIAGSIPAVVRANGRVATIAVNSFVFKQPVYVGDL 86

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASS-DVLQKTCEATVVMVAVDEKGNPK 147
           V  Y  + K G+TS+T+  +V+    +A+      K  EAT+  VA DE   P+
Sbjct: 87  VSFYANVVKTGRTSITVDVEVYAQRMHANGRHATVKVTEATLTYVATDETRKPR 140


>gi|238894299|ref|YP_002919033.1| putative enzyme [Klebsiella pneumoniae NTUH-K2044]
 gi|262043033|ref|ZP_06016176.1| acyl-CoA thioester hydrolase YciA [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330002736|ref|ZP_08304408.1| thioesterase family protein [Klebsiella sp. MS 92-3]
 gi|238546615|dbj|BAH62966.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259039635|gb|EEW40763.1| acyl-CoA thioester hydrolase YciA [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328537207|gb|EGF63472.1| thioesterase family protein [Klebsiella sp. MS 92-3]
          Length = 132

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/129 (38%), Positives = 74/129 (57%), Gaps = 5/129 (3%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           +   G + L+   MP D N +G++FGGW+MSQ+DI   I A ++ + RVVT  V  + F 
Sbjct: 6   LAPKGEMVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIMAKEIAQGRVVTVRVDGMTFL 65

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEK 143
           +P+ V D+V  Y +  K G TSVTI  +VW   +  SS+ +    K  EA  + VAVD +
Sbjct: 66  RPVAVGDVVCCYARCVKRGNTSVTINIEVWV--KKVSSEPIGQRYKATEALFIYVAVDNQ 123

Query: 144 GNPKSIRTE 152
           G P+ +  E
Sbjct: 124 GKPRPLPAE 132


>gi|146329448|ref|YP_001209729.1| acyl-CoA thioester hydrolase [Dichelobacter nodosus VCS1703A]
 gi|146232918|gb|ABQ13896.1| acyl-CoA thioester hydrolase [Dichelobacter nodosus VCS1703A]
          Length = 147

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 73/127 (57%), Gaps = 2/127 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
              G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R VT AV E+ F  
Sbjct: 11  EPQGELVLRSLAMPADTNPNQDIFGGWIMSQMDMGAGILAAEITRGRAVTIAVQEMTFMH 70

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWT--CPRNASSDVLQKTCEATVVMVAVDEKGN 145
           P++V ++V  Y +   IG+TS+ I  +VW     ++   +  +   EA    VA+DE GN
Sbjct: 71  PVRVGNVVCCYGRCVHIGRTSLQIKIEVWVKIFGQSGFEESRKLVTEAIFTYVAIDENGN 130

Query: 146 PKSIRTE 152
           P+ I  E
Sbjct: 131 PRPIPKE 137


>gi|294649254|ref|ZP_06726690.1| cytosolic long-chain acyl-CoA thioester hydrolase [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292824859|gb|EFF83626.1| cytosolic long-chain acyl-CoA thioester hydrolase [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 143

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 71/125 (56%), Gaps = 2/125 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
              G+L+L+   MP D N  G+VFGGWI+SQ+D+A  I   +  K R  T A+ ++ F  
Sbjct: 7   QPEGILSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHVERFSKGRCATIAINQMSFLV 66

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           P++V +++  YT+I K+G TSV +  +VW    ++   V  +  E     VAVD KGN +
Sbjct: 67  PVKVGNVISCYTKILKVGNTSVQVQIEVWNSHDDSREPV--RITEGVFTFVAVDIKGNKR 124

Query: 148 SIRTE 152
            I  E
Sbjct: 125 VIAEE 129


>gi|88813237|ref|ZP_01128477.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Nitrococcus mobilis Nb-231]
 gi|88789559|gb|EAR20686.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Nitrococcus mobilis Nb-231]
          Length = 131

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 68/110 (61%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  G++FGGW+M+Q+D+A  I A++  + RV T AV  + F KP+ V D V +Y 
Sbjct: 22  MPKDTNPSGDIFGGWLMAQMDLAGSIVATRHARGRVATAAVNGMSFLKPVFVGDEVSLYA 81

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ K G+TS+T+  + W   R   S+   +  EAT V VA+DE+  P+ +
Sbjct: 82  KLLKTGRTSITVAVEAWR--RERFSEERIQVTEATFVYVAIDEQRQPRPV 129


>gi|326796045|ref|YP_004313865.1| thioesterase [Marinomonas mediterranea MMB-1]
 gi|326546809|gb|ADZ92029.1| thioesterase superfamily protein [Marinomonas mediterranea MMB-1]
          Length = 141

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 72/130 (55%), Gaps = 2/130 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  +    G LT +   MP D N  G++FGGW++SQ+D+A GI A Q  + RVVT ++  
Sbjct: 1   MSSEPVEKGRLTTRTVAMPADTNPSGDIFGGWVVSQMDLAAGICAGQRAQTRVVTVSIDG 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + F +P++V D++ +YT +   G+TS+ I+ + W   R       +K  EA    VA+D 
Sbjct: 61  MSFIRPVKVGDILGVYTYVESTGRTSMNIHVEAWV--RRGRIGQREKVTEALFKFVAIDA 118

Query: 143 KGNPKSIRTE 152
           +G    I  E
Sbjct: 119 EGKSMPIPAE 128


>gi|207727920|ref|YP_002256314.1| thioesterase protein [Ralstonia solanacearum MolK2]
 gi|207742325|ref|YP_002258717.1| thioesterase protein [Ralstonia solanacearum IPO1609]
 gi|206591162|emb|CAQ56774.1| thioesterase protein [Ralstonia solanacearum MolK2]
 gi|206593715|emb|CAQ60642.1| thioesterase protein [Ralstonia solanacearum IPO1609]
          Length = 139

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 68/115 (59%), Gaps = 3/115 (2%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           +++  MP D N+ G+VFGGWIM+Q+DIA  I A      RV T AV   +F++P+ V DL
Sbjct: 21  VRVMPMPADANVHGDVFGGWIMAQVDIAGSIPAVVRANGRVATVAVNSFVFKQPVYVGDL 80

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPK 147
           V  Y  + K G+TS+T+  +V+   R  S+   +  K  EAT+  VA DE   P+
Sbjct: 81  VSFYASVAKTGRTSITVDVEVYAQ-RMGSNGRHETVKVTEATLTYVATDESRKPR 134


>gi|241760112|ref|ZP_04758210.1| acyl-CoA thioester hydrolase YciA [Neisseria flavescens SK114]
 gi|241319566|gb|EER55996.1| acyl-CoA thioester hydrolase YciA [Neisseria flavescens SK114]
          Length = 144

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 79/131 (60%), Gaps = 4/131 (3%)

Query: 26  QMHSS--GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTEL 83
           Q H++  G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+
Sbjct: 6   QTHAAPEGQLLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIAQGRIVTVAVQEM 65

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVD 141
            F +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++  Q   EA    VA+D
Sbjct: 66  NFIRPVKVGNVVCCYGHCVRVGNTSLQLKIEVWVKTLMNDMVTEDRQLVTEAVFTYVAID 125

Query: 142 EKGNPKSIRTE 152
            +GNP+ I  E
Sbjct: 126 SQGNPRPIPRE 136


>gi|186475161|ref|YP_001856631.1| thioesterase superfamily protein [Burkholderia phymatum STM815]
 gi|184191620|gb|ACC69585.1| thioesterase superfamily protein [Burkholderia phymatum STM815]
          Length = 135

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 70/115 (60%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P+D N+ G+VFGGWIM+Q+DIA  I AS+    RV T AV   +F++P+ V DL
Sbjct: 18  LRVVPQPSDANVHGDVFGGWIMAQVDIAGSIPASRRANGRVATIAVNSFVFKQPVFVGDL 77

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I K G TSVT+  +V+   R + ++   K  EAT+  VA D    P+++
Sbjct: 78  LSFYADIVKTGNTSVTVSVEVYAQ-RMSLAEETVKVTEATLTYVATDTDRRPRAL 131


>gi|225076385|ref|ZP_03719584.1| hypothetical protein NEIFLAOT_01429 [Neisseria flavescens
           NRL30031/H210]
 gi|224952291|gb|EEG33500.1| hypothetical protein NEIFLAOT_01429 [Neisseria flavescens
           NRL30031/H210]
          Length = 144

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 79/131 (60%), Gaps = 4/131 (3%)

Query: 26  QMHSS--GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTEL 83
           Q H++  G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+
Sbjct: 6   QTHAAPEGQLLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIAQGRIVTVAVQEM 65

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVD 141
            F +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++  Q   EA    VA+D
Sbjct: 66  NFIRPVKVGNVVCCYGHCVRVGNTSLQLKIEVWVKTLMNDMVTEDRQLVTEAVFTYVAID 125

Query: 142 EKGNPKSIRTE 152
            +GNP+ I  E
Sbjct: 126 SQGNPRPIPRE 136


>gi|319637993|ref|ZP_07992757.1| acyl CoA thioester hydrolase [Neisseria mucosa C102]
 gi|317400638|gb|EFV81295.1| acyl CoA thioester hydrolase [Neisseria mucosa C102]
          Length = 146

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 79/131 (60%), Gaps = 4/131 (3%)

Query: 26  QMHSS--GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTEL 83
           Q H++  G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+
Sbjct: 6   QTHAAPEGQLLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIAQGRIVTVAVQEM 65

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVD 141
            F +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++  Q   EA    VA+D
Sbjct: 66  NFIRPVKVGNVVCCYGHCVRVGNTSLQLKIEVWVKTLMNDMVTEDRQLVTEAVFTYVAID 125

Query: 142 EKGNPKSIRTE 152
            +GNP+ I  E
Sbjct: 126 AQGNPRPIPRE 136


>gi|307130964|ref|YP_003882980.1| esterase [Dickeya dadantii 3937]
 gi|306528493|gb|ADM98423.1| esterase [Dickeya dadantii 3937]
          Length = 140

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 73/122 (59%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I+A ++ + RVVT  V  + F KP+ 
Sbjct: 10  GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAEGRVVTVRVDGMTFLKPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEKGNPK 147
           V D+V  Y +  + G++S+TI  +VW   +  S+D +    +  EA    VAVDE G P+
Sbjct: 70  VGDVVCCYARCVRTGRSSMTINVEVWV--KKVSTDPIGQRYRATEALFTYVAVDEDGRPR 127

Query: 148 SI 149
            +
Sbjct: 128 EL 129


>gi|91789749|ref|YP_550701.1| thioesterase superfamily protein [Polaromonas sp. JS666]
 gi|91698974|gb|ABE45803.1| thioesterase superfamily [Polaromonas sp. JS666]
          Length = 158

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 77/127 (60%), Gaps = 1/127 (0%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           +  Q+ +   L LK+  MP D N +G++FGGW+M+Q+D+A  +  ++    R+ T AV +
Sbjct: 30  LSVQLPTDKELVLKVIPMPADCNANGDIFGGWVMAQVDLAGSVVPARHAGGRLATVAVNQ 89

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
            +F++P++V D++  +  + +IG TS+T+  +V+     A    + K  EA++  VA+D+
Sbjct: 90  FIFKQPVRVGDILSFFASLTRIGTTSITVQVEVYAERFRAQGRYI-KVTEASLTYVAIDD 148

Query: 143 KGNPKSI 149
            G P+ I
Sbjct: 149 FGKPRKI 155


>gi|261381106|ref|ZP_05985679.1| acyl-CoA thioester hydrolase YciA [Neisseria subflava NJ9703]
 gi|284795904|gb|EFC51251.1| acyl-CoA thioester hydrolase YciA [Neisseria subflava NJ9703]
          Length = 144

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 79/131 (60%), Gaps = 4/131 (3%)

Query: 26  QMHSS--GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTEL 83
           Q H++  G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+
Sbjct: 6   QTHAAPEGQLLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIAQGRIVTVAVQEM 65

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVD 141
            F +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++  Q   EA    VA+D
Sbjct: 66  NFIRPVKVGNVVCCYGHCVRVGNTSLQLKIEVWVKTLMNDMVTEDRQLVTEAVFTYVAID 125

Query: 142 EKGNPKSIRTE 152
            +GNP+ I  E
Sbjct: 126 AQGNPRPIPRE 136


>gi|292492510|ref|YP_003527949.1| thioesterase superfamily protein [Nitrosococcus halophilus Nc4]
 gi|291581105|gb|ADE15562.1| thioesterase superfamily protein [Nitrosococcus halophilus Nc4]
          Length = 129

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 70/118 (59%), Gaps = 1/118 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           +L+I   PTD N  G++FGGW+MS  DIA  I A +  + R+VT AV    F +P+ V D
Sbjct: 10  SLRILARPTDTNASGDIFGGWLMSWTDIAGSIVAFRRARGRIVTVAVKNFNFIQPVYVDD 69

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           LV  Y ++ K+G TS+T+   V+   RN + D  ++   A +V VA+DE   P+ + T
Sbjct: 70  LVSFYAEVIKVGHTSLTVEVIVY-AERNRAEDTCEQVASAHLVYVALDENRRPRPVPT 126


>gi|262371130|ref|ZP_06064452.1| thioesterase superfamily protein [Acinetobacter johnsonii SH046]
 gi|262314016|gb|EEY95061.1| thioesterase superfamily protein [Acinetobacter johnsonii SH046]
          Length = 140

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 72/122 (59%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G+L+L+   MP D N  G+VFGGWI+SQ+D+A  I A +  K R  T ++ ++ F  P++
Sbjct: 10  GMLSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHAERFSKGRCATISINQMTFLVPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V D++  YT++ K+G TS+ +  +VW    ++   V  +  E     VAVD KGN + I 
Sbjct: 70  VGDVISCYTKLLKVGNTSIQMEIEVWDSHDSSRPPV--RVTEGVFTFVAVDVKGNKRQIP 127

Query: 151 TE 152
            +
Sbjct: 128 AD 129


>gi|226952852|ref|ZP_03823316.1| acyl-CoA thioester hydrolase [Acinetobacter sp. ATCC 27244]
 gi|226836363|gb|EEH68746.1| acyl-CoA thioester hydrolase [Acinetobacter sp. ATCC 27244]
          Length = 143

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 71/125 (56%), Gaps = 2/125 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
              G+L+L+   MP D N  G+VFGGWI+SQ+D+A  I   +L K R  T A+ ++ F  
Sbjct: 7   QPEGILSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHVERLSKGRCATIAINQMSFLV 66

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           P++V +++  YT+I K+G TSV +  +VW    ++   V  +  E     VAVD  GN +
Sbjct: 67  PVKVGNVISCYTKILKVGNTSVQVQIEVWNSHDDSREPV--RITEGVFTFVAVDINGNKR 124

Query: 148 SIRTE 152
            I  E
Sbjct: 125 VIAEE 129


>gi|312797288|ref|YP_004030210.1| acyl-CoA hydrolase [Burkholderia rhizoxinica HKI 454]
 gi|312169063|emb|CBW76066.1| Acyl-CoA hydrolase (EC 3.1.2.20) [Burkholderia rhizoxinica HKI 454]
          Length = 133

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (59%), Gaps = 1/117 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           + L++   P D N+ G+VFGGWIM+Q+DIA  I AS+    RVVT AV   +F++P+ V 
Sbjct: 14  VALRVVPQPRDANVHGDVFGGWIMAQVDIAGAIPASRRANGRVVTVAVNSFVFKQPVFVG 73

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           DL+  YT I + G+TS+T+   V+        + + K  EAT+  VA D +  P+ +
Sbjct: 74  DLLSFYTDIIRTGRTSITVDVSVYAQRMGLVGETV-KVTEATLTYVATDSQRRPREL 129


>gi|187735279|ref|YP_001877391.1| thioesterase [Akkermansia muciniphila ATCC BAA-835]
 gi|187425331|gb|ACD04610.1| thioesterase superfamily protein [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 155

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 71/123 (57%), Gaps = 1/123 (0%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCR-VVTKAVTEL 83
            Q+    V  L+++ MP D N  G VFGGW+MSQ+D+A    A +    R +VT+AV+ L
Sbjct: 8   AQLPEGRVPALRVEPMPADTNQSGEVFGGWVMSQVDLAGANTAMRYALSRYIVTRAVSSL 67

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEK 143
            FE P+ V D+V  YT I K+G+TSVT+  +V+        + + K  EA +V VA+ E 
Sbjct: 68  TFEAPVLVGDVVSFYTDIIKVGRTSVTVKVEVYAERLTKLCNNIAKITEAELVYVALGED 127

Query: 144 GNP 146
             P
Sbjct: 128 KKP 130


>gi|152980455|ref|YP_001351966.1| acyl-CoA thioester hydrolase [Janthinobacterium sp. Marseille]
 gi|151280532|gb|ABR88942.1| acyl-CoA thioester hydrolase [Janthinobacterium sp. Marseille]
          Length = 138

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 71/115 (61%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           +++  MP D N+ G+VFGGWIM+Q+D+A  + A++    RVVT AV   LF+ P+ V DL
Sbjct: 17  MRVVPMPHDANMHGDVFGGWIMAQVDLAGAVCATRRANGRVVTIAVNSFLFKHPVFVGDL 76

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           + IY +I K+G TSVT+  + +   RN     + K  EAT+  VA ++   P+ +
Sbjct: 77  LSIYAEIVKVGNTSVTVNVECY-AERNRLEVEIVKVTEATLTYVATNDDRKPRQL 130


>gi|240949550|ref|ZP_04753890.1| putative acyl CoA thioester hydrolase [Actinobacillus minor NM305]
 gi|240296123|gb|EER46784.1| putative acyl CoA thioester hydrolase [Actinobacillus minor NM305]
          Length = 157

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 72/125 (57%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
             +G L L+   MP+D N +G++FGGWIMSQ+D+   I A +L K RVVT  V +++F  
Sbjct: 9   EPNGKLILRTLAMPSDTNANGDIFGGWIMSQMDLGGAILAKELAKGRVVTVTVDKMIFHL 68

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           PI V D+V  Y  + ++G+TS+ +  +V+       +    +  EA    VA+D+ G P+
Sbjct: 69  PISVGDVVCCYGTLVRVGRTSMQVKVEVFIKQVYEGNRERFRVTEALFTYVAIDKNGRPR 128

Query: 148 SIRTE 152
            I  E
Sbjct: 129 EIPRE 133


>gi|326403650|ref|YP_004283732.1| hypothetical protein ACMV_15030 [Acidiphilium multivorum AIU301]
 gi|325050512|dbj|BAJ80850.1| hypothetical protein ACMV_15030 [Acidiphilium multivorum AIU301]
          Length = 134

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 71/115 (61%), Gaps = 2/115 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           ++   MP D N +G++FGGW+MSQ+D+     A ++   R+ T AV  + F +P+++ D 
Sbjct: 17  MRAIAMPADANANGDIFGGWLMSQMDLGGSNLAGRIAHGRIATVAVDAMSFIRPVKIGDE 76

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V +Y ++ K+G+TS+ +  + W   R+++S+  ++  +A    VA+D +G P+ I
Sbjct: 77  VSVYAELLKVGRTSIQVNVEAWRRARDSASE--RRVTKAVFTFVAIDSEGRPRPI 129


>gi|91779729|ref|YP_554937.1| putative acyl-CoA thioester hydrolase [Burkholderia xenovorans
           LB400]
 gi|91692389|gb|ABE35587.1| Putative acyl-CoA thioester hydrolase [Burkholderia xenovorans
           LB400]
          Length = 155

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 73/124 (58%), Gaps = 1/124 (0%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           ++ ++ +  L++   P+  N+ G+VFGGWIMS +DIA  I AS+    RVVT AV    F
Sbjct: 9   RLPANAMPVLRVVPQPSSANVHGDVFGGWIMSHVDIAGSIPASRRANGRVVTIAVNSFTF 68

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
            +P+ + DL+  Y  I + G+TS+T+  +V+      ++DV+ K  EAT+  VA D    
Sbjct: 69  RQPVFIGDLLSFYADIVREGRTSITVNVEVFAQRMGMAADVV-KVTEATLTFVATDPTRK 127

Query: 146 PKSI 149
           P+ +
Sbjct: 128 PRPL 131


>gi|251789785|ref|YP_003004506.1| acyl-CoA thioester hydrolase [Dickeya zeae Ech1591]
 gi|247538406|gb|ACT07027.1| thioesterase superfamily protein [Dickeya zeae Ech1591]
          Length = 140

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 11/137 (8%)

Query: 16  ITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRV 75
           ++K++VL        G L L+   MP D N +G++FGGW+MSQ+DI   I A ++ + RV
Sbjct: 1   MSKQDVL------PHGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAEGRV 54

Query: 76  VTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCE 132
           VT  V  + F KP+ V D+V  Y +  + G++S+TI  +VW   +  S+D +    +  E
Sbjct: 55  VTVRVDGMTFLKPVAVGDVVCCYARCVRTGRSSMTINVEVWV--KKVSTDPIGQRYRATE 112

Query: 133 ATVVMVAVDEKGNPKSI 149
           A    VAVDE+G P+ +
Sbjct: 113 ALFTYVAVDEEGRPREL 129


>gi|254360721|ref|ZP_04976869.1| acyl-CoA hydrolase [Mannheimia haemolytica PHL213]
 gi|261496903|ref|ZP_05993271.1| acyl-CoA hydrolase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153091291|gb|EDN73265.1| acyl-CoA hydrolase [Mannheimia haemolytica PHL213]
 gi|261307427|gb|EEY08762.1| acyl-CoA hydrolase [Mannheimia haemolytica serotype A2 str. OVINE]
          Length = 154

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 73/123 (59%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
            G L L+   MP+D N +G++FGGWIMSQ+D+   I A +L K RVVT  V +++F +PI
Sbjct: 11  EGKLILRTLAMPSDTNANGDIFGGWIMSQMDLGGAILAKELAKGRVVTVTVDKMIFHRPI 70

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V D+V  Y ++  IG++S+ +  +V+       +       EA    VA+D++G P+++
Sbjct: 71  SVGDVVCCYGKLMHIGRSSMQVKVEVFIKQVYEGNRERYLVTEALFTYVAIDKEGKPRAV 130

Query: 150 RTE 152
             E
Sbjct: 131 PRE 133


>gi|257095008|ref|YP_003168649.1| thioesterase superfamily protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047532|gb|ACV36720.1| thioesterase superfamily protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 132

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++  MP DVN  G+VFGGWIM+Q+D+A  I A    + RV T AV   LF++P+ V D+
Sbjct: 15  LRVMPMPADVNPQGDVFGGWIMAQVDVAGAIPAMHRARGRVTTVAVNSFLFKQPVSVGDV 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V  + ++   G+TS+ +  +V+   R+ +  +  K  EA +  VA+++ G 
Sbjct: 75  VSFFAEVIDTGRTSIKVRVEVY-AERHPAQPITVKVTEAVLTYVAINQHGE 124


>gi|283832896|ref|ZP_06352637.1| acyl-CoA thioester hydrolase YciA [Citrobacter youngae ATCC 29220]
 gi|291071499|gb|EFE09608.1| acyl-CoA thioester hydrolase YciA [Citrobacter youngae ATCC 29220]
          Length = 133

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 73/123 (59%), Gaps = 3/123 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I+A ++   RVVT  V  + F +P+ 
Sbjct: 10  GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAHGRVVTVRVEGMSFLRPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  K G TS++I  +VW   + AS  + Q  K  EA  + VAVD+ G P+ 
Sbjct: 70  VGDVVCCYARCVKRGTTSISINIEVW-VKKVASEPIGQRYKATEALFIYVAVDKDGKPRP 128

Query: 149 IRT 151
           I T
Sbjct: 129 IPT 131


>gi|167561598|ref|ZP_02354514.1| thioesterase domain protein [Burkholderia oklahomensis EO147]
 gi|167568834|ref|ZP_02361708.1| thioesterase domain protein [Burkholderia oklahomensis C6786]
          Length = 137

 Score = 94.0 bits (232), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 70/115 (60%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P+D N+ G+VFGGWIM+Q+DIA  I A +    RV T AV   LF++P+ V DL
Sbjct: 20  LRVVPQPSDANVHGDVFGGWIMAQVDIAGSIPACRRANGRVATVAVNSFLFKQPVFVGDL 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I K G TSVT+  +V+    +  S+++ K  EAT+  VA D    P+++
Sbjct: 80  LSFYASIVKTGNTSVTVDVEVYAQRMSLMSEIV-KVTEATLTYVATDADRRPRAL 133


>gi|148260457|ref|YP_001234584.1| thioesterase superfamily protein [Acidiphilium cryptum JF-5]
 gi|146402138|gb|ABQ30665.1| thioesterase superfamily protein [Acidiphilium cryptum JF-5]
          Length = 132

 Score = 94.0 bits (232), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 71/115 (61%), Gaps = 2/115 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           ++   MP D N +G++FGGW+MSQ+D+     A ++   R+ T AV  + F +P+++ D 
Sbjct: 15  MRAIAMPADANANGDIFGGWLMSQMDLGGSNLAGRIAHGRIATVAVDAMSFIRPVKIGDE 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V +Y ++ K+G+TS+ +  + W   R+++S+  ++  +A    VA+D +G P+ I
Sbjct: 75  VSVYAELLKVGRTSIQVNVEAWRRARDSASE--RRVTKAVFTFVAIDSEGRPRPI 127


>gi|257465655|ref|ZP_05630026.1| putative acyl CoA thioester hydrolase [Actinobacillus minor 202]
 gi|257451315|gb|EEV25358.1| putative acyl CoA thioester hydrolase [Actinobacillus minor 202]
          Length = 157

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 72/125 (57%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
             +G L L+   MP+D N +G++FGGWIMSQ+D+   I A +L K RVVT  V +++F  
Sbjct: 9   EPNGKLILRTLAMPSDTNANGDIFGGWIMSQMDLGGAILAKELAKGRVVTVTVDKMIFHL 68

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           PI V D+V  Y  + ++G+TS+ +  +V+       +    +  EA    VA+D+ G P+
Sbjct: 69  PISVGDVVCCYGTLVRVGRTSMQVKVEVFIKQVYEGNRERFRVTEALFTYVAIDKNGRPR 128

Query: 148 SIRTE 152
            I  E
Sbjct: 129 EIPRE 133


>gi|237731732|ref|ZP_04562213.1| acyl-CoA thioester hydrolase [Citrobacter sp. 30_2]
 gi|226907271|gb|EEH93189.1| acyl-CoA thioester hydrolase [Citrobacter sp. 30_2]
          Length = 133

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 73/123 (59%), Gaps = 3/123 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I+A ++   RVVT  V  + F +P+ 
Sbjct: 10  GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAHGRVVTVRVEGMSFLRPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  K G TS++I  +VW   + AS  + Q  K  EA  + VAVD+ G P+ 
Sbjct: 70  VGDVVCCYARCVKRGTTSISINIEVW-VKKVASEPIGQRYKATEALFIYVAVDKDGKPRP 128

Query: 149 IRT 151
           I T
Sbjct: 129 IPT 131


>gi|157370918|ref|YP_001478907.1| acyl-CoA thioester hydrolase [Serratia proteamaculans 568]
 gi|157322682|gb|ABV41779.1| thioesterase superfamily protein [Serratia proteamaculans 568]
          Length = 142

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 76/122 (62%), Gaps = 3/122 (2%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           SG + L+   MP D N +G++FGGW+MSQ+DI   I+A ++ + RVVT  V  + F KP+
Sbjct: 9   SGEMVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAEGRVVTVRVDGMTFLKPV 68

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPK 147
            V D+V  Y    + G++S+TI  +VW   + +S+ + Q  +  EA    VAVD++GN +
Sbjct: 69  AVGDVVCCYAHCIRTGRSSITINIEVW-VKKVSSAPIGQRYRATEAVFTYVAVDDEGNSR 127

Query: 148 SI 149
           ++
Sbjct: 128 AL 129


>gi|149178135|ref|ZP_01856730.1| acyl-CoA hydrolase [Planctomyces maris DSM 8797]
 gi|148843055|gb|EDL57423.1| acyl-CoA hydrolase [Planctomyces maris DSM 8797]
          Length = 137

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/125 (40%), Positives = 74/125 (59%), Gaps = 4/125 (3%)

Query: 24  VCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTEL 83
           +C++   G L L+   MP D N +G++FGGWIMSQ+DIA GI + ++   R VT AV  +
Sbjct: 5   ICEL-PDGKLILRTLAMPADTNANGDIFGGWIMSQMDIAGGILSKEVSGIRTVTIAVESM 63

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCP--RNASSDV-LQKTCEATVVMVAV 140
            F +P++V D+V  Y  + +IG TSVT+  +VW  P  R+  S     K  EA    VA+
Sbjct: 64  KFIRPVKVGDVVCCYGTVERIGTTSVTLQLEVWVEPVLRHEDSQCPCFKVTEAAFTYVAI 123

Query: 141 DEKGN 145
           D +G 
Sbjct: 124 DHQGK 128


>gi|300692516|ref|YP_003753511.1| acyl-CoA thioester hydrolase [Ralstonia solanacearum PSI07]
 gi|299079576|emb|CBJ52254.1| putative Acyl-CoA thioester hydrolase [Ralstonia solanacearum
           PSI07]
          Length = 139

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 68/115 (59%), Gaps = 3/115 (2%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           +++  MP D N+ G+VFGGWIM+Q+DIA  I A      RV T AV   +F++P+ V DL
Sbjct: 21  VRVMPMPADANVHGDVFGGWIMAQVDIAGSIPAVVRANGRVATVAVNSFVFKQPVYVGDL 80

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPK 147
           V  Y  + K G+TS+T+  +V+   R  S+   +  K  EAT+  VA DE   P+
Sbjct: 81  VSFYASVVKTGRTSITVDVEVYAQ-RMGSNGRHETVKVTEATLTYVATDESRKPR 134


>gi|271500665|ref|YP_003333690.1| thioesterase superfamily protein [Dickeya dadantii Ech586]
 gi|270344220|gb|ACZ76985.1| thioesterase superfamily protein [Dickeya dadantii Ech586]
          Length = 140

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 80/137 (58%), Gaps = 11/137 (8%)

Query: 16  ITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRV 75
           ++K++VL        G L L+   MP D N +G++FGGW+MSQ+DI   I A ++ + RV
Sbjct: 1   MSKQDVL------PHGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAEGRV 54

Query: 76  VTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCE 132
           VT  V  + F KP+ V D+V  Y +  + G++S+T+  +VW   +  S+D +    +  E
Sbjct: 55  VTVRVDGMTFLKPVAVGDVVCCYARCVRTGRSSMTVNVEVWV--KKVSTDPIGQRYRATE 112

Query: 133 ATVVMVAVDEKGNPKSI 149
           A    VAVDE+G P+ +
Sbjct: 113 ALFTYVAVDEEGRPREL 129


>gi|261493408|ref|ZP_05989933.1| acyl-CoA hydrolase [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261310902|gb|EEY12080.1| acyl-CoA hydrolase [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 154

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 73/123 (59%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
            G L L+   MP+D N +G++FGGWIMSQ+D+   I A +L K RVVT  V +++F +PI
Sbjct: 11  EGKLILRTLAMPSDTNANGDIFGGWIMSQMDLGGAILAKELAKGRVVTVTVDKMIFHRPI 70

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V D+V  Y ++  IG++S+ +  +V+       +       EA    VA+D++G P+++
Sbjct: 71  SVGDVVCCYGKLMYIGRSSMQVKVEVFIKQVYEGNRERYLVTEALFTYVAIDKEGKPRAV 130

Query: 150 RTE 152
             E
Sbjct: 131 PRE 133


>gi|260598160|ref|YP_003210731.1| acyl-CoA esterase [Cronobacter turicensis z3032]
 gi|260217337|emb|CBA31336.1| Acyl-CoA thioester hydrolase yciA [Cronobacter turicensis z3032]
          Length = 133

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 72/127 (56%), Gaps = 5/127 (3%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q    G L L+   MP D N +G++FGGW+M+Q+DI   I A ++   RVVT  V  + F
Sbjct: 5   QTTPQGELVLRTLAMPADTNANGDIFGGWLMAQMDIGGAILAKEIAHGRVVTVRVDGMTF 64

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDE 142
            +P+ V D+V  Y +  K G TSVTI  +VW   +  SS+ L    +  EA  + VAVD+
Sbjct: 65  LRPVAVGDVVCCYARCVKRGNTSVTINIEVWV--KKVSSEPLGQRYRATEALFIYVAVDD 122

Query: 143 KGNPKSI 149
            G P+ +
Sbjct: 123 NGKPRPL 129


>gi|253688383|ref|YP_003017573.1| thioesterase superfamily protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754961|gb|ACT13037.1| thioesterase superfamily protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 135

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 74/126 (58%), Gaps = 5/126 (3%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M   G L L+   MP D N +G++FGGW+MSQ+DI   I A ++ + RVVT  V  + F 
Sbjct: 1   MLPQGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAEGRVVTVRVDGMSFL 60

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEK 143
           KP+ V D+V  Y +  + G++S+ +  +VW   +  SS+ +    +  EA    VAVDE+
Sbjct: 61  KPVAVGDVVCCYARCLRTGRSSINVNVEVWV--KKVSSEPIGQRYRATEALFTYVAVDEE 118

Query: 144 GNPKSI 149
           G+P+ +
Sbjct: 119 GHPREL 124


>gi|83312448|ref|YP_422712.1| putative acyl-CoA thioester hydrolase yciA [Magnetospirillum
           magneticum AMB-1]
 gi|82947289|dbj|BAE52153.1| Putative acyl-CoA thioester hydrolase yciA [Magnetospirillum
           magneticum AMB-1]
          Length = 113

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 1/113 (0%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  G+VFGGW+MSQ+D+A G  + +  +    T AV  + F +P+ V D V  YT
Sbjct: 1   MPADTNPFGHVFGGWLMSQMDLAGGTHSYRRARGHTPTVAVEGMEFHQPVYVGDEVSCYT 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           +I ++G+TS+++  + W   R+  SD L K   A    VAVD++G  + +  E
Sbjct: 61  EILRVGRTSLSVRVEAWVR-RHGGSDALVKVTSAVFTYVAVDDQGKKRPVPPE 112


>gi|22125931|ref|NP_669354.1| acyl-CoA thioester hydrolase [Yersinia pestis KIM 10]
 gi|45441795|ref|NP_993334.1| acyl-CoA thioester hydrolase [Yersinia pestis biovar Microtus str.
           91001]
 gi|51596444|ref|YP_070635.1| acyl-CoA thioester hydrolase [Yersinia pseudotuberculosis IP 32953]
 gi|108807549|ref|YP_651465.1| acyl-CoA thioester hydrolase [Yersinia pestis Antiqua]
 gi|108811825|ref|YP_647592.1| acyl-CoA thioester hydrolase [Yersinia pestis Nepal516]
 gi|145598236|ref|YP_001162312.1| acyl-CoA thioester hydrolase [Yersinia pestis Pestoides F]
 gi|149365884|ref|ZP_01887919.1| putative acyl-CoA thioester hydrolase [Yersinia pestis CA88-4125]
 gi|153947770|ref|YP_001400920.1| acyl-CoA thioester hydrolase [Yersinia pseudotuberculosis IP 31758]
 gi|162420713|ref|YP_001606758.1| acyl-CoA thioester hydrolase [Yersinia pestis Angola]
 gi|165927410|ref|ZP_02223242.1| thioesterase family protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165938243|ref|ZP_02226802.1| thioesterase family protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166010731|ref|ZP_02231629.1| thioesterase family protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211077|ref|ZP_02237112.1| thioesterase family protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167400829|ref|ZP_02306335.1| thioesterase family protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420453|ref|ZP_02312206.1| thioesterase family protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425023|ref|ZP_02316776.1| thioesterase family protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167468888|ref|ZP_02333592.1| thioesterase family protein [Yersinia pestis FV-1]
 gi|170024289|ref|YP_001720794.1| acyl-CoA thioester hydrolase [Yersinia pseudotuberculosis YPIII]
 gi|186895495|ref|YP_001872607.1| acyl-CoA thioester hydrolase [Yersinia pseudotuberculosis PB1/+]
 gi|218929293|ref|YP_002347168.1| acyl-CoA thioester hydrolase [Yersinia pestis CO92]
 gi|229894876|ref|ZP_04510054.1| esterase [Yersinia pestis Pestoides A]
 gi|229897620|ref|ZP_04512776.1| esterase [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229898265|ref|ZP_04513412.1| esterase [Yersinia pestis biovar Orientalis str. India 195]
 gi|229902124|ref|ZP_04517245.1| esterase [Yersinia pestis Nepal516]
 gi|270490601|ref|ZP_06207675.1| thioesterase family protein [Yersinia pestis KIM D27]
 gi|294503764|ref|YP_003567826.1| putative acyl-CoA thioester hydrolase [Yersinia pestis Z176003]
 gi|21958870|gb|AAM85605.1|AE013806_9 hypothetical protein y2039 [Yersinia pestis KIM 10]
 gi|45436657|gb|AAS62211.1| putative acyl-CoA thioester hydrolase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51589726|emb|CAH21356.1| putative acyl-CoA thioester hydrolase [Yersinia pseudotuberculosis
           IP 32953]
 gi|108775473|gb|ABG17992.1| acyl-CoA thioester hydrolase [Yersinia pestis Nepal516]
 gi|108779462|gb|ABG13520.1| putative acyl-CoA thioester hydrolase [Yersinia pestis Antiqua]
 gi|115347904|emb|CAL20825.1| putative acyl-CoA thioester hydrolase [Yersinia pestis CO92]
 gi|145209932|gb|ABP39339.1| acyl-CoA thioester hydrolase [Yersinia pestis Pestoides F]
 gi|149292297|gb|EDM42371.1| putative acyl-CoA thioester hydrolase [Yersinia pestis CA88-4125]
 gi|152959265|gb|ABS46726.1| thioesterase family protein [Yersinia pseudotuberculosis IP 31758]
 gi|162353528|gb|ABX87476.1| thioesterase family protein [Yersinia pestis Angola]
 gi|165913904|gb|EDR32522.1| thioesterase family protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165920676|gb|EDR37924.1| thioesterase family protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990433|gb|EDR42734.1| thioesterase family protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166208257|gb|EDR52737.1| thioesterase family protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962148|gb|EDR58169.1| thioesterase family protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167049682|gb|EDR61090.1| thioesterase family protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056210|gb|EDR65988.1| thioesterase family protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|169750823|gb|ACA68341.1| thioesterase superfamily protein [Yersinia pseudotuberculosis
           YPIII]
 gi|186698521|gb|ACC89150.1| thioesterase superfamily protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|229681020|gb|EEO77115.1| esterase [Yersinia pestis Nepal516]
 gi|229688555|gb|EEO80624.1| esterase [Yersinia pestis biovar Orientalis str. India 195]
 gi|229693957|gb|EEO84006.1| esterase [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229701971|gb|EEO89992.1| esterase [Yersinia pestis Pestoides A]
 gi|262362116|gb|ACY58837.1| putative acyl-CoA thioester hydrolase [Yersinia pestis D106004]
 gi|262365445|gb|ACY62002.1| putative acyl-CoA thioester hydrolase [Yersinia pestis D182038]
 gi|270339105|gb|EFA49882.1| thioesterase family protein [Yersinia pestis KIM D27]
 gi|294354223|gb|ADE64564.1| putative acyl-CoA thioester hydrolase [Yersinia pestis Z176003]
 gi|320014858|gb|ADV98429.1| esterase [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 149

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 73/123 (59%), Gaps = 5/123 (4%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G L L+   MP D N +G++FGGW+MSQ+DI   I+A ++ + RVVT  V  + F KP+
Sbjct: 16  NGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAQGRVVTVRVDGMTFLKPV 75

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ---KTCEATVVMVAVDEKGNP 146
            V D+V  Y +  K G +S+TI  +VW   +  SS+ +    +  EA    VAVD+ G P
Sbjct: 76  AVGDVVCCYARCIKTGHSSITINIEVWV--KKVSSEPIGQRYRATEAVFTYVAVDDAGKP 133

Query: 147 KSI 149
           + +
Sbjct: 134 RGL 136


>gi|156933725|ref|YP_001437641.1| acyl-CoA thioester hydrolase [Cronobacter sakazakii ATCC BAA-894]
 gi|156531979|gb|ABU76805.1| hypothetical protein ESA_01551 [Cronobacter sakazakii ATCC BAA-894]
          Length = 133

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 72/127 (56%), Gaps = 5/127 (3%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q    G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F
Sbjct: 5   QATPQGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVDGMTF 64

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDE 142
            +P+ V D+V  Y +  K G TSVTI  +VW   +  SS+ +    +  EA  + VAVD+
Sbjct: 65  LRPVAVGDVVCCYARCVKRGNTSVTINIEVWV--KKVSSEPIGQRYRATEALFIYVAVDD 122

Query: 143 KGNPKSI 149
            G P+ +
Sbjct: 123 DGKPRPL 129


>gi|261821567|ref|YP_003259673.1| acyl-CoA thioester hydrolase [Pectobacterium wasabiae WPP163]
 gi|261605580|gb|ACX88066.1| thioesterase superfamily protein [Pectobacterium wasabiae WPP163]
          Length = 140

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 73/122 (59%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++ + RVVT  V  + F KP+ 
Sbjct: 10  GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAEGRVVTVRVDGMSFLKPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEKGNPK 147
           V D+V  Y +  + G++S+ I  +VW   +  SS+ +    +  EA    VAVDE+G+P+
Sbjct: 70  VGDVVCCYARCLRTGRSSININVEVWV--KKVSSEPIGQRYRATEALFTYVAVDEEGHPR 127

Query: 148 SI 149
            +
Sbjct: 128 EL 129


>gi|152969797|ref|YP_001334906.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|150954646|gb|ABR76676.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
          Length = 121

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 72/123 (58%), Gaps = 5/123 (4%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           + L+   MP D N +G++FGGW+MSQ+DI   I A ++ + RVVT  V  + F +P+ V 
Sbjct: 1   MVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIMAKEIAQGRVVTVRVDGMTFLRPVAVG 60

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEKGNPKSI 149
           D+V  Y +  K G TSVTI  +VW   +  SS+ +    K  EA  + VAVD +G P+ +
Sbjct: 61  DVVCCYARCVKRGNTSVTINIEVWV--KKVSSEPIGQRYKATEALFIYVAVDNQGKPRPL 118

Query: 150 RTE 152
             E
Sbjct: 119 PAE 121


>gi|303256242|ref|ZP_07342258.1| thioesterase family protein [Burkholderiales bacterium 1_1_47]
 gi|302860971|gb|EFL84046.1| thioesterase family protein [Burkholderiales bacterium 1_1_47]
          Length = 152

 Score = 93.2 bits (230), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 69/115 (60%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++  MP D N  G+VFGGWIMSQ+D+A    AS++   R  T AVT   F++P+ V D+
Sbjct: 26  LRVMAMPPDTNQYGDVFGGWIMSQVDLAGSSIASRVANSRTATVAVTSFTFKEPVWVGDV 85

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V  Y  + K+G TS+T+   V+    +  +  + K  EA +V VA+++ G P+ +
Sbjct: 86  VSFYATVLKVGTTSITVDVTVFAERLHKDNHRIVKVTEAQLVFVALNKDGRPQPV 140


>gi|325981426|ref|YP_004293828.1| thioesterase superfamily protein [Nitrosomonas sp. AL212]
 gi|325530945|gb|ADZ25666.1| thioesterase superfamily protein [Nitrosomonas sp. AL212]
          Length = 140

 Score = 93.2 bits (230), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 69/126 (54%), Gaps = 2/126 (1%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
             G   L++  MP+D N  G++FGGWIMSQ+D+A  I A +    RV T AV   +F+ P
Sbjct: 15  PEGQPILRMVPMPSDTNYAGDIFGGWIMSQVDMAGSIPALRRAHGRVATVAVNSFVFKHP 74

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWT--CPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           + V DLV  Y  I K+G+TS+T+   V+     R    +V  K  EA +  VA+D    P
Sbjct: 75  VCVGDLVSFYADIIKVGRTSITVGVAVYAQRGVREGGEEVCIKVTEAELTYVAIDSDRRP 134

Query: 147 KSIRTE 152
           + +  E
Sbjct: 135 RPVPQE 140


>gi|149908705|ref|ZP_01897366.1| acyl-CoA hydrolase [Moritella sp. PE36]
 gi|149808247|gb|EDM68186.1| acyl-CoA hydrolase [Moritella sp. PE36]
          Length = 136

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 72/122 (59%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L  +  +MP+D N +G++FGGWIMSQ+DIA GI A ++ + RV T +V  + F KP+ 
Sbjct: 8   GQLLTRTLSMPSDCNANGDIFGGWIMSQMDIAGGILAKEVAQGRVATISVDGMTFHKPVA 67

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK--TCEATVVMVAVDEKGNPKS 148
           V D+V  Y    +IG +S+TI  ++W  P   +  V  +    EAT   VA+D+ G  + 
Sbjct: 68  VGDVVCCYGSCTRIGNSSMTIKLEIWVKPLINAPKVNYRYIVTEATFTYVAIDDNGQSRK 127

Query: 149 IR 150
           I 
Sbjct: 128 IE 129


>gi|219870710|ref|YP_002475085.1| putative acyl-CoA thioester hydrolase [Haemophilus parasuis SH0165]
 gi|219690914|gb|ACL32137.1| putative acyl-CoA thioester hydrolase [Haemophilus parasuis SH0165]
          Length = 146

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 71/124 (57%), Gaps = 4/124 (3%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
              G L L+   MP+D N +G++FGGWIMSQ+D+   I A +L K RVVT +V ++ F  
Sbjct: 8   QPEGTLILRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKELVKGRVVTVSVDKMSFLL 67

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGN 145
           P+ V D+V  Y +  K+G+TS+ I  +VW   +     +  + C  EA    VAVD  G 
Sbjct: 68  PVSVGDVVCCYGKCTKVGRTSLQIKVEVWI--KKVYEGMRDRHCVTEALFTFVAVDSNGK 125

Query: 146 PKSI 149
           P+ I
Sbjct: 126 PRVI 129


>gi|83594041|ref|YP_427793.1| thioesterase superfamily protein [Rhodospirillum rubrum ATCC 11170]
 gi|83576955|gb|ABC23506.1| Thioesterase superfamily [Rhodospirillum rubrum ATCC 11170]
          Length = 150

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G ++++   MP D N  G++FGGW+M+Q+D+A G  A +    RVVT AV    F  P++
Sbjct: 26  GTVSIRTIAMPADTNPSGDIFGGWLMAQMDLAGGTHARKAAGGRVVTVAVNGFSFHLPVK 85

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V D V  YT+I K G+TS+T+    W C ++  + +  K  E   V VA+D +G  + +
Sbjct: 86  VGDEVTCYTEIIKRGRTSLTLDVQAWVCRQDGGAKI--KVTEGVFVFVALDAEGRARPL 142


>gi|116515108|ref|YP_802737.1| YciA [Buchnera aphidicola str. Cc (Cinara cedri)]
 gi|116256962|gb|ABJ90644.1| putative acyl-CoA thioester hydrolase [Buchnera aphidicola str. Cc
           (Cinara cedri)]
          Length = 142

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 72/122 (59%), Gaps = 1/122 (0%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M S+  L LK   MP   N++GN+FGGWIMS++DIA GI A ++ K RV T  V  + F 
Sbjct: 9   MVSNKNLMLKTIAMPLHKNINGNIFGGWIMSKMDIAGGILAKEISKGRVSTVCVKNINFL 68

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNAS-SDVLQKTCEATVVMVAVDEKGN 145
           KPI   DLV  Y + +KIG TS+T   ++W    ++    +   +  AT + VA+D+ G 
Sbjct: 69  KPISAGDLVFCYAKCKKIGNTSITTKIEIWIKKIHSKLFGISYCSTTATFIYVAIDKYGK 128

Query: 146 PK 147
           P+
Sbjct: 129 PR 130


>gi|331001303|ref|ZP_08324929.1| thioesterase family protein [Parasutterella excrementihominis YIT
           11859]
 gi|329569030|gb|EGG50826.1| thioesterase family protein [Parasutterella excrementihominis YIT
           11859]
          Length = 141

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 69/115 (60%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++  MP D N  G+VFGGWIMSQ+D+A    AS++   R  T AVT   F++P+ V D+
Sbjct: 15  LRVMAMPPDTNQYGDVFGGWIMSQVDLAGSSIASRVANSRTATVAVTSFTFKEPVWVGDV 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V  Y  + K+G TS+T+   V+    +  +  + K  EA +V VA+++ G P+ +
Sbjct: 75  VSFYATVLKVGTTSITVDVTVFAERLHKDNHRIVKVTEAQLVFVALNKDGRPQPV 129


>gi|311279839|ref|YP_003942070.1| thioesterase superfamily protein [Enterobacter cloacae SCF1]
 gi|308749034|gb|ADO48786.1| thioesterase superfamily protein [Enterobacter cloacae SCF1]
          Length = 132

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 72/122 (59%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ 
Sbjct: 10  GDLVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIMAKEIAHGRVVTVRVDGMTFLRPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEKGNPK 147
           V D+V  Y +  K G TS+TI  +VW   +  SS+ +    K  EA  + VAVD +G P+
Sbjct: 70  VGDVVCCYARCVKRGNTSITINIEVWV--KKVSSEPIGQRYKATEALFIYVAVDSEGKPR 127

Query: 148 SI 149
           ++
Sbjct: 128 AL 129


>gi|184159500|ref|YP_001847839.1| acyl-CoA hydrolase [Acinetobacter baumannii ACICU]
 gi|239504358|ref|ZP_04663668.1| Acyl-CoA hydrolase [Acinetobacter baumannii AB900]
 gi|260557096|ref|ZP_05829312.1| acyl-CoA hydrolase [Acinetobacter baumannii ATCC 19606]
 gi|332873854|ref|ZP_08441795.1| thioesterase family protein [Acinetobacter baumannii 6014059]
 gi|183211094|gb|ACC58492.1| Acyl-CoA hydrolase [Acinetobacter baumannii ACICU]
 gi|260409202|gb|EEX02504.1| acyl-CoA hydrolase [Acinetobacter baumannii ATCC 19606]
 gi|322509412|gb|ADX04866.1| Putative acyl-CoA thioester hydrolase [Acinetobacter baumannii
           1656-2]
 gi|323519433|gb|ADX93814.1| hypothetical protein ABTW07_3395 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332737958|gb|EGJ68844.1| thioesterase family protein [Acinetobacter baumannii 6014059]
          Length = 140

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 72/122 (59%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G+L+L+   MP D N  G+VFGGWI+SQ+D+A  I A +  + R  T ++ ++ F  P++
Sbjct: 10  GILSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHAERFSRGRCATISINQMTFLVPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V  ++  YT+I K+G TS+ +  +VW    ++ + +  +  E     VAVD KGN + I 
Sbjct: 70  VGFVISCYTKILKVGNTSIQMQIEVWDSHDDSRAPI--RITEGVFTFVAVDVKGNKRQIP 127

Query: 151 TE 152
            E
Sbjct: 128 EE 129


>gi|261364917|ref|ZP_05977800.1| acyl-CoA thioester hydrolase YciA [Neisseria mucosa ATCC 25996]
 gi|288566700|gb|EFC88260.1| acyl-CoA thioester hydrolase YciA [Neisseria mucosa ATCC 25996]
          Length = 145

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 76/127 (59%), Gaps = 2/127 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
           H  G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F +
Sbjct: 10  HPQGELLLRTVAMPQDTNPNQDIFGGWIMSQMDLGGGILAAEIAQGRIVTVAVQEMNFIR 69

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           P++V ++V  Y +  ++G TS+ +  +VW  T   +  ++  Q   EA    VA+D +GN
Sbjct: 70  PVKVGNVVCCYGRCVRVGNTSLQLKIEVWVKTLMNDHLTEDRQLVTEAVFTYVAIDSEGN 129

Query: 146 PKSIRTE 152
            + I  E
Sbjct: 130 TRPIPKE 136


>gi|32034957|ref|ZP_00135041.1| COG1607: Acyl-CoA hydrolase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126208445|ref|YP_001053670.1| putative acyl CoA thioester hydrolase [Actinobacillus
           pleuropneumoniae L20]
 gi|165976399|ref|YP_001651992.1| putative acyl CoA thioester hydrolase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|190150295|ref|YP_001968820.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303251092|ref|ZP_07337278.1| putative acyl CoA thioester hydrolase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303253567|ref|ZP_07339705.1| putative acyl CoA thioester hydrolase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307245878|ref|ZP_07527963.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307247968|ref|ZP_07529999.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307250220|ref|ZP_07532176.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307252607|ref|ZP_07534501.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307254851|ref|ZP_07536677.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307257016|ref|ZP_07538792.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307259293|ref|ZP_07541022.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307261455|ref|ZP_07543126.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|307263638|ref|ZP_07545249.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|126097237|gb|ABN74065.1| putative acyl CoA thioester hydrolase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165876500|gb|ABY69548.1| putative acyl CoA thioester hydrolase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|189915426|gb|ACE61678.1| putative acyl CoA thioester hydrolase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302647487|gb|EFL77705.1| putative acyl CoA thioester hydrolase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302650102|gb|EFL80272.1| putative acyl CoA thioester hydrolase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306853238|gb|EFM85458.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306855522|gb|EFM87694.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306857749|gb|EFM89849.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306859929|gb|EFM91948.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306862222|gb|EFM94190.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306864500|gb|EFM96407.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306866660|gb|EFM98519.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306868850|gb|EFN00656.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306871015|gb|EFN02748.1| acyl CoA thioester hydrolase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 163

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 73/125 (58%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
           + +G L L+   MP+D N +G++FGGWIMSQ+D+   I A +L K RVVT  V +++F  
Sbjct: 10  NPNGKLLLRTLAMPSDTNANGDIFGGWIMSQMDLGGAILAKELAKGRVVTVTVDKMVFHM 69

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           PI V D+V  Y  + ++G++S+ +  +V+       S    +  EA    VAV+ +G P+
Sbjct: 70  PISVGDVVCCYGTLVRVGRSSMQVKVEVFIKQVYQGSRERFRVTEALFTYVAVNNEGRPR 129

Query: 148 SIRTE 152
            I  E
Sbjct: 130 EIPRE 134


>gi|238763143|ref|ZP_04624109.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia kristensenii
           ATCC 33638]
 gi|238698642|gb|EEP91393.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia kristensenii
           ATCC 33638]
          Length = 156

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/127 (38%), Positives = 76/127 (59%), Gaps = 5/127 (3%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q+  +G L L+   MP D N +G++FGGW+MSQ+DI   I+A ++ + RVVT  V  + F
Sbjct: 19  QVLPNGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAQGRVVTVRVDGMTF 78

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDE 142
            KP+ V D+V  Y +  K G++S+TI  +VW   +  SS+ +    K  EA    VAVD+
Sbjct: 79  LKPVAVGDVVCCYARCIKSGRSSITINIEVWV--KKVSSEPIGQRYKATEAVFTYVAVDD 136

Query: 143 KGNPKSI 149
            G  +++
Sbjct: 137 AGKARAL 143


>gi|163855017|ref|YP_001629315.1| putative acyl-CoA hydrolase [Bordetella petrii DSM 12804]
 gi|163258745|emb|CAP41044.1| putative acyl-CoA hydrolase [Bordetella petrii]
          Length = 135

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 75/135 (55%), Gaps = 7/135 (5%)

Query: 23  MVCQMHSSGVLT------LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVV 76
           M    HSS  L       L++  MP D N+ G+VFGGWIMSQ+DIA  + A++    RV 
Sbjct: 1   MTTADHSSATLPEGRDPVLRVMPMPADANIHGDVFGGWIMSQVDIAGSVPAARRAAGRVA 60

Query: 77  TKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVV 136
           T AV    F++P+ V DL+  Y  I K GKTSVT+  +V+       ++V+ K  EAT+ 
Sbjct: 61  TVAVNAFQFKQPVFVGDLLSFYATITKTGKTSVTVSVEVYAERHRLDAEVV-KVTEATLT 119

Query: 137 MVAVDEKGNPKSIRT 151
            VA DE    + + T
Sbjct: 120 YVATDEARRSRPLPT 134


>gi|260548767|ref|ZP_05822989.1| acyl-CoA hydrolase [Acinetobacter sp. RUH2624]
 gi|260407935|gb|EEX01406.1| acyl-CoA hydrolase [Acinetobacter sp. RUH2624]
          Length = 138

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 72/122 (59%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G+L+L+   MP D N  G+VFGGWI+SQ+D+A  I A +  + R  T ++ ++ F  P++
Sbjct: 10  GILSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHAERFSRGRCATISINQMTFLVPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V  ++  YT+I K+G TS+ +  +VW    ++ + +  +  E     VAVD KGN + I 
Sbjct: 70  VGFVISCYTKILKVGNTSIQMQIEVWDSHDDSRAPI--RITEGVFTFVAVDVKGNKRQIP 127

Query: 151 TE 152
            E
Sbjct: 128 EE 129


>gi|15676820|ref|NP_273965.1| acyl CoA thioester hydrolase family protein [Neisseria meningitidis
           MC58]
 gi|7226164|gb|AAF41333.1| acyl CoA thioester hydrolase family protein [Neisseria meningitidis
           MC58]
 gi|254672243|emb|CBA05226.1| putative acyl-CoA thioester hydrolase [Neisseria meningitidis
           alpha275]
 gi|308389097|gb|ADO31417.1| putative acyl-CoA hydrolase [Neisseria meningitidis alpha710]
 gi|316985857|gb|EFV64799.1| thioesterase superfamily protein [Neisseria meningitidis H44/76]
 gi|325130086|gb|EGC52873.1| thioesterase family protein [Neisseria meningitidis OX99.30304]
 gi|325134071|gb|EGC56725.1| thioesterase family protein [Neisseria meningitidis M13399]
 gi|325136830|gb|EGC59428.1| thioesterase family protein [Neisseria meningitidis M0579]
 gi|325144282|gb|EGC66587.1| thioesterase family protein [Neisseria meningitidis M01-240013]
 gi|325200389|gb|ADY95844.1| thioesterase family protein [Neisseria meningitidis H44/76]
 gi|325202286|gb|ADY97740.1| thioesterase family protein [Neisseria meningitidis M01-240149]
 gi|325206242|gb|ADZ01695.1| thioesterase family protein [Neisseria meningitidis M04-240196]
          Length = 148

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 75/129 (58%), Gaps = 2/129 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           +    G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F
Sbjct: 8   RQRPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIARGRIVTVAVQEMNF 67

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEK 143
            +P++V ++V  Y    ++G TS+ +  DVW  T   +  ++      EA    VA+D +
Sbjct: 68  IRPVKVGNVVCCYGHCVRVGNTSLQLKVDVWVKTLMNDCVTEDRYLVTEAVFTYVAIDAE 127

Query: 144 GNPKSIRTE 152
           GNP+ I  E
Sbjct: 128 GNPRPIPKE 136


>gi|227111439|ref|ZP_03825095.1| acyl-CoA thioester hydrolase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227326064|ref|ZP_03830088.1| acyl-CoA thioester hydrolase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 140

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 73/122 (59%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++ + RVVT  V  + F KP+ 
Sbjct: 10  GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAEGRVVTVRVDGMSFLKPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEKGNPK 147
           V D+V  Y +  + G++S+ +  +VW   +  SS+ +    +  EA    VAVDE+G+P+
Sbjct: 70  VGDVVCCYARCLRTGRSSINVNVEVWV--KKVSSEPIGQRYRATEALFTYVAVDEEGHPR 127

Query: 148 SI 149
            +
Sbjct: 128 EL 129


>gi|301166648|emb|CBW26224.1| putative acyl-coA hydrolase [Bacteriovorax marinus SJ]
          Length = 130

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L+L+   MP D N +G++FGGW+MSQ+DIA  I A + C  RVVT AV  ++F  P+ 
Sbjct: 8   GELSLRTLAMPADTNPNGDIFGGWLMSQMDIAGSIYAMRHCGGRVVTVAVDSMVFHSPVH 67

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V D+V  Y+++ K G TS+ I  +V+   R  +  V  K  E     V +D+ G P  +
Sbjct: 68  VGDIVCCYSELIKKGNTSLRIKIEVFVVKRYKNERV--KVTEGQFTYVRIDKSGKPTPV 124


>gi|296161141|ref|ZP_06843951.1| thioesterase superfamily protein [Burkholderia sp. Ch1-1]
 gi|295888664|gb|EFG68472.1| thioesterase superfamily protein [Burkholderia sp. Ch1-1]
          Length = 155

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 68/115 (59%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P+  N+ G+VFGGWIMS +DIA  I AS+    RVVT AV    F +P+ + DL
Sbjct: 18  LRVVPQPSSANVHGDVFGGWIMSHVDIAGSIPASRRANGRVVTIAVNSFTFRQPVFIGDL 77

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I + G+TS+T+  +V+      ++DV+ K  EAT+  VA D    P+ +
Sbjct: 78  LSFYADIVREGRTSITVNVEVFAQRMGMAADVV-KVTEATLTFVATDSMRMPRPL 131


>gi|262281049|ref|ZP_06058831.1| thioesterase superfamily protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257280|gb|EEY76016.1| thioesterase superfamily protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 139

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 71/122 (58%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           GVL+L+   MP D N  G+VFGGWI+SQ+D+A  I A +  + R  T ++ ++ F  P++
Sbjct: 10  GVLSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHAERFSRGRCATISINQMTFLVPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V  ++  YT+I K+G TS+ +  +VW    ++   +  +  E     VAVD KGN + I 
Sbjct: 70  VGFVISCYTKILKVGNTSIQMQIEVWDSHDDSREPI--RITEGVFTFVAVDVKGNKRQIP 127

Query: 151 TE 152
            E
Sbjct: 128 EE 129


>gi|17545196|ref|NP_518598.1| hypothetical protein RSc0477 [Ralstonia solanacearum GMI1000]
 gi|17427487|emb|CAD14005.1| putative thioesterase protein [Ralstonia solanacearum GMI1000]
          Length = 139

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 69/117 (58%), Gaps = 3/117 (2%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           +++  MP D N+ G+VFGGWIM+Q+DIA  I A      RV T AV   +F++P+ V DL
Sbjct: 21  VRVMPMPADANVHGDVFGGWIMAQVDIAGSIPAVVRANGRVATVAVNSFVFKQPVYVGDL 80

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKSI 149
           V  Y  + K G+TS+T+  +V+   R  S+   +  K  EAT+  VA D    P+++
Sbjct: 81  VSFYASVVKTGRTSITVDVEVYAQ-RMGSNGRHETVKVTEATLTYVATDASRKPRAL 136


>gi|21672543|ref|NP_660610.1| hypothetical protein BUsg263 [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|22654297|sp|P42398|Y263_BUCAP RecName: Full=Uncharacterized acyl-CoA thioester hydrolase BUsg_263
 gi|21623167|gb|AAM67821.1| hypothetical protein BUsg_263 [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 135

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 70/121 (57%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + LK  TM +D N +G++FGGWIMSQ+D+   I A ++   RVVT  V  + F KP+ 
Sbjct: 10  GTIVLKTLTMRSDTNANGDIFGGWIMSQMDMGGAILAKEIAGGRVVTVQVNGITFFKPVS 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGNPKS 148
           V D+V  Y    K G +S+TI  +VW   +  S  + Q  C  EA  + VA+DE G P+ 
Sbjct: 70  VGDIVSCYAHCIKTGNSSITINLEVW-IKKIYSKPLGQFYCAAEAIFIYVAIDETGKPRE 128

Query: 149 I 149
           +
Sbjct: 129 L 129


>gi|161503150|ref|YP_001570262.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160864497|gb|ABX21120.1| hypothetical protein SARI_01218 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 133

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 71/121 (58%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ 
Sbjct: 10  GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  K G+TS++I  +VW   + AS  + Q  K  EA  + VAVD  G P+ 
Sbjct: 70  VGDVVCCYARCVKRGRTSISINIEVWV-KKVASEPIGQRYKATEALFIYVAVDPNGRPRP 128

Query: 149 I 149
           +
Sbjct: 129 L 129


>gi|189351475|ref|YP_001947103.1| putative acyl-CoA hydrolase [Burkholderia multivorans ATCC 17616]
 gi|221200084|ref|ZP_03573127.1| thioesterase family protein [Burkholderia multivorans CGD2M]
 gi|221206763|ref|ZP_03579775.1| thioesterase family protein [Burkholderia multivorans CGD2]
 gi|221211266|ref|ZP_03584245.1| thioesterase family protein [Burkholderia multivorans CGD1]
 gi|189335497|dbj|BAG44567.1| putative acyl-CoA hydrolase [Burkholderia multivorans ATCC 17616]
 gi|221168627|gb|EEE01095.1| thioesterase family protein [Burkholderia multivorans CGD1]
 gi|221173418|gb|EEE05853.1| thioesterase family protein [Burkholderia multivorans CGD2]
 gi|221180323|gb|EEE12727.1| thioesterase family protein [Burkholderia multivorans CGD2M]
          Length = 131

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P D N+ G+VFGGWIMSQ+DIA  I ASQ    RV T AV   +F++P+ V DL
Sbjct: 15  LRVVPQPHDANVHGDVFGGWIMSQVDIAGSIPASQRANGRVATVAVNSFVFKQPVFVGDL 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I + G TSVT+  +V+        +V+ K  EAT+  VA      P+ +
Sbjct: 75  LSFYATITRTGNTSVTVDVEVYAQRMRLMGEVV-KVTEATLTYVATGPDRKPRPL 128


>gi|294635954|ref|ZP_06714397.1| acyl-CoA thioester hydrolase YciA [Edwardsiella tarda ATCC 23685]
 gi|291090711|gb|EFE23272.1| acyl-CoA thioester hydrolase YciA [Edwardsiella tarda ATCC 23685]
          Length = 142

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 74/122 (60%), Gaps = 3/122 (2%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G L L+   MP D N +G++FGGWIMSQ+DI   I A ++ + RVVT AV  + F KP+
Sbjct: 9   AGELVLRTLAMPADTNANGDIFGGWIMSQMDIGGAILAKEIAEGRVVTVAVNAITFLKPV 68

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGNPK 147
            V D+V  Y +  + G++S+T+  +VW   + AS  + Q+ C  EA    VAV++    +
Sbjct: 69  AVGDVVCCYARCIRTGRSSITVNIEVWV-KKVASEPIGQRECVTEAVFTYVAVNDANKSR 127

Query: 148 SI 149
           ++
Sbjct: 128 AL 129


>gi|118475622|ref|YP_892434.1| acyl-CoA hydrolase [Campylobacter fetus subsp. fetus 82-40]
 gi|261886221|ref|ZP_06010260.1| acyl-CoA hydrolase [Campylobacter fetus subsp. venerealis str.
           Azul-94]
 gi|118414848|gb|ABK83268.1| acyl-CoA hydrolase [Campylobacter fetus subsp. fetus 82-40]
          Length = 136

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 73/127 (57%), Gaps = 1/127 (0%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M   G   +KI  MP+D N  GN+FGGWI+SQID+A  I A +L   RVVT ++ E++F+
Sbjct: 1   MKDMGEPRIKIVAMPSDTNPAGNIFGGWILSQIDLAGSIAARELAPTRVVTISMKEVIFK 60

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDV-LQKTCEATVVMVAVDEKGN 145
           +P+ + D+V  Y ++  +G TS+T    V     N    V       A V  V+VDE+GN
Sbjct: 61  EPVFIGDIVSCYAKVVSVGNTSITTVVKVVVQRLNDGGFVECVPVTTAEVTYVSVDEQGN 120

Query: 146 PKSIRTE 152
            K I +E
Sbjct: 121 KKPIDSE 127


>gi|299067964|emb|CBJ39178.1| putative Acyl-CoA thioester hydrolase [Ralstonia solanacearum
           CMR15]
          Length = 141

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 69/117 (58%), Gaps = 3/117 (2%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           +++  MP D N+ G+VFGGWIM+Q+DIA  I A      RV T AV   +F++P+ V DL
Sbjct: 23  VRVMPMPADANVHGDVFGGWIMAQVDIAGSIPAVVRANGRVATVAVNSFVFKQPVYVGDL 82

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKSI 149
           V  Y  + K G+TS+T+  +V+   R  S+   +  K  EAT+  VA D    P+++
Sbjct: 83  VSFYASVVKTGRTSITVDVEVYAQ-RMGSNGRHETVKVTEATLTYVATDASRKPRAL 138


>gi|169794691|ref|YP_001712484.1| putative acyl-CoA thioester hydrolase [Acinetobacter baumannii AYE]
 gi|213157938|ref|YP_002320736.1| hypothetical protein AB57_3431 [Acinetobacter baumannii AB0057]
 gi|215482278|ref|YP_002324460.1| Thioesterase superfamily protein [Acinetobacter baumannii
           AB307-0294]
 gi|301345083|ref|ZP_07225824.1| Thioesterase superfamily protein [Acinetobacter baumannii AB056]
 gi|301511782|ref|ZP_07237019.1| Thioesterase superfamily protein [Acinetobacter baumannii AB058]
 gi|301595304|ref|ZP_07240312.1| Thioesterase superfamily protein [Acinetobacter baumannii AB059]
 gi|332852184|ref|ZP_08433989.1| thioesterase family protein [Acinetobacter baumannii 6013150]
 gi|332868145|ref|ZP_08438030.1| thioesterase family protein [Acinetobacter baumannii 6013113]
 gi|169147618|emb|CAM85481.1| putative acyl-CoA thioester hydrolase [Acinetobacter baumannii AYE]
 gi|193078381|gb|ABO13352.2| hypothetical protein A1S_2947 [Acinetobacter baumannii ATCC 17978]
 gi|213057098|gb|ACJ42000.1| hypothetical protein AB57_3431 [Acinetobacter baumannii AB0057]
 gi|213987601|gb|ACJ57900.1| Thioesterase superfamily protein [Acinetobacter baumannii
           AB307-0294]
 gi|332729314|gb|EGJ60654.1| thioesterase family protein [Acinetobacter baumannii 6013150]
 gi|332733533|gb|EGJ64700.1| thioesterase family protein [Acinetobacter baumannii 6013113]
          Length = 140

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 71/122 (58%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G+L+L+   MP D N  G+VFGGWI+SQ+D+A  I A +  + R  T ++ ++ F  P++
Sbjct: 10  GILSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHAERFSRGRCATISINQMTFLVPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V  ++  YT+I K+G TS+ +  +VW    ++   +  +  E     VAVD KGN + I 
Sbjct: 70  VGFVISCYTKILKVGNTSIQMQIEVWDSHDDSREPI--RITEGVFTFVAVDVKGNKRQIP 127

Query: 151 TE 152
            E
Sbjct: 128 EE 129


>gi|157145584|ref|YP_001452903.1| acyl-CoA thioester hydrolase [Citrobacter koseri ATCC BAA-895]
 gi|157082789|gb|ABV12467.1| hypothetical protein CKO_01330 [Citrobacter koseri ATCC BAA-895]
          Length = 133

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 71/121 (58%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I+A ++   RVVT  V  + F +P+ 
Sbjct: 10  GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAHGRVVTVRVEGMSFLRPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  K G TSV+I  +VW   + AS  + Q  K  EA  + VAVD  G P+ 
Sbjct: 70  VGDVVCCYARCVKRGTTSVSINIEVWV-KKVASEPIGQRYKATEALFIYVAVDSDGKPRP 128

Query: 149 I 149
           +
Sbjct: 129 L 129


>gi|293611123|ref|ZP_06693422.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826775|gb|EFF85141.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325123452|gb|ADY82975.1| hypothetical protein BDGL_002389 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 138

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 71/122 (58%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G+L+L+   MP D N  G+VFGGWI+SQ+D+A  I A +  + R  T ++ ++ F  P++
Sbjct: 10  GILSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHAERFSRGRCATISINQMTFLVPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V  ++  YT+I K+G TS+ +  +VW    ++   +  +  E     VAVD KGN + I 
Sbjct: 70  VGFVISCYTKILKVGNTSIQMQIEVWDSHDDSREPI--RITEGVFTFVAVDVKGNKRQIP 127

Query: 151 TE 152
            E
Sbjct: 128 EE 129


>gi|299768766|ref|YP_003730792.1| Thioesterase superfamily protein [Acinetobacter sp. DR1]
 gi|298698854|gb|ADI89419.1| Thioesterase superfamily protein [Acinetobacter sp. DR1]
          Length = 138

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 71/122 (58%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G+L+L+   MP D N  G+VFGGWI+SQ+D+A  I A +  + R  T ++ ++ F  P++
Sbjct: 10  GILSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHAERFSRGRCATISINQMTFLVPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V  ++  YT+I K+G TS+ +  +VW    ++   +  +  E     VAVD KGN + I 
Sbjct: 70  VGFVISCYTKILKVGNTSIQMQIEVWDSHDDSREPI--RITEGVFTFVAVDVKGNKRQIP 127

Query: 151 TE 152
            E
Sbjct: 128 EE 129


>gi|269138874|ref|YP_003295575.1| thioesterase superfamily protein [Edwardsiella tarda EIB202]
 gi|267984535|gb|ACY84364.1| thioesterase superfamily protein [Edwardsiella tarda EIB202]
 gi|304558860|gb|ADM41524.1| Acyl-CoA thioesterase YciA [Edwardsiella tarda FL6-60]
          Length = 142

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 73/122 (59%), Gaps = 3/122 (2%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G L L+   MP D N +G++FGGWIMSQ+DI   I A ++ + RVVT AV  + F KP+
Sbjct: 9   AGELVLRTLAMPADTNANGDIFGGWIMSQMDIGGAILAKEIAEGRVVTVAVNAITFLKPV 68

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGNPK 147
            V D+V  Y    + G++S+T+  +VW   + AS  + Q+ C  EA    VAV++    +
Sbjct: 69  AVGDVVCCYAHCIRTGRSSITVNIEVWV-KKVASEPIGQRECVTEAVFTYVAVNDANKSR 127

Query: 148 SI 149
           ++
Sbjct: 128 AL 129


>gi|238751886|ref|ZP_04613372.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia rohdei ATCC
           43380]
 gi|238709866|gb|EEQ02098.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia rohdei ATCC
           43380]
          Length = 149

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 75/127 (59%), Gaps = 5/127 (3%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q   +G L L+   MP D N +G++FGGW+MSQ+DI   I+A ++ + RVVT  V  + F
Sbjct: 12  QALPNGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAQGRVVTVRVDGMTF 71

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ---KTCEATVVMVAVDE 142
            KP+ V D+V  Y +  K G++S+TI  +VW   +  SS+ +    +  EA    VAVD+
Sbjct: 72  LKPVAVGDVVCCYARCIKTGRSSITINIEVWV--KKVSSEPIGQRYRATEAVFTYVAVDD 129

Query: 143 KGNPKSI 149
            G  +++
Sbjct: 130 AGKSRAL 136


>gi|307547014|ref|YP_003899493.1| thioesterase superfamily protein [Halomonas elongata DSM 2581]
 gi|307219038|emb|CBV44308.1| thioesterase superfamily protein [Halomonas elongata DSM 2581]
          Length = 136

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 73/121 (60%), Gaps = 1/121 (0%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LTLK+     D NL G++ GGW++  +D A  + A +    R  T A+  + F  P++
Sbjct: 12  GQLTLKLVANRQDTNLHGDIPGGWLVGHMDQAAELAAGREAHGRTATVAIEAMDFLCPVR 71

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWT-CPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V  +V+I+T+IR+IG +S+ I  +VW+  P+    + L K  EA  VMVA+D+KG  +++
Sbjct: 72  VGSMVNIFTEIREIGHSSIKIDVEVWSRSPQERDPNELHKVTEARFVMVALDDKGRIRAV 131

Query: 150 R 150
           R
Sbjct: 132 R 132


>gi|221134176|ref|ZP_03560481.1| thioesterase superfamily protein [Glaciecola sp. HTCC2999]
          Length = 248

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 71/121 (58%), Gaps = 2/121 (1%)

Query: 24  VCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTEL 83
           + +   +G LT +   M  D N  G++FGGW++SQ+D+A GI A Q  + RVVT A+  +
Sbjct: 111 LSEKQPTGRLTTRTIAMHADTNPAGDIFGGWVLSQMDMAAGISAGQRAQGRVVTVALDGM 170

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEK 143
            F KP+ V D++ +YT I ++G++S+ +  + W   R A     +K  EA    VA+D +
Sbjct: 171 SFIKPVHVGDILGVYTNIVRVGRSSIDVKVECWV--RRARIGQREKVTEAIFKFVALDSE 228

Query: 144 G 144
           G
Sbjct: 229 G 229


>gi|171317320|ref|ZP_02906516.1| thioesterase superfamily protein [Burkholderia ambifaria MEX-5]
 gi|171097519|gb|EDT42357.1| thioesterase superfamily protein [Burkholderia ambifaria MEX-5]
          Length = 131

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P D N+ G+VFGGWIMSQ+DIA  I ASQ    RV T AV   +F++P+ V DL
Sbjct: 15  LRVVPQPHDANVHGDVFGGWIMSQVDIAGSIPASQRANGRVATVAVNSFVFKQPVFVGDL 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I + G TSVT+  +V+        +++ K  EAT+  VA      P+ +
Sbjct: 75  LSFYATITRTGNTSVTVDVEVYAQRMRLMGEIV-KVTEATLTYVATGPDRKPRQL 128


>gi|218768012|ref|YP_002342524.1| putative acyl-CoA hydrolase [Neisseria meningitidis Z2491]
 gi|121052020|emb|CAM08329.1| putative acyl-CoA hydrolase [Neisseria meningitidis Z2491]
 gi|319410260|emb|CBY90601.1| putative acyl-CoA thioester hydrolase [Neisseria meningitidis WUE
           2594]
          Length = 148

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 75/129 (58%), Gaps = 2/129 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           +    G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F
Sbjct: 8   RQRPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIARGRIVTVAVQEMNF 67

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEK 143
            +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++      EA    VA+D +
Sbjct: 68  IRPVKVGNVVCCYGHCVRVGNTSLQLKVEVWVKTLMNDCVTEDRHLVTEAVFTYVAIDAE 127

Query: 144 GNPKSIRTE 152
           GNP+ I  E
Sbjct: 128 GNPRPIPKE 136


>gi|212710716|ref|ZP_03318844.1| hypothetical protein PROVALCAL_01783 [Providencia alcalifaciens DSM
           30120]
 gi|212686413|gb|EEB45941.1| hypothetical protein PROVALCAL_01783 [Providencia alcalifaciens DSM
           30120]
          Length = 141

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 75/122 (61%), Gaps = 3/122 (2%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G L L+   MP+D N +G++FGGW+MSQ+DI   I A ++   RVVT AV  + F+KP+
Sbjct: 5   NGELVLRTLAMPSDTNANGDIFGGWLMSQMDIGGAILAKEIALGRVVTVAVNGIKFQKPV 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK--TCEATVVMVAVDEKGNPK 147
            V D+V  Y +  K GK+SVTI  +VW   + A+  V Q+    +A    VAV++   P+
Sbjct: 65  AVGDVVCCYARCLKTGKSSVTINIEVW-VKKVATHPVGQRYQATDAVFTYVAVNDDNTPR 123

Query: 148 SI 149
           ++
Sbjct: 124 AL 125


>gi|238794936|ref|ZP_04638534.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia intermedia
           ATCC 29909]
 gi|238725754|gb|EEQ17310.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia intermedia
           ATCC 29909]
          Length = 149

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 75/127 (59%), Gaps = 5/127 (3%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q   +G L L+   MP D N +G++FGGW+MSQ+DI   I+A ++ + RVVT  V  + F
Sbjct: 12  QSLPNGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAQGRVVTVRVDGMTF 71

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ---KTCEATVVMVAVDE 142
            KP+ V D+V  Y +  K G++S+TI  +VW   +  SS+ +    +  EA    VAVD+
Sbjct: 72  LKPVAVGDVVCCYARCIKTGRSSITINIEVWV--KKVSSEPIGQRYRATEAVFTYVAVDD 129

Query: 143 KGNPKSI 149
            G  +++
Sbjct: 130 AGKARAL 136


>gi|240014399|ref|ZP_04721312.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae DGI18]
 gi|240016831|ref|ZP_04723371.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae FA6140]
 gi|240120886|ref|ZP_04733848.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae PID24-1]
 gi|240125465|ref|ZP_04738351.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae SK-92-679]
 gi|268684059|ref|ZP_06150921.1| acyl-CoA hydrolase [Neisseria gonorrhoeae SK-92-679]
 gi|268624343|gb|EEZ56743.1| acyl-CoA hydrolase [Neisseria gonorrhoeae SK-92-679]
          Length = 148

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 75/129 (58%), Gaps = 2/129 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           +    G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F
Sbjct: 8   RQRPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIARGRIVTVAVQEMNF 67

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEK 143
            +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++      EA    VA+D +
Sbjct: 68  IRPVKVGNVVCCYGHCVRVGNTSLQLKVEVWVKTLMNDCVTEDRHLVTEAVFTYVAIDAE 127

Query: 144 GNPKSIRTE 152
           GNP+ I  E
Sbjct: 128 GNPRPIPKE 136


>gi|107023650|ref|YP_621977.1| thioesterase [Burkholderia cenocepacia AU 1054]
 gi|116690735|ref|YP_836358.1| thioesterase superfamily protein [Burkholderia cenocepacia HI2424]
 gi|170734077|ref|YP_001766024.1| thioesterase superfamily protein [Burkholderia cenocepacia MC0-3]
 gi|105893839|gb|ABF77004.1| thioesterase superfamily [Burkholderia cenocepacia AU 1054]
 gi|116648824|gb|ABK09465.1| thioesterase superfamily protein [Burkholderia cenocepacia HI2424]
 gi|169817319|gb|ACA91902.1| thioesterase superfamily protein [Burkholderia cenocepacia MC0-3]
          Length = 136

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P D N+ G+VFGGWIMSQ+DIA  I ASQ    RV T AV   +F++P+ V DL
Sbjct: 20  LRVVPQPHDANVHGDVFGGWIMSQVDIAGSIPASQRANGRVATVAVNSFVFKQPVFVGDL 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I + G TS+T+  +V+        +V+ K  EAT+  VA      P+ +
Sbjct: 80  LSFYATIMRTGNTSITVDVEVYAQRMRLMGEVV-KVTEATLTYVATGSDRKPRQL 133


>gi|59801445|ref|YP_208157.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae FA 1090]
 gi|239998695|ref|ZP_04718619.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae 35/02]
 gi|240081017|ref|ZP_04725560.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae FA19]
 gi|240112616|ref|ZP_04727106.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae MS11]
 gi|240115362|ref|ZP_04729424.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae PID18]
 gi|240117666|ref|ZP_04731728.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae PID1]
 gi|240123221|ref|ZP_04736177.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae PID332]
 gi|240127901|ref|ZP_04740562.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae SK-93-1035]
 gi|254493418|ref|ZP_05106589.1| acyl-CoA hydrolase [Neisseria gonorrhoeae 1291]
 gi|260440825|ref|ZP_05794641.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae DGI2]
 gi|268594547|ref|ZP_06128714.1| acyl CoA thioester hydrolase [Neisseria gonorrhoeae 35/02]
 gi|268597127|ref|ZP_06131294.1| acyl CoA thioester hydrolase [Neisseria gonorrhoeae FA19]
 gi|268598685|ref|ZP_06132852.1| acyl-CoA hydrolase [Neisseria gonorrhoeae MS11]
 gi|268601044|ref|ZP_06135211.1| acyl-CoA hydrolase [Neisseria gonorrhoeae PID18]
 gi|268603368|ref|ZP_06137535.1| acyl-CoA hydrolase [Neisseria gonorrhoeae PID1]
 gi|268681847|ref|ZP_06148709.1| acyl-CoA hydrolase [Neisseria gonorrhoeae PID332]
 gi|268686296|ref|ZP_06153158.1| acyl-CoA hydrolase [Neisseria gonorrhoeae SK-93-1035]
 gi|291044140|ref|ZP_06569856.1| acyl CoA thioester hydrolase [Neisseria gonorrhoeae DGI2]
 gi|293399310|ref|ZP_06643475.1| acyl-CoA hydrolase [Neisseria gonorrhoeae F62]
 gi|59718340|gb|AAW89745.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae FA 1090]
 gi|226512458|gb|EEH61803.1| acyl-CoA hydrolase [Neisseria gonorrhoeae 1291]
 gi|268547936|gb|EEZ43354.1| acyl CoA thioester hydrolase [Neisseria gonorrhoeae 35/02]
 gi|268550915|gb|EEZ45934.1| acyl CoA thioester hydrolase [Neisseria gonorrhoeae FA19]
 gi|268582816|gb|EEZ47492.1| acyl-CoA hydrolase [Neisseria gonorrhoeae MS11]
 gi|268585175|gb|EEZ49851.1| acyl-CoA hydrolase [Neisseria gonorrhoeae PID18]
 gi|268587499|gb|EEZ52175.1| acyl-CoA hydrolase [Neisseria gonorrhoeae PID1]
 gi|268622131|gb|EEZ54531.1| acyl-CoA hydrolase [Neisseria gonorrhoeae PID332]
 gi|268626580|gb|EEZ58980.1| acyl-CoA hydrolase [Neisseria gonorrhoeae SK-93-1035]
 gi|291012603|gb|EFE04592.1| acyl CoA thioester hydrolase [Neisseria gonorrhoeae DGI2]
 gi|291610724|gb|EFF39834.1| acyl-CoA hydrolase [Neisseria gonorrhoeae F62]
          Length = 148

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 75/129 (58%), Gaps = 2/129 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           +    G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F
Sbjct: 8   RQRPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIARGRIVTVAVQEMNF 67

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEK 143
            +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++      EA    VA+D +
Sbjct: 68  IRPVKVGNVVCCYGHCVRVGNTSLQLKVEVWVKTLMNDCVTEDRHLVTEAVFTYVAIDAE 127

Query: 144 GNPKSIRTE 152
           GNP+ I  E
Sbjct: 128 GNPRPIPKE 136


>gi|238788432|ref|ZP_04632225.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia
           frederiksenii ATCC 33641]
 gi|238723345|gb|EEQ14992.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia
           frederiksenii ATCC 33641]
          Length = 149

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 75/127 (59%), Gaps = 5/127 (3%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q   +G L L+   MP D N +G++FGGW+MSQ+DI   I+A ++ + RVVT  V  + F
Sbjct: 12  QSLPNGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAQGRVVTVRVDGMTF 71

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDE 142
            KP+ V D+V  Y +  K G++S+TI  +VW   +  SS+ +    +  EA    VAVD+
Sbjct: 72  LKPVAVGDVVCCYARCIKTGRSSITINIEVWV--KKVSSEPIGQRYRATEAVFTYVAVDD 129

Query: 143 KGNPKSI 149
            G  +++
Sbjct: 130 AGKARAL 136


>gi|209884364|ref|YP_002288221.1| acyl-CoA thioester hydrolase YciA [Oligotropha carboxidovorans OM5]
 gi|209872560|gb|ACI92356.1| acyl-CoA thioester hydrolase YciA [Oligotropha carboxidovorans OM5]
          Length = 146

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 79/136 (58%), Gaps = 5/136 (3%)

Query: 16  ITKKEVLMVCQMHSS-GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCR 74
           +T  EV+   Q  S  G L ++   MP D N +G++FGGW++SQ+D+A  + A +    R
Sbjct: 6   VTGHEVVHPGQGCSPQGELCVRTIAMPADTNQNGDIFGGWLLSQMDLAGSVFAYKTTLAR 65

Query: 75  VVTKAVTELLFEKPIQVSDLVHIY-TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEA 133
            VT A+  + F KP+ V DLV +Y TQ+R +G+TS+T+  + W   RN +  +L    + 
Sbjct: 66  NVTVAIEAMTFRKPVFVGDLVSVYGTQVR-VGRTSITVRVEAWVQRRNETDIIL--VTDG 122

Query: 134 TVVMVAVDEKGNPKSI 149
               VA+D+ G P+ I
Sbjct: 123 NFTYVAIDDSGKPQPI 138


>gi|253989522|ref|YP_003040878.1| acyl-CoA thioester hydrolase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780972|emb|CAQ84134.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 143

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/129 (39%), Positives = 72/129 (55%), Gaps = 3/129 (2%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  Q   +G L L+   MP D N +G++FGGW+MSQ+DI   I A ++ + RVVT  V  
Sbjct: 1   MTQQQLPNGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAEGRVVTVRVNG 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAV 140
           + F KP+ V D+V  Y    K G +S+TI  +VW   + AS  V Q  +  EA    VAV
Sbjct: 61  ITFLKPVAVGDVVCCYAHCLKTGNSSITINIEVWV-KKVASEPVGQRYRATEAIFTYVAV 119

Query: 141 DEKGNPKSI 149
           +E   P+ +
Sbjct: 120 NEDNTPRRL 128


>gi|206559283|ref|YP_002230044.1| thioesterase superfamily protein [Burkholderia cenocepacia J2315]
 gi|254247252|ref|ZP_04940573.1| Thioesterase superfamily [Burkholderia cenocepacia PC184]
 gi|124872028|gb|EAY63744.1| Thioesterase superfamily [Burkholderia cenocepacia PC184]
 gi|198035321|emb|CAR51196.1| thioesterase superfamily protein [Burkholderia cenocepacia J2315]
          Length = 136

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P D N+ G+VFGGWIMSQ+DIA  I ASQ    RV T AV   +F++P+ V DL
Sbjct: 20  LRVVPQPHDANVHGDVFGGWIMSQVDIAGSIPASQRANGRVATVAVNSFVFKQPVFVGDL 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I + G TS+T+  +V+        +V+ K  EAT+  VA      P+ +
Sbjct: 80  LSFYATIMRTGNTSITVDVEVYAQRMRLMGEVV-KVTEATLTYVATGPDRKPRQL 133


>gi|254804807|ref|YP_003083028.1| putative acyl-CoA thioester hydrolase [Neisseria meningitidis
           alpha14]
 gi|261400214|ref|ZP_05986339.1| acyl-CoA thioester hydrolase YciA [Neisseria lactamica ATCC 23970]
 gi|296314536|ref|ZP_06864477.1| acyl-CoA thioester hydrolase YciA [Neisseria polysaccharea ATCC
           43768]
 gi|304387776|ref|ZP_07369954.1| acyl-CoA thioester hydrolase YciA [Neisseria meningitidis ATCC
           13091]
 gi|313668634|ref|YP_004048918.1| acyl-CoA hydrolase [Neisseria lactamica ST-640]
 gi|254668349|emb|CBA05386.1| putative acyl-CoA thioester hydrolase [Neisseria meningitidis
           alpha14]
 gi|269210224|gb|EEZ76679.1| acyl-CoA thioester hydrolase YciA [Neisseria lactamica ATCC 23970]
 gi|296838704|gb|EFH22642.1| acyl-CoA thioester hydrolase YciA [Neisseria polysaccharea ATCC
           43768]
 gi|304338187|gb|EFM04319.1| acyl-CoA thioester hydrolase YciA [Neisseria meningitidis ATCC
           13091]
 gi|309379464|emb|CBX22031.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313006096|emb|CBN87557.1| putative acyl-CoA hydrolase [Neisseria lactamica 020-06]
 gi|325140184|gb|EGC62711.1| thioesterase family protein [Neisseria meningitidis CU385]
 gi|325203998|gb|ADY99451.1| thioesterase family protein [Neisseria meningitidis M01-240355]
 gi|325207961|gb|ADZ03413.1| thioesterase family protein [Neisseria meningitidis NZ-05/33]
          Length = 148

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 75/129 (58%), Gaps = 2/129 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           +    G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F
Sbjct: 8   RQRPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIARGRIVTVAVQEMNF 67

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEK 143
            +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++      EA    VA+D +
Sbjct: 68  IRPVKVGNVVCCYGHCVRVGNTSLQLKVEVWVKTLMNDCVTEDRHLVTEAVFTYVAIDAE 127

Query: 144 GNPKSIRTE 152
           GNP+ I  E
Sbjct: 128 GNPRPIPKE 136


>gi|170699182|ref|ZP_02890235.1| thioesterase superfamily protein [Burkholderia ambifaria IOP40-10]
 gi|170135907|gb|EDT04182.1| thioesterase superfamily protein [Burkholderia ambifaria IOP40-10]
          Length = 136

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P D N+ G+VFGGWIMSQ+DIA  I ASQ    RV T AV   +F++P+ V DL
Sbjct: 20  LRVVPQPHDANVHGDVFGGWIMSQVDIAGSIPASQRANGRVATVAVNSFVFKQPVFVGDL 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I + G TSVT+  +V+        +++ K  EAT+  VA      P+ +
Sbjct: 80  LSFYATITRTGNTSVTVDVEVYAQRMRLMGEIV-KVTEATLTYVATGADRKPRQL 133


>gi|291617629|ref|YP_003520371.1| YciA [Pantoea ananatis LMG 20103]
 gi|291152659|gb|ADD77243.1| YciA [Pantoea ananatis LMG 20103]
 gi|327394057|dbj|BAK11479.1| putative acyl-CoA thioester hydrolase bbp254 YciA [Pantoea ananatis
           AJ13355]
          Length = 140

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 73/122 (59%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + ++   MP D N +G++FGGW+MSQ+D+   I+A ++ + RVVT  V  + F KP+ 
Sbjct: 10  GEMVMRTLAMPADTNANGDIFGGWLMSQMDMGGAIQAKEIAEGRVVTVRVDGMTFLKPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKT---CEATVVMVAVDEKGNPK 147
           V D+V  Y    + G +S+TI   VW   +  SS+ + +T    EA  + VAVD +G+P+
Sbjct: 70  VGDVVSCYAHCIRTGNSSMTINVQVWI--KKVSSEPIGQTYCATEAVFIYVAVDNEGHPR 127

Query: 148 SI 149
            +
Sbjct: 128 QL 129


>gi|317163979|gb|ADV07520.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 189

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 75/129 (58%), Gaps = 2/129 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           +    G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F
Sbjct: 49  RQRPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIARGRIVTVAVQEMNF 108

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEK 143
            +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++      EA    VA+D +
Sbjct: 109 IRPVKVGNVVCCYGHCVRVGNTSLQLKVEVWVKTLMNDCVTEDRHLVTEAVFTYVAIDAE 168

Query: 144 GNPKSIRTE 152
           GNP+ I  E
Sbjct: 169 GNPRPIPKE 177


>gi|325128057|gb|EGC50953.1| thioesterase family protein [Neisseria meningitidis N1568]
          Length = 148

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 75/129 (58%), Gaps = 2/129 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           +    G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F
Sbjct: 8   RQRPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIARGRIVTVAVQEMNF 67

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEK 143
            +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++      EA    VA+D +
Sbjct: 68  IRPVKVGNVVCCYGHCVRVGNTSLQLKIEVWVKTLMNDCVTEDRHLVTEAVFTYVAIDAE 127

Query: 144 GNPKSIRTE 152
           GNP+ I  E
Sbjct: 128 GNPRPIPKE 136


>gi|194098259|ref|YP_002001315.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae NCCP11945]
 gi|193933549|gb|ACF29373.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae NCCP11945]
          Length = 189

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 75/129 (58%), Gaps = 2/129 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           +    G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F
Sbjct: 49  RQRPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIARGRIVTVAVQEMNF 108

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEK 143
            +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++      EA    VA+D +
Sbjct: 109 IRPVKVGNVVCCYGHCVRVGNTSLQLKVEVWVKTLMNDCVTEDRHLVTEAVFTYVAIDAE 168

Query: 144 GNPKSIRTE 152
           GNP+ I  E
Sbjct: 169 GNPRPIPKE 177


>gi|322514713|ref|ZP_08067739.1| thioesterase [Actinobacillus ureae ATCC 25976]
 gi|322119308|gb|EFX91424.1| thioesterase [Actinobacillus ureae ATCC 25976]
          Length = 155

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 72/125 (57%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
              G L L+   MP+D N +G++FGGWIMSQ+D+   I A +L K RVVT  V +++F  
Sbjct: 10  EPEGKLILRTLAMPSDTNANGDIFGGWIMSQMDLGGAILAKELAKGRVVTVTVDKMIFHL 69

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           PI V D+V  Y  + K+G++S+ +  +V+       +    +  EA    VAVD++G  +
Sbjct: 70  PISVGDVVCCYGTLVKVGRSSMQVKVEVFIKQVYEGARERFRVTEALFTYVAVDKEGKSR 129

Query: 148 SIRTE 152
           +I  E
Sbjct: 130 AIPRE 134


>gi|161523764|ref|YP_001578776.1| thioesterase superfamily protein [Burkholderia multivorans ATCC
           17616]
 gi|160341193|gb|ABX14279.1| thioesterase superfamily protein [Burkholderia multivorans ATCC
           17616]
          Length = 166

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P D N+ G+VFGGWIMSQ+DIA  I ASQ    RV T AV   +F++P+ V DL
Sbjct: 50  LRVVPQPHDANVHGDVFGGWIMSQVDIAGSIPASQRANGRVATVAVNSFVFKQPVFVGDL 109

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I + G TSVT+  +V+        +V+ K  EAT+  VA      P+ +
Sbjct: 110 LSFYATITRTGNTSVTVDVEVYAQRMRLMGEVV-KVTEATLTYVATGPDRKPRPL 163


>gi|323143188|ref|ZP_08077884.1| thioesterase family protein [Succinatimonas hippei YIT 12066]
 gi|322417029|gb|EFY07667.1| thioesterase family protein [Succinatimonas hippei YIT 12066]
          Length = 158

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/120 (40%), Positives = 67/120 (55%), Gaps = 1/120 (0%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N  G++FGGWIMSQ+DI+  I A  +   RVVT AV  + F KP+ 
Sbjct: 13  GNLLLRTLAMPGDANPAGDIFGGWIMSQMDISGAILARDIAGGRVVTVAVDAMSFLKPVS 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCP-RNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V D+V  Y +   IG TS+ I  ++W      A +D      EA+   VAVD+ G P+ +
Sbjct: 73  VGDVVCCYGRCIHIGHTSLKIKLEIWVKKFHEAGNDSRNMVTEASFTYVAVDDNGKPRPL 132


>gi|167585496|ref|ZP_02377884.1| thioesterase superfamily protein [Burkholderia ubonensis Bu]
          Length = 132

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 67/115 (58%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P+D N+ G+VFGGWIMSQ+DIA  I ASQ    RV T AV   +F++P+ V DL
Sbjct: 15  LRVVPQPSDANVHGDVFGGWIMSQVDIAGSIPASQRANGRVATVAVNSFVFKQPVFVGDL 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  + + G TSVT+   V+      + +++ K  EAT+  VA      P+ +
Sbjct: 75  LSFYATVTRTGNTSVTVDVVVYAQRMRLAGEIV-KVTEATLTYVATGPDRKPRPL 128


>gi|283478254|emb|CAY74170.1| putative acyl-CoA thioester hydrolase [Erwinia pyrifoliae DSM
           12163]
          Length = 155

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 79/134 (58%), Gaps = 4/134 (2%)

Query: 19  KEVLMVCQMHSS-GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVT 77
           KE +M  Q+ +  G + L+   MP D N +G++FGGW+MSQ+D+   I A ++   RVVT
Sbjct: 10  KEQIMSKQLRTPQGEMVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAGGRVVT 69

Query: 78  KAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATV 135
             V  + F KP+ V D+V  + +  + G +SVT+  +VW   + +S  + Q+ C  EA  
Sbjct: 70  VRVDGMTFMKPVAVGDVVCCHARCVRTGTSSVTVNIEVW-IKKVSSEPIGQRYCTTEAVF 128

Query: 136 VMVAVDEKGNPKSI 149
           + VAVD +G P+ +
Sbjct: 129 IYVAVDSQGKPRPL 142


>gi|121634728|ref|YP_974973.1| putative acyl-CoA hydrolase [Neisseria meningitidis FAM18]
 gi|120866434|emb|CAM10180.1| putative acyl-CoA hydrolase [Neisseria meningitidis FAM18]
 gi|261392725|emb|CAX50300.1| putative acyl-CoA thioester hydrolase [Neisseria meningitidis 8013]
 gi|325132370|gb|EGC55063.1| thioesterase family protein [Neisseria meningitidis M6190]
 gi|325138449|gb|EGC61015.1| thioesterase family protein [Neisseria meningitidis ES14902]
 gi|325142200|gb|EGC64622.1| thioesterase family protein [Neisseria meningitidis 961-5945]
 gi|325198158|gb|ADY93614.1| thioesterase family protein [Neisseria meningitidis G2136]
          Length = 148

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 75/129 (58%), Gaps = 2/129 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           +    G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F
Sbjct: 8   RQRPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIAQGRIVTVAVQEMNF 67

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEK 143
            +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++      EA    VA+D +
Sbjct: 68  IRPVKVGNVVCCYGHCVRVGNTSLQLKVEVWVKTLMNDCVTEDRHLVTEAVFTYVAIDAE 127

Query: 144 GNPKSIRTE 152
           GNP+ I  E
Sbjct: 128 GNPRPIPKE 136


>gi|78067511|ref|YP_370280.1| thioesterase superfamily protein [Burkholderia sp. 383]
 gi|77968256|gb|ABB09636.1| Thioesterase superfamily [Burkholderia sp. 383]
          Length = 136

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P D N+ G+VFGGWIMSQ+DIA  I ASQ    RV T AV   +F++P+ V DL
Sbjct: 20  LRVVPQPHDANVHGDVFGGWIMSQVDIAGSIPASQRANGRVATVAVNSFVFKQPVFVGDL 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I + G TS+T+  +V+        +V+ K  EAT+  VA      P+ +
Sbjct: 80  LSFYATITRTGNTSITVDVEVYAQRMRLMGEVV-KVTEATLTYVATGTDRKPRQL 133


>gi|317491905|ref|ZP_07950340.1| thioesterase superfamily protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920339|gb|EFV41663.1| thioesterase superfamily protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 142

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 74/122 (60%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+DI   I A ++ + RVVT AV  + F KP+ 
Sbjct: 10  GELVLRTLAMPADTNANGDIFGGWIMSQMDIGGAILAKEVAEGRVVTVAVNGITFLKPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSD-VLQKTC--EATVVMVAVDEKGNPK 147
           V D+V  Y +  + G++S+T+  +VW   +  SSD + Q+ C  EA    VAVD+    +
Sbjct: 70  VGDVVCCYARCIRTGRSSITVNIEVWV--KKVSSDPIGQRYCVTEAVFTYVAVDDDNKSR 127

Query: 148 SI 149
           ++
Sbjct: 128 TL 129


>gi|310767761|gb|ADP12711.1| putative acyl-CoA thioester hydrolase [Erwinia sp. Ejp617]
          Length = 155

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 79/134 (58%), Gaps = 4/134 (2%)

Query: 19  KEVLMVCQMHSS-GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVT 77
           KE +M  Q+ +  G + L+   MP D N +G++FGGW+MSQ+D+   I A ++   RVVT
Sbjct: 10  KEQIMSEQLRTPQGEMVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAGGRVVT 69

Query: 78  KAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATV 135
             V  + F KP+ V D+V  + +  + G +SVT+  +VW   + +S  + Q+ C  EA  
Sbjct: 70  VRVDGMTFMKPVAVGDVVCCHARCVRTGTSSVTVNIEVW-IKKVSSEPIGQRYCTTEAVF 128

Query: 136 VMVAVDEKGNPKSI 149
           + VAVD +G P+ +
Sbjct: 129 IYVAVDSQGKPRPL 142


>gi|50121242|ref|YP_050409.1| acyl-CoA thioester hydrolase [Pectobacterium atrosepticum SCRI1043]
 gi|49611768|emb|CAG75217.1| putative acyl-CoA thioester hydrolase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 140

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 72/122 (59%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+D+   I A ++ + RVVT  V  + F KP+ 
Sbjct: 10  GELVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAEGRVVTVRVDGMSFLKPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEKGNPK 147
           V D+V  Y +  + G++S+ +  +VW   +  SS+ +    +  EA    VAVDE+G P+
Sbjct: 70  VGDVVCCYARCLRTGRSSINVNVEVWV--KKVSSEPIGQRYRATEALFTYVAVDEEGQPR 127

Query: 148 SI 149
            +
Sbjct: 128 EL 129


>gi|171315788|ref|ZP_02905020.1| thioesterase superfamily protein [Burkholderia ambifaria MEX-5]
 gi|171099087|gb|EDT43867.1| thioesterase superfamily protein [Burkholderia ambifaria MEX-5]
          Length = 133

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P+  N+ G+VFGGWIMS +DIA  I ASQ    RVVT AV    F +P+ + DL
Sbjct: 19  LRVVPQPSSANVHGDVFGGWIMSHVDIAGSIPASQRANGRVVTVAVNSFAFRQPVFIGDL 78

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y +I   G TSVT+  +V+   R   ++V+ K  EAT+  VA      P+ +
Sbjct: 79  LSFYAKIVHEGNTSVTVNVEVF-AQRIGLNEVIVKVTEATLTFVATGADRAPRKL 132


>gi|161869835|ref|YP_001599004.1| acyl CoA thioester hydrolase family protein [Neisseria meningitidis
           053442]
 gi|161595388|gb|ABX73048.1| acyl CoA thioester hydrolase family protein [Neisseria meningitidis
           053442]
          Length = 148

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 75/129 (58%), Gaps = 2/129 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           +    G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F
Sbjct: 8   RQRPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIARGRIVTVAVQEMNF 67

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEK 143
            +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++      EA    VA+D +
Sbjct: 68  IRPVKVGNVVCCYGHCVRVGNTSLQLKIEVWVKTLMNDCVTEDRYLVTEAVFTYVAIDAE 127

Query: 144 GNPKSIRTE 152
           GNP+ I  E
Sbjct: 128 GNPRPIPKE 136


>gi|115352818|ref|YP_774657.1| thioesterase superfamily protein [Burkholderia ambifaria AMMD]
 gi|115282806|gb|ABI88323.1| thioesterase superfamily protein [Burkholderia ambifaria AMMD]
          Length = 136

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P D N+ G+VFGGWIMSQ+DIA  I ASQ    RV T AV   +F++P+ V DL
Sbjct: 20  LRVVPQPHDANVHGDVFGGWIMSQVDIAGSIPASQRANGRVATVAVNSFVFKQPVFVGDL 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I + G TSVT+  +V+        +++ K  EAT+  VA      P+ +
Sbjct: 80  LSFYATIIRTGNTSVTVDVEVYAQRMRLMGEIV-KVTEATLTYVATGPDRKPRQL 133


>gi|197285213|ref|YP_002151085.1| acyl-CoA thioester hydrolase [Proteus mirabilis HI4320]
 gi|227355639|ref|ZP_03840033.1| acyl-CoA thioester hydrolase [Proteus mirabilis ATCC 29906]
 gi|194682700|emb|CAR42863.1| putative acyl-CoA thioester hydrolase [Proteus mirabilis HI4320]
 gi|227164246|gb|EEI49139.1| acyl-CoA thioester hydrolase [Proteus mirabilis ATCC 29906]
          Length = 143

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 50/126 (39%), Positives = 73/126 (57%), Gaps = 3/126 (2%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q   +G L L+   MP D N +G++FGGWIMSQ+DI   I A ++   RVVT +VT + F
Sbjct: 5   QSLPNGELVLRTLAMPADTNANGDIFGGWIMSQMDIGGAILAKEIALGRVVTVSVTGITF 64

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEK 143
            KP+ V D+V  Y +  K G +S+T+  +VW   + A+  V Q  +  EA    VAVDE 
Sbjct: 65  LKPVAVGDVVCCYARCLKTGNSSITVNIEVW-VKKVATEPVGQRYRATEAVFTYVAVDEN 123

Query: 144 GNPKSI 149
            + + +
Sbjct: 124 NSARRL 129


>gi|238797316|ref|ZP_04640816.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia mollaretii
           ATCC 43969]
 gi|238718747|gb|EEQ10563.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia mollaretii
           ATCC 43969]
          Length = 149

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 73/127 (57%), Gaps = 5/127 (3%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q   +G L L+   MP D N +G++FGGW+MSQ+DI   I+A ++   RVVT  V  + F
Sbjct: 12  QSLPNGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAHGRVVTVRVDGMTF 71

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ---KTCEATVVMVAVDE 142
            KP+ V D+V  Y +  K G++S+TI  +VW   +  SS+ +    +  EA    VAVD+
Sbjct: 72  LKPVAVGDVVCCYARCIKTGRSSITINIEVWV--KKVSSEPIGQRYRATEAVFTYVAVDD 129

Query: 143 KGNPKSI 149
            G  + +
Sbjct: 130 AGQARGL 136


>gi|332161889|ref|YP_004298466.1| putative acyl-CoA thioester hydrolase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|318605596|emb|CBY27094.1| acyl-CoA thioesterase YciA, involved in membrane biogenesis
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325666119|gb|ADZ42763.1| putative acyl-CoA thioester hydrolase [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330859714|emb|CBX70049.1| acyl-CoA thioester hydrolase yciA [Yersinia enterocolitica W22703]
          Length = 156

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 76/127 (59%), Gaps = 5/127 (3%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q+  +G L L+   MP D N +G++FGGW+MSQ+DI   I+A ++ + RVVT  V  + F
Sbjct: 19  QVLPNGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAQGRVVTVRVDGMTF 78

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ---KTCEATVVMVAVDE 142
            KP+ V D+V  Y +  + G++S+TI  +VW   +  SS+ +    K  EA    VAVD+
Sbjct: 79  LKPVAVGDVVCCYARCIRSGRSSITINIEVWV--KKVSSEPIGQRYKATEAVFTYVAVDD 136

Query: 143 KGNPKSI 149
            G  +++
Sbjct: 137 IGKARAL 143


>gi|172061674|ref|YP_001809326.1| thioesterase superfamily protein [Burkholderia ambifaria MC40-6]
 gi|171994191|gb|ACB65110.1| thioesterase superfamily protein [Burkholderia ambifaria MC40-6]
          Length = 131

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P D N+ G+VFGGWIMSQ+DIA  I ASQ    RV T AV   +F++P+ V DL
Sbjct: 15  LRVVPQPHDANVHGDVFGGWIMSQVDIAGSIPASQRANGRVATVAVNSFVFKQPVFVGDL 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I + G TSVT+  +V+        +++ K  EAT+  VA      P+ +
Sbjct: 75  LSFYATIIRTGNTSVTVDVEVYAQRMRLMGEIV-KVTEATLTYVATGPDRKPRQL 128


>gi|293395918|ref|ZP_06640199.1| acyl-CoA thioester hydrolase YciA [Serratia odorifera DSM 4582]
 gi|291421416|gb|EFE94664.1| acyl-CoA thioester hydrolase YciA [Serratia odorifera DSM 4582]
          Length = 124

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 72/112 (64%), Gaps = 3/112 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N +G++FGGW+MSQ+DI   I+A ++ + RVVT  V  + F KP+ V D+V  Y 
Sbjct: 1   MPADTNANGDIFGGWLMSQMDIGGAIQAKEIAEGRVVTVRVDGMTFLKPVAVGDVVCCYA 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKSI 149
           Q  + G++S+TI  +VW   + +S+ + Q  +  EA    VAVD++GN +++
Sbjct: 61  QCIRTGRSSITINVEVWV-KKVSSAPIGQRYRATEAVFTYVAVDDEGNSRAL 111


>gi|33152729|ref|NP_874082.1| putative acyl CoA thioester hydrolase [Haemophilus ducreyi 35000HP]
 gi|33148953|gb|AAP96471.1| putative acyl CoA thioester hydrolase [Haemophilus ducreyi 35000HP]
          Length = 156

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 71/122 (58%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
             SG L L+   MP+D N +G++FGGWIMSQ+D+   I A ++ K RVVT  V +++F +
Sbjct: 9   QPSGKLLLRTLAMPSDANANGDIFGGWIMSQMDLGGAILAKEVAKGRVVTVTVDKMIFHR 68

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           PI V D+V  Y  + K+G++S+ +  +++       S    +  EA    VA+D  G  +
Sbjct: 69  PISVGDVVCCYGSVVKVGRSSMQVKVEIFIKQVYDGSRERFRVTEALFTYVAIDNIGKSR 128

Query: 148 SI 149
           +I
Sbjct: 129 AI 130


>gi|261343633|ref|ZP_05971278.1| acyl-CoA thioester hydrolase YciA [Providencia rustigianii DSM
           4541]
 gi|282568016|gb|EFB73551.1| acyl-CoA thioester hydrolase YciA [Providencia rustigianii DSM
           4541]
          Length = 139

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 74/122 (60%), Gaps = 3/122 (2%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G L L+   MP+D N +G++FGGW+MSQ+DI   I A ++   RVVT AV  + F+KP+
Sbjct: 5   NGELVLRTLAMPSDTNANGDIFGGWLMSQMDIGGAILAKEIALGRVVTVAVNGIKFQKPV 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK--TCEATVVMVAVDEKGNPK 147
            V D+V  Y +  K GK+S+TI  +VW   + A+  V Q+    +A    VAV++   P+
Sbjct: 65  AVGDVVCCYARCLKTGKSSITINIEVWV-KKVATHPVGQRYQATDAVFTYVAVNDDNTPR 123

Query: 148 SI 149
            +
Sbjct: 124 PL 125


>gi|194451180|ref|YP_002045782.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205358998|ref|ZP_02666247.2| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205360301|ref|ZP_02682015.2| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|194409484|gb|ACF69703.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|205339488|gb|EDZ26252.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205351281|gb|EDZ37912.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 130

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 70/121 (57%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ 
Sbjct: 7   GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVA 66

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  K G TS++I  +VW   + AS  + Q  K  EA  + VAVD  G P+ 
Sbjct: 67  VGDVVCCYARCVKRGTTSISINIEVWV-KKVASEPIGQRYKATEALFIYVAVDPDGKPRP 125

Query: 149 I 149
           +
Sbjct: 126 L 126


>gi|254671162|emb|CBA08245.1| putative acyl-CoA thioester hydrolase [Neisseria meningitidis
           alpha153]
          Length = 157

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 75/129 (58%), Gaps = 2/129 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           +    G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F
Sbjct: 8   RQRPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIARGRIVTVAVQEMNF 67

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEK 143
            +P++V ++V  Y    ++G TS+ +  +VW  T   +  ++      EA    VA+D +
Sbjct: 68  IRPVKVGNVVCCYGHCVRVGNTSLQLKIEVWVKTLMNDCVTEDRYLVTEAVFTYVAIDAE 127

Query: 144 GNPKSIRTE 152
           GNP+ I  E
Sbjct: 128 GNPRPIPKE 136


>gi|146311932|ref|YP_001177006.1| acyl-CoA thioester hydrolase [Enterobacter sp. 638]
 gi|145318808|gb|ABP60955.1| thioesterase superfamily protein [Enterobacter sp. 638]
          Length = 132

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 70/121 (57%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+D+   I A ++   RVVT  V  + F +P+ 
Sbjct: 10  GELVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAHGRVVTVRVDGMTFLRPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  K G TSV+I  +VW   + AS  + Q  K  EA  + VAVD  G P+ 
Sbjct: 70  VGDVVCCYARCVKRGNTSVSINIEVWV-KKVASEPIGQRYKATEALFIYVAVDNDGKPRQ 128

Query: 149 I 149
           +
Sbjct: 129 L 129


>gi|16760145|ref|NP_455762.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16765080|ref|NP_460695.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29142084|ref|NP_805426.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56413339|ref|YP_150414.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62180302|ref|YP_216719.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|197362264|ref|YP_002141901.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|205352591|ref|YP_002226392.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207856752|ref|YP_002243403.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224583772|ref|YP_002637570.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|60416299|sp|P0A1A1|YCIA_SALTY RecName: Full=Acyl-CoA thioester hydrolase YciA
 gi|60416300|sp|P0A1A2|YCIA_SALTI RecName: Full=Acyl-CoA thioester hydrolase YciA
 gi|25349141|pir||AI0651 probable acyl-coA hydrolase STY1315 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16420267|gb|AAL20654.1| putative Acyl-CoA hydrolase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16502439|emb|CAD08396.1| putative acyl-coA hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137713|gb|AAO69275.1| putative acyl-coA hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56127596|gb|AAV77102.1| putative acyl-coA hydrolase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62127935|gb|AAX65638.1| putative Acyl-CoA hydrolase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|197093741|emb|CAR59214.1| putative acyl-coA hydrolase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|205272372|emb|CAR37252.1| putative acyl-coA hydrolase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206708555|emb|CAR32876.1| putative acyl-coA hydrolase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224468299|gb|ACN46129.1| putative Acyl-CoA hydrolase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261246925|emb|CBG24742.1| putative Acyl-CoA hydrolase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267993681|gb|ACY88566.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301158263|emb|CBW17762.1| putative acyl-coA hydrolase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|320085765|emb|CBY95541.1| putative acyl-CoA thioester hydrolase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322714776|gb|EFZ06347.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323130008|gb|ADX17438.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326623153|gb|EGE29498.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326627654|gb|EGE33997.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332988625|gb|AEF07608.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 133

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 70/121 (57%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ 
Sbjct: 10  GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  K G TS++I  +VW   + AS  + Q  K  EA  + VAVD  G P+ 
Sbjct: 70  VGDVVCCYARCVKRGTTSISINIEVWV-KKVASEPIGQRYKATEALFIYVAVDPDGKPRP 128

Query: 149 I 149
           +
Sbjct: 129 L 129


>gi|161613774|ref|YP_001587739.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|194442286|ref|YP_002040989.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194472755|ref|ZP_03078739.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194737579|ref|YP_002114768.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195873182|ref|ZP_02696721.2| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197250649|ref|YP_002146291.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197261646|ref|ZP_03161720.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197300996|ref|ZP_02662847.2| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|198242033|ref|YP_002215406.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389995|ref|ZP_03216606.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204927866|ref|ZP_03219067.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205357405|ref|ZP_02347456.2| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205358090|ref|ZP_02575732.2| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205358286|ref|ZP_02655233.2| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205359683|ref|ZP_02831559.2| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|213163087|ref|ZP_03348797.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213424450|ref|ZP_03357263.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213581942|ref|ZP_03363768.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213622653|ref|ZP_03375436.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213855210|ref|ZP_03383450.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|238911873|ref|ZP_04655710.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289810355|ref|ZP_06540984.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|289829075|ref|ZP_06546755.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|161363138|gb|ABX66906.1| hypothetical protein SPAB_01508 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194400949|gb|ACF61171.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194459119|gb|EDX47958.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194713081|gb|ACF92302.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195633911|gb|EDX52263.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197214352|gb|ACH51749.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197239901|gb|EDY22521.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197289209|gb|EDY28576.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197936549|gb|ACH73882.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199602440|gb|EDZ00986.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204323208|gb|EDZ08404.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205321925|gb|EDZ09764.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205327509|gb|EDZ14273.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205335346|gb|EDZ22110.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205343748|gb|EDZ30512.1| acyl-CoA thioester hydrolase YciA [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|312912727|dbj|BAJ36701.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321224366|gb|EFX49429.1| Acyl-CoA thioesterase YciA, involved in membrane biogenesis
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322614993|gb|EFY11918.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322621412|gb|EFY18266.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322623245|gb|EFY20087.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322628535|gb|EFY25323.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633699|gb|EFY30439.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322638492|gb|EFY35187.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322640837|gb|EFY37486.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322645298|gb|EFY41826.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322651818|gb|EFY48190.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322654284|gb|EFY50606.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659249|gb|EFY55497.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322662748|gb|EFY58955.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322667640|gb|EFY63800.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671945|gb|EFY68066.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322677008|gb|EFY73072.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322680329|gb|EFY76368.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685241|gb|EFY81237.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323195448|gb|EFZ80627.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199300|gb|EFZ84394.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323204758|gb|EFZ89754.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323205945|gb|EFZ90908.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323217270|gb|EGA01991.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323220794|gb|EGA05233.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323227092|gb|EGA11271.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323232134|gb|EGA16241.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323234661|gb|EGA18748.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238113|gb|EGA22172.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323243282|gb|EGA27301.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323247563|gb|EGA31515.1| acyl-CoA esterase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323253802|gb|EGA37628.1| acyl-CoA esterase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323255928|gb|EGA39671.1| acyl-CoA esterase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323260301|gb|EGA43921.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323267602|gb|EGA51085.1| acyl-CoA esterase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323270931|gb|EGA54367.1| acyl-CoA esterase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 130

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 70/121 (57%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ 
Sbjct: 7   GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVA 66

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  K G TS++I  +VW   + AS  + Q  K  EA  + VAVD  G P+ 
Sbjct: 67  VGDVVCCYARCVKRGTTSISINIEVWV-KKVASEPIGQRYKATEALFIYVAVDPDGKPRP 125

Query: 149 I 149
           +
Sbjct: 126 L 126


>gi|27657347|emb|CAD60256.1| acyl-CoA thioester-like hydrolase [Defluvibacter lusatiensis]
          Length = 136

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 68/116 (58%), Gaps = 2/116 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            ++   MP D N  G++FGGW+MSQ+D+A G  A+   + R  T AV  + F +P++V D
Sbjct: 13  AIRTVAMPADTNPAGDIFGGWLMSQMDLAAGCLAASTARGRSATIAVEAMRFLRPVRVGD 72

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V ++  +  +G++S+ I+ + W   R+  S   +K  +A    VA+D +G P+S+
Sbjct: 73  EVSLFADLVSVGRSSMRIHVEAWR--RSRDSIESEKVTQANFTFVALDPQGRPRSV 126


>gi|317402422|gb|EFV82993.1| thioesterase [Achromobacter xylosoxidans C54]
          Length = 136

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (62%), Gaps = 1/108 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++  MP D N+ G+VFGGWIMSQ+DIA  I A++    RV T AV    F++P+ V DL
Sbjct: 20  LRVMPMPADANIHGDVFGGWIMSQVDIAGSIPAARRAAGRVATVAVNAFQFKQPVFVGDL 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           +  Y  I K GKTS+T+  +V+   +   ++V+ K  EAT+  VA DE
Sbjct: 80  LSFYASIVKTGKTSITVSVEVYAERQRLDAEVV-KVTEATLTYVATDE 126


>gi|319944724|ref|ZP_08018988.1| acyl-CoA thioester hydrolase YciA [Lautropia mirabilis ATCC 51599]
 gi|319741973|gb|EFV94396.1| acyl-CoA thioester hydrolase YciA [Lautropia mirabilis ATCC 51599]
          Length = 158

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 65/125 (52%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
            ++ S     L I  MP D N  G+VFGGWIMSQ+DIA  + A Q  + RV T AV  L 
Sbjct: 26  SELPSGRTPVLAIVPMPPDANPHGHVFGGWIMSQMDIAGAVAAVQRARGRVSTVAVNTLT 85

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           F  PIQV      Y  + ++G TSVT   + +T     +   ++K  EA    VA+DE  
Sbjct: 86  FLAPIQVGSRTLFYADVVRVGNTSVTCKVEAYTEHNIHAPTEVRKVSEALFTYVAMDEND 145

Query: 145 NPKSI 149
            P+ +
Sbjct: 146 QPRPV 150


>gi|281178444|dbj|BAI54774.1| putative acyl-CoA thioester hydrolase [Escherichia coli SE15]
          Length = 132

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 72/124 (58%), Gaps = 3/124 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ 
Sbjct: 10  GDLVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  + G TSV+I  +VW   + AS  + Q  K  EA    VAVD +G P++
Sbjct: 70  VGDVVCCYARCVQKGTTSVSINIEVWV-KKVASEPIGQRYKATEALFKYVAVDPEGKPRA 128

Query: 149 IRTE 152
           +  E
Sbjct: 129 LPVE 132


>gi|296102009|ref|YP_003612155.1| acyl-CoA thioester hydrolase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295056468|gb|ADF61206.1| acyl-CoA thioester hydrolase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 131

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 71/122 (58%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+D+   I A ++   RVVT  V  + F +P+ 
Sbjct: 9   GELVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAHGRVVTVRVDGMTFLRPVA 68

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEKGNPK 147
           V D+V  Y +  K G TS++I  +VW   +  SS+ +    K  EA  + VAVD +G P+
Sbjct: 69  VGDVVCCYARCVKRGNTSISINIEVWV--KKVSSEPIGQRYKATEALFIYVAVDSEGKPR 126

Query: 148 SI 149
            +
Sbjct: 127 QL 128


>gi|261867526|ref|YP_003255448.1| hypothetical protein D11S_0833 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|293391402|ref|ZP_06635736.1| acyl-CoA thioester hydrolase YciA [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|261412858|gb|ACX82229.1| hypothetical protein D11S_0833 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|290951936|gb|EFE02055.1| acyl-CoA thioester hydrolase YciA [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 156

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 74/124 (59%), Gaps = 3/124 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F +P+ 
Sbjct: 15  GTLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIRPVT 74

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGNPKS 148
           V D+V  Y +   +G++S+ I  +VW   + AS  + ++ C  EA    VAV+ +G  ++
Sbjct: 75  VGDVVCCYGRCLYVGRSSLKIKVEVWV-KKVASEPIGERYCVTEAVFTFVAVNNEGKSRA 133

Query: 149 IRTE 152
           I  E
Sbjct: 134 IPRE 137


>gi|16129214|ref|NP_415769.1| Acyl-CoA esterase, role unknown [Escherichia coli str. K-12 substr.
           MG1655]
 gi|24112652|ref|NP_707162.1| acyl-CoA thioester hydrolase [Shigella flexneri 2a str. 301]
 gi|26247584|ref|NP_753624.1| acyl-CoA thioester hydrolase [Escherichia coli CFT073]
 gi|30062776|ref|NP_836947.1| acyl-CoA thioester hydrolase [Shigella flexneri 2a str. 2457T]
 gi|74312397|ref|YP_310816.1| acyl-CoA thioester hydrolase [Shigella sonnei Ss046]
 gi|82544292|ref|YP_408239.1| acyl-CoA thioester hydrolase [Shigella boydii Sb227]
 gi|82776606|ref|YP_402955.1| acyl-CoA thioester hydrolase [Shigella dysenteriae Sd197]
 gi|89108099|ref|AP_001879.1| predicted hydrolase [Escherichia coli str. K-12 substr. W3110]
 gi|91210478|ref|YP_540464.1| acyl-CoA thioester hydrolase [Escherichia coli UTI89]
 gi|110641483|ref|YP_669213.1| acyl-CoA thioester hydrolase [Escherichia coli 536]
 gi|110805257|ref|YP_688777.1| acyl-CoA thioester hydrolase [Shigella flexneri 5 str. 8401]
 gi|117623469|ref|YP_852382.1| acyl-CoA thioester hydrolase [Escherichia coli APEC O1]
 gi|157155297|ref|YP_001462513.1| acyl-CoA thioester hydrolase [Escherichia coli E24377A]
 gi|157160758|ref|YP_001458076.1| acyl-CoA thioester hydrolase [Escherichia coli HS]
 gi|170020382|ref|YP_001725336.1| acyl-CoA thioester hydrolase [Escherichia coli ATCC 8739]
 gi|170080930|ref|YP_001730250.1| hydrolase [Escherichia coli str. K-12 substr. DH10B]
 gi|170680833|ref|YP_001743933.1| acyl-CoA thioester hydrolase [Escherichia coli SMS-3-5]
 gi|187732746|ref|YP_001880033.1| acyl-CoA thioester hydrolase [Shigella boydii CDC 3083-94]
 gi|188491728|ref|ZP_02998998.1| acyl-CoA thioesterase YciA [Escherichia coli 53638]
 gi|191166645|ref|ZP_03028473.1| acyl-CoA thioesterase YciA [Escherichia coli B7A]
 gi|191170973|ref|ZP_03032524.1| acyl-CoA thioesterase YciA [Escherichia coli F11]
 gi|193064865|ref|ZP_03045942.1| acyl-CoA thioesterase YciA [Escherichia coli E22]
 gi|193069940|ref|ZP_03050888.1| acyl-CoA thioesterase YciA [Escherichia coli E110019]
 gi|194426044|ref|ZP_03058600.1| acyl-CoA thioesterase YciA [Escherichia coli B171]
 gi|194437077|ref|ZP_03069176.1| acyl-CoA thioesterase YciA [Escherichia coli 101-1]
 gi|209918493|ref|YP_002292577.1| acyl-CoA thioester hydrolase [Escherichia coli SE11]
 gi|215486488|ref|YP_002328919.1| acyl-CoA thioester hydrolase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218553805|ref|YP_002386718.1| acyl-CoA thioester hydrolase [Escherichia coli IAI1]
 gi|218558182|ref|YP_002391095.1| acyl-CoA thioester hydrolase [Escherichia coli S88]
 gi|218689199|ref|YP_002397411.1| acyl-CoA thioester hydrolase [Escherichia coli ED1a]
 gi|218694768|ref|YP_002402435.1| acyl-CoA thioester hydrolase [Escherichia coli 55989]
 gi|218699960|ref|YP_002407589.1| acyl-CoA thioester hydrolase [Escherichia coli IAI39]
 gi|218704776|ref|YP_002412295.1| acyl-CoA thioester hydrolase [Escherichia coli UMN026]
 gi|237705218|ref|ZP_04535699.1| acyl-CoA thioesterase YciA [Escherichia sp. 3_2_53FAA]
 gi|238900486|ref|YP_002926282.1| putative hydrolase [Escherichia coli BW2952]
 gi|253773749|ref|YP_003036580.1| acyl-CoA thioester hydrolase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254161332|ref|YP_003044440.1| acyl-CoA thioester hydrolase [Escherichia coli B str. REL606]
 gi|256018500|ref|ZP_05432365.1| acyl-CoA thioester hydrolase [Shigella sp. D9]
 gi|256023071|ref|ZP_05436936.1| acyl-CoA thioester hydrolase [Escherichia sp. 4_1_40B]
 gi|260843544|ref|YP_003221322.1| putative hydrolase [Escherichia coli O103:H2 str. 12009]
 gi|260854912|ref|YP_003228803.1| putative hydrolase [Escherichia coli O26:H11 str. 11368]
 gi|260868021|ref|YP_003234423.1| putative hydrolase [Escherichia coli O111:H- str. 11128]
 gi|291282275|ref|YP_003499093.1| acyl-CoA thioester hydrolase yciA [Escherichia coli O55:H7 str.
           CB9615]
 gi|293404795|ref|ZP_06648787.1| acyl-CoA thioester hydrolase [Escherichia coli FVEC1412]
 gi|293409640|ref|ZP_06653216.1| acyl-CoA thioester hydrolase [Escherichia coli B354]
 gi|293414525|ref|ZP_06657174.1| acyl-CoA thioesterase YciA [Escherichia coli B185]
 gi|293433566|ref|ZP_06661994.1| acyl-CoA thioester hydrolase [Escherichia coli B088]
 gi|297518039|ref|ZP_06936425.1| acyl-CoA thioester hydrolase [Escherichia coli OP50]
 gi|298380436|ref|ZP_06990035.1| acyl-CoA thioester hydrolase [Escherichia coli FVEC1302]
 gi|306813723|ref|ZP_07447904.1| acyl-CoA thioester hydrolase [Escherichia coli NC101]
 gi|307137891|ref|ZP_07497247.1| acyl-CoA thioester hydrolase [Escherichia coli H736]
 gi|307309992|ref|ZP_07589642.1| thioesterase superfamily protein [Escherichia coli W]
 gi|312966500|ref|ZP_07780722.1| thioesterase superfamily protein [Escherichia coli 2362-75]
 gi|331641812|ref|ZP_08342947.1| acyl-CoA thioester hydrolase YciA [Escherichia coli H736]
 gi|331646578|ref|ZP_08347681.1| acyl-CoA thioester hydrolase YciA [Escherichia coli M605]
 gi|331652291|ref|ZP_08353310.1| acyl-CoA thioester hydrolase YciA [Escherichia coli M718]
 gi|331657303|ref|ZP_08358265.1| acyl-CoA thioester hydrolase YciA [Escherichia coli TA206]
 gi|331662665|ref|ZP_08363588.1| acyl-CoA thioester hydrolase YciA [Escherichia coli TA143]
 gi|331667638|ref|ZP_08368502.1| acyl-CoA thioester hydrolase YciA [Escherichia coli TA271]
 gi|331672783|ref|ZP_08373569.1| acyl-CoA thioester hydrolase YciA [Escherichia coli TA280]
 gi|331677032|ref|ZP_08377728.1| acyl-CoA thioester hydrolase YciA [Escherichia coli H591]
 gi|331682740|ref|ZP_08383359.1| acyl-CoA thioester hydrolase YciA [Escherichia coli H299]
 gi|332279556|ref|ZP_08391969.1| acyl-CoA thioester hydrolase [Shigella sp. D9]
 gi|68066504|sp|P0A8Z0|YCIA_ECOLI RecName: Full=Acyl-CoA thioester hydrolase YciA; AltName:
           Full=Protein P14
 gi|68066507|sp|P0A8Z1|YCIA_ECOL6 RecName: Full=Acyl-CoA thioester hydrolase YciA
 gi|68066508|sp|P0A8Z2|YCIA_SHIFL RecName: Full=Acyl-CoA thioester hydrolase YciA
 gi|26107986|gb|AAN80186.1|AE016760_45 Putative acyl-CoA thioester hydrolase yciA [Escherichia coli
           CFT073]
 gi|455187|gb|AAB59067.1| P14 protein (P14 gene; putative); putative [Escherichia coli]
 gi|902382|gb|AAB60068.1| yciA [Escherichia coli]
 gi|902391|gb|AAB60076.1| yciA [Escherichia coli]
 gi|902400|gb|AAB60084.1| yciA [Escherichia coli]
 gi|902409|gb|AAB60092.1| yciA [Escherichia coli]
 gi|902418|gb|AAB60100.1| yciA [Escherichia coli]
 gi|902427|gb|AAB60108.1| yciA [Escherichia coli]
 gi|902436|gb|AAB60116.1| yciA [Escherichia coli]
 gi|902445|gb|AAB60124.1| yciA [Escherichia coli]
 gi|902454|gb|AAB60132.1| yciA [Escherichia coli]
 gi|902463|gb|AAB60140.1| yciA [Escherichia coli]
 gi|902472|gb|AAB60148.1| yciA [Escherichia coli]
 gi|902481|gb|AAB60156.1| yciA [Escherichia coli]
 gi|1742042|dbj|BAA14785.1| predicted hydrolase [Escherichia coli str. K12 substr. W3110]
 gi|1787506|gb|AAC74335.1| Acyl-CoA esterase, role unknown [Escherichia coli str. K-12 substr.
           MG1655]
 gi|24051564|gb|AAN42869.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30041024|gb|AAP16754.1| hypothetical protein S1342 [Shigella flexneri 2a str. 2457T]
 gi|73855874|gb|AAZ88581.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81240754|gb|ABB61464.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81245703|gb|ABB66411.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|91072052|gb|ABE06933.1| putative acyl-CoA thioester hydrolase YciA [Escherichia coli UTI89]
 gi|110343075|gb|ABG69312.1| putative acyl-CoA thioester hydrolase YciA [Escherichia coli 536]
 gi|110614805|gb|ABF03472.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115512593|gb|ABJ00668.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157066438|gb|ABV05693.1| acyl-CoA thioesterase YciA [Escherichia coli HS]
 gi|157077327|gb|ABV17035.1| acyl-CoA thioester hydrolase YciA [Escherichia coli E24377A]
 gi|169755310|gb|ACA78009.1| thioesterase superfamily protein [Escherichia coli ATCC 8739]
 gi|169888765|gb|ACB02472.1| predicted hydrolase [Escherichia coli str. K-12 substr. DH10B]
 gi|170518551|gb|ACB16729.1| acyl-CoA thioesterase YciA [Escherichia coli SMS-3-5]
 gi|187429738|gb|ACD09012.1| acyl-CoA thioesterase YciA [Shigella boydii CDC 3083-94]
 gi|188486927|gb|EDU62030.1| acyl-CoA thioesterase YciA [Escherichia coli 53638]
 gi|190903294|gb|EDV63015.1| acyl-CoA thioesterase YciA [Escherichia coli B7A]
 gi|190908705|gb|EDV68293.1| acyl-CoA thioesterase YciA [Escherichia coli F11]
 gi|192927550|gb|EDV82167.1| acyl-CoA thioesterase YciA [Escherichia coli E22]
 gi|192956693|gb|EDV87148.1| acyl-CoA thioesterase YciA [Escherichia coli E110019]
 gi|194416099|gb|EDX32365.1| acyl-CoA thioesterase YciA [Escherichia coli B171]
 gi|194424060|gb|EDX40048.1| acyl-CoA thioesterase YciA [Escherichia coli 101-1]
 gi|195182842|dbj|BAG66414.1| predicted hydrolase [Escherichia coli O111:H-]
 gi|209772174|gb|ACI84399.1| hypothetical protein ECs1753 [Escherichia coli]
 gi|209911752|dbj|BAG76826.1| putative acyl-CoA thioester hydrolase [Escherichia coli SE11]
 gi|215264560|emb|CAS08928.1| predicted hydrolase [Escherichia coli O127:H6 str. E2348/69]
 gi|218351500|emb|CAU97209.1| putative hydrolase [Escherichia coli 55989]
 gi|218360573|emb|CAQ98132.1| putative hydrolase [Escherichia coli IAI1]
 gi|218364951|emb|CAR02648.1| putative hydrolase [Escherichia coli S88]
 gi|218369946|emb|CAR17721.1| putative hydrolase [Escherichia coli IAI39]
 gi|218426763|emb|CAR07606.1| putative hydrolase [Escherichia coli ED1a]
 gi|218431873|emb|CAR12759.1| putative hydrolase [Escherichia coli UMN026]
 gi|222033058|emb|CAP75798.1| acyl-CoA thioester hydrolase yciA [Escherichia coli LF82]
 gi|226899975|gb|EEH86234.1| acyl-CoA thioesterase YciA [Escherichia sp. 3_2_53FAA]
 gi|238862464|gb|ACR64462.1| predicted hydrolase [Escherichia coli BW2952]
 gi|242377030|emb|CAQ31754.1| acyl-CoA thioesterase [Escherichia coli BL21(DE3)]
 gi|253324793|gb|ACT29395.1| thioesterase superfamily protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973233|gb|ACT38904.1| predicted hydrolase [Escherichia coli B str. REL606]
 gi|253977447|gb|ACT43117.1| predicted hydrolase [Escherichia coli BL21(DE3)]
 gi|257753561|dbj|BAI25063.1| predicted hydrolase [Escherichia coli O26:H11 str. 11368]
 gi|257758691|dbj|BAI30188.1| predicted hydrolase [Escherichia coli O103:H2 str. 12009]
 gi|257764377|dbj|BAI35872.1| predicted hydrolase [Escherichia coli O111:H- str. 11128]
 gi|260449616|gb|ACX40038.1| thioesterase superfamily protein [Escherichia coli DH1]
 gi|281600677|gb|ADA73661.1| Acyl-CoA thioester hydrolase yciA [Shigella flexneri 2002017]
 gi|284921062|emb|CBG34127.1| putative acyl-coA thioester hydrolase [Escherichia coli 042]
 gi|290762148|gb|ADD56109.1| Acyl-CoA thioester hydrolase yciA [Escherichia coli O55:H7 str.
           CB9615]
 gi|291324385|gb|EFE63807.1| acyl-CoA thioester hydrolase [Escherichia coli B088]
 gi|291427003|gb|EFF00030.1| acyl-CoA thioester hydrolase [Escherichia coli FVEC1412]
 gi|291434583|gb|EFF07556.1| acyl-CoA thioesterase YciA [Escherichia coli B185]
 gi|291470108|gb|EFF12592.1| acyl-CoA thioester hydrolase [Escherichia coli B354]
 gi|294491597|gb|ADE90353.1| acyl-CoA thioester hydrolase YciA [Escherichia coli IHE3034]
 gi|298277878|gb|EFI19392.1| acyl-CoA thioester hydrolase [Escherichia coli FVEC1302]
 gi|305852997|gb|EFM53442.1| acyl-CoA thioester hydrolase [Escherichia coli NC101]
 gi|306909710|gb|EFN40204.1| thioesterase superfamily protein [Escherichia coli W]
 gi|307553313|gb|ADN46088.1| acyl-CoA thioester hydrolase [Escherichia coli ABU 83972]
 gi|307627226|gb|ADN71530.1| acyl-CoA thioester hydrolase [Escherichia coli UM146]
 gi|309701551|emb|CBJ00858.1| putative acyl-coA thioester hydrolase [Escherichia coli ETEC
           H10407]
 gi|312288953|gb|EFR16851.1| thioesterase superfamily protein [Escherichia coli 2362-75]
 gi|312945888|gb|ADR26715.1| acyl-CoA thioester hydrolase [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315060504|gb|ADT74831.1| predicted hydrolase [Escherichia coli W]
 gi|315135890|dbj|BAJ43049.1| acyl-CoA thioester hydrolase yciA [Escherichia coli DH1]
 gi|320654035|gb|EFX22109.1| acyl-CoA esterase [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320659514|gb|EFX27083.1| acyl-CoA esterase [Escherichia coli O55:H7 str. USDA 5905]
 gi|323378932|gb|ADX51200.1| thioesterase superfamily protein [Escherichia coli KO11]
 gi|323937751|gb|EGB34017.1| thioesterase superfamily protein [Escherichia coli E1520]
 gi|323942368|gb|EGB38538.1| thioesterase superfamily protein [Escherichia coli E482]
 gi|323947465|gb|EGB43469.1| thioesterase superfamily protein [Escherichia coli H120]
 gi|323949630|gb|EGB45516.1| thioesterase superfamily protein [Escherichia coli H252]
 gi|323953893|gb|EGB49692.1| thioesterase superfamily protein [Escherichia coli H263]
 gi|323962624|gb|EGB58203.1| thioesterase superfamily protein [Escherichia coli H489]
 gi|323964654|gb|EGB60126.1| thioesterase superfamily protein [Escherichia coli M863]
 gi|323973506|gb|EGB68692.1| thioesterase superfamily protein [Escherichia coli TA007]
 gi|323977178|gb|EGB72265.1| thioesterase superfamily protein [Escherichia coli TW10509]
 gi|324117553|gb|EGC11459.1| thioesterase superfamily protein [Escherichia coli E1167]
 gi|327253943|gb|EGE65572.1| thioesterase superfamily protein [Escherichia coli STEC_7v]
 gi|331038610|gb|EGI10830.1| acyl-CoA thioester hydrolase YciA [Escherichia coli H736]
 gi|331045330|gb|EGI17457.1| acyl-CoA thioester hydrolase YciA [Escherichia coli M605]
 gi|331050569|gb|EGI22627.1| acyl-CoA thioester hydrolase YciA [Escherichia coli M718]
 gi|331055551|gb|EGI27560.1| acyl-CoA thioester hydrolase YciA [Escherichia coli TA206]
 gi|331061087|gb|EGI33051.1| acyl-CoA thioester hydrolase YciA [Escherichia coli TA143]
 gi|331065223|gb|EGI37118.1| acyl-CoA thioester hydrolase YciA [Escherichia coli TA271]
 gi|331070004|gb|EGI41373.1| acyl-CoA thioester hydrolase YciA [Escherichia coli TA280]
 gi|331075721|gb|EGI47019.1| acyl-CoA thioester hydrolase YciA [Escherichia coli H591]
 gi|331080371|gb|EGI51550.1| acyl-CoA thioester hydrolase YciA [Escherichia coli H299]
 gi|332101908|gb|EGJ05254.1| acyl-CoA thioester hydrolase [Shigella sp. D9]
 gi|332342846|gb|AEE56180.1| acyl-CoA thioester hydrolase YciA [Escherichia coli UMNK88]
 gi|333005553|gb|EGK25071.1| thioesterase superfamily protein [Shigella flexneri K-218]
 gi|333019143|gb|EGK38433.1| thioesterase superfamily protein [Shigella flexneri K-304]
          Length = 132

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 72/124 (58%), Gaps = 3/124 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ 
Sbjct: 10  GDLVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  + G TSV+I  +VW   + AS  + Q  K  EA    VAVD +G P++
Sbjct: 70  VGDVVCCYARCVQKGTTSVSINIEVWV-KKVASEPIGQRYKATEALFKYVAVDPEGKPRA 128

Query: 149 IRTE 152
           +  E
Sbjct: 129 LPVE 132


>gi|325521376|gb|EGD00217.1| thioesterase superfamily protein [Burkholderia sp. TJI49]
          Length = 131

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P D N+ G+VFGGWIMSQ+DIA  I ASQ    RV T AV   +F++P+ V DL
Sbjct: 15  LRVVPQPHDANVHGDVFGGWIMSQVDIAGSIPASQRANGRVATVAVNSFVFKQPVFVGDL 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  +  I + G TS+T+  +V+        +V+ K  EAT+  VA      P+ +
Sbjct: 75  LSFFATITRTGNTSITVDVEVYAQRMRLMGEVV-KVTEATLTYVATGPDRKPRPL 128


>gi|256829011|ref|YP_003157739.1| thioesterase superfamily protein [Desulfomicrobium baculatum DSM
           4028]
 gi|256578187|gb|ACU89323.1| thioesterase superfamily protein [Desulfomicrobium baculatum DSM
           4028]
          Length = 141

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 73/120 (60%), Gaps = 1/120 (0%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G+L L+   MP D N  G++FGGWI++Q+D+A G+ AS++ K R VT +V ++ F+KP++
Sbjct: 13  GLLVLRTLAMPRDTNPSGDIFGGWILAQMDVAGGLMASEVSKGRTVTVSVEKMSFDKPVR 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK-TCEATVVMVAVDEKGNPKSI 149
           + D + ++ ++  +G +S+ I  +VW      + +  ++   E     VAVDE   P+ +
Sbjct: 73  MGDTICVHAELLHVGNSSMDIKLEVWARQLVGAYEAQRELVTEGVFRYVAVDENRRPRRV 132


>gi|295095671|emb|CBK84761.1| Acyl-CoA hydrolase [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 131

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 70/122 (57%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+D+   I A ++   RVVT  V  + F +P+ 
Sbjct: 9   GELVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAHGRVVTVRVDGMTFLRPVA 68

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEKGNPK 147
           V D+V  Y +  K G TSV+I  +VW   +  SS+ +    K  EA  + VAVD  G P+
Sbjct: 69  VGDVVCCYARCVKRGNTSVSINIEVWV--KKVSSEPIGQRYKATEALFIYVAVDSDGKPR 126

Query: 148 SI 149
            +
Sbjct: 127 QL 128


>gi|89053495|ref|YP_508946.1| thioesterase superfamily protein [Jannaschia sp. CCS1]
 gi|88863044|gb|ABD53921.1| thioesterase superfamily [Jannaschia sp. CCS1]
          Length = 136

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 63/115 (54%), Gaps = 2/115 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G LTL+   MP D N  G+VFGGW++SQ+DIA G  A    + R  T A+  L F  P+
Sbjct: 11  NGALTLQTVPMPGDTNAGGDVFGGWVVSQMDIAAGTTAIDRAQGRCATVAIEALRFHAPV 70

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
            V DL  ++T I + G+TS+T++ + W   +     +L    E     VA+ + G
Sbjct: 71  LVGDLFSVFTHITRTGRTSITMHIEAWVRRQRTGEQIL--VTEGDFTFVAISDSG 123


>gi|183599281|ref|ZP_02960774.1| hypothetical protein PROSTU_02743 [Providencia stuartii ATCC 25827]
 gi|188021514|gb|EDU59554.1| hypothetical protein PROSTU_02743 [Providencia stuartii ATCC 25827]
          Length = 138

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 73/125 (58%), Gaps = 3/125 (2%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT AV  + F+KP+
Sbjct: 5   NGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIALGRVVTVAVNGIKFQKPV 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPK 147
            V D+V  Y +  K GK+S+TI  +VW   + A+  V    +  +A    VAV++   P+
Sbjct: 65  AVGDVVCCYARCLKTGKSSITINIEVW-VKKVATEPVGHRYRATDAVFTYVAVNDDNTPR 123

Query: 148 SIRTE 152
            +  E
Sbjct: 124 ELPKE 128


>gi|188533736|ref|YP_001907533.1| Putative acyl-CoA thioester hydrolase [Erwinia tasmaniensis Et1/99]
 gi|188028778|emb|CAO96640.1| Putative acyl-CoA thioester hydrolase [Erwinia tasmaniensis Et1/99]
          Length = 142

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/126 (35%), Positives = 73/126 (57%), Gaps = 3/126 (2%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q    G + L+   MP D N +G++FGGW+MSQ+D+   I A ++   RVVT     + F
Sbjct: 5   QRTPQGEMVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEMAGGRVVTVRADGMTF 64

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEK 143
            KP+ V D+V  + +  + G +S+TI  +VW   + +S  + Q+ C  EA  + VAVD++
Sbjct: 65  LKPVAVGDVVSCHARCIRTGTSSITINIEVW-IKKVSSEPIGQRYCTTEAVFIYVAVDKE 123

Query: 144 GNPKSI 149
           G P+ +
Sbjct: 124 GKPRPL 129


>gi|332187165|ref|ZP_08388905.1| thioesterase superfamily protein [Sphingomonas sp. S17]
 gi|332012865|gb|EGI54930.1| thioesterase superfamily protein [Sphingomonas sp. S17]
          Length = 135

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (55%), Gaps = 2/118 (1%)

Query: 32  VLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
           V  +++  MP D N  G++FGGW+M Q+D+A G  AS+    R VT AV  + F  P+ V
Sbjct: 8   VPVIRVTAMPGDANPYGDIFGGWLMGQMDLAAGSVASRHSGGRAVTIAVEGMKFHAPVLV 67

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            D V +Y Q+ ++G TS+TI  + W   R+       K  +A  V VA D+   P+++
Sbjct: 68  GDEVSVYAQLVRVGTTSMTIEVEAWRRARHVED--ATKVTQARFVFVATDKDRKPRTV 123


>gi|92115384|ref|YP_575312.1| thioesterase superfamily protein [Chromohalobacter salexigens DSM
           3043]
 gi|91798474|gb|ABE60613.1| thioesterase superfamily [Chromohalobacter salexigens DSM 3043]
          Length = 134

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 70/118 (59%), Gaps = 1/118 (0%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
             G LTLK+ T   D NL G++ GGW+M+Q+D A  + A +L + R  T A   + F  P
Sbjct: 10  PQGELTLKLVTRRQDTNLYGDIPGGWLMAQMDQAAELAAGRLARGRTATVATEGMDFLCP 69

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVW-TCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           ++V  +V+I+TQ+R++G++S+ +  +VW   P     +   K  EA  VMVA+D+ G 
Sbjct: 70  VRVGAMVNIFTQVREVGRSSIKLDVEVWIRPPHERDPEERYKVTEARFVMVALDDNGR 127


>gi|134296907|ref|YP_001120642.1| thioesterase superfamily protein [Burkholderia vietnamiensis G4]
 gi|134140064|gb|ABO55807.1| thioesterase superfamily protein [Burkholderia vietnamiensis G4]
          Length = 136

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P D N+ G+VFGGWIMSQ+DIA  I ASQ    RV T AV   +F++P+ V D+
Sbjct: 20  LRVVPQPHDANVHGDVFGGWIMSQVDIAGSIPASQRANGRVATVAVNSFVFKQPVFVGDV 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  Y  I + G TSVT+  +V+        +++ K  EAT+  VA      P+ +
Sbjct: 80  LSFYATIMRTGNTSVTVDVEVYAQRMRLMGEIV-KVTEATLTYVATGADRKPRPL 133


>gi|87122160|ref|ZP_01078043.1| thioesterase family protein [Marinomonas sp. MED121]
 gi|86162480|gb|EAQ63762.1| thioesterase family protein [Marinomonas sp. MED121]
          Length = 147

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 69/125 (55%), Gaps = 2/125 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            + G LT +   MP D N  G++FGGW++SQ+DIA GI A Q  + RVVT  +  + F +
Sbjct: 9   ETKGRLTTRTVAMPGDTNPAGDIFGGWVLSQMDIAAGICAGQRAQSRVVTVEIDRMSFIR 68

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           P++V D++ +YT + K+G++S+ I  + W   R       +K  E     VA+ E G   
Sbjct: 69  PVKVGDILGVYTCVIKVGRSSMEILVEAWV--RRNRIGTREKVTEGVFKFVAIGEDGKST 126

Query: 148 SIRTE 152
            +  E
Sbjct: 127 PVPAE 131


>gi|268589475|ref|ZP_06123696.1| acyl-CoA thioester hydrolase YciA [Providencia rettgeri DSM 1131]
 gi|291315142|gb|EFE55595.1| acyl-CoA thioester hydrolase YciA [Providencia rettgeri DSM 1131]
          Length = 144

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 74/125 (59%), Gaps = 3/125 (2%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT AV  + F+KP+
Sbjct: 5   NGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIALGRVVTVAVNGIKFQKPV 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPK 147
            V D+V  Y +  K GK+S+TI  +VW   + A+  V Q  +  +A    VAV++    +
Sbjct: 65  AVGDVVCCYARCLKTGKSSITINIEVW-VKKVATEPVGQRYRATDAVFTYVAVNDDSTSR 123

Query: 148 SIRTE 152
           S+  E
Sbjct: 124 SLPKE 128


>gi|302384288|ref|YP_003820111.1| thioesterase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194916|gb|ADL02488.1| thioesterase superfamily protein [Brevundimonas subvibrioides ATCC
           15264]
          Length = 133

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 69/127 (54%), Gaps = 7/127 (5%)

Query: 28  HSS-----GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           HSS     G L  ++  MP D N +G++FGGW+++Q+D+A    A  L + R  T AV  
Sbjct: 3   HSSPDTPDGSLVGRVIAMPADTNPEGDIFGGWLLAQMDLAGSTPAFDLAQGRCATIAVDG 62

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           ++F +P+ V D V +Y  + K G+TS+ +  + W  PR  S+  + +  E     VA+D 
Sbjct: 63  MVFHQPVSVGDEVSLYATVLKTGRTSIRVRVEAWKRPR--STHAVSRVTEGVFTYVAIDS 120

Query: 143 KGNPKSI 149
              P+ +
Sbjct: 121 DRKPRPL 127


>gi|226330272|ref|ZP_03805790.1| hypothetical protein PROPEN_04185 [Proteus penneri ATCC 35198]
 gi|225201067|gb|EEG83421.1| hypothetical protein PROPEN_04185 [Proteus penneri ATCC 35198]
          Length = 143

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 73/126 (57%), Gaps = 3/126 (2%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q   +G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT +VT + F
Sbjct: 5   QSLPNGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIALGRVVTVSVTGITF 64

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEK 143
            KP+ V D+V  Y +  K G +S+T+  +VW   + A+  V Q  +  EA    VAVDE 
Sbjct: 65  LKPVAVGDVVCCYARCLKTGNSSITVNIEVW-VKKVATEPVGQRYRATEAVFTYVAVDEN 123

Query: 144 GNPKSI 149
            + + +
Sbjct: 124 NSARRL 129


>gi|121606352|ref|YP_983681.1| thioesterase superfamily protein [Polaromonas naphthalenivorans
           CJ2]
 gi|120595321|gb|ABM38760.1| thioesterase superfamily protein [Polaromonas naphthalenivorans
           CJ2]
          Length = 155

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 72/117 (61%), Gaps = 1/117 (0%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L LK+  MP D N +G++FGGW+M+Q+D+A  +  ++    R+ T AV + +F++P++V 
Sbjct: 37  LVLKVIPMPRDCNANGDIFGGWVMAQVDLAGAVLPARYVDGRMATVAVNQFIFKQPVRVG 96

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           D++     + +IG TS+T+  +V+     A    + K  EA++  VA+D+ G P+ I
Sbjct: 97  DILSFLAVVTRIGTTSITVQVEVFAERFRAQGRHI-KVTEASLTYVALDDAGKPRKI 152


>gi|329850347|ref|ZP_08265192.1| thioesterase superfamily protein [Asticcacaulis biprosthecum C19]
 gi|328840662|gb|EGF90233.1| thioesterase superfamily protein [Asticcacaulis biprosthecum C19]
          Length = 125

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  G++FGGW+M+Q+D+A G  A++  + RV T AV  ++F  P++V D V +Y 
Sbjct: 16  MPADTNPSGDIFGGWLMAQMDLAAGNVAARTSRGRVATIAVDGMIFLTPVKVGDEVSVYA 75

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +I  +G+TS+ +    +   R+  SD      EAT   VA+D  G P+ +
Sbjct: 76  KILSVGRTSMKLKVKAYRRLRD--SDTRIPVTEATFTFVAIDANGRPRPV 123


>gi|261340068|ref|ZP_05967926.1| acyl-CoA thioester hydrolase YciA [Enterobacter cancerogenus ATCC
           35316]
 gi|288317995|gb|EFC56933.1| acyl-CoA thioester hydrolase YciA [Enterobacter cancerogenus ATCC
           35316]
          Length = 131

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 70/122 (57%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+D+   I A ++   RVVT  V  + F +P+ 
Sbjct: 9   GELVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAHGRVVTVRVDGMTFLRPVA 68

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEKGNPK 147
           V D+V  Y +  K G TS++I  +VW   +  SS+ +    K  EA  + VAVD  G P+
Sbjct: 69  VGDVVCCYARCVKRGNTSISINIEVWV--KKVSSEPIGQRYKATEALFIYVAVDNAGKPR 126

Query: 148 SI 149
            +
Sbjct: 127 PL 128


>gi|298368742|ref|ZP_06980060.1| acyl-CoA thioester hydrolase YciA [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298282745|gb|EFI24232.1| acyl-CoA thioester hydrolase YciA [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 170

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 83/144 (57%), Gaps = 6/144 (4%)

Query: 15  IITKKEVLMV--CQMHS--SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQL 70
           +  KKE  M    ++H+   G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++
Sbjct: 18  LTPKKEYEMPQNTELHTDPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEI 77

Query: 71  CKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQ 128
            + R+VT AV E+ F +P++V ++V  Y +   +G TS+ +  +VW  T   +  ++  Q
Sbjct: 78  AQGRIVTVAVQEMNFIRPVRVGNVVCCYGRCVHVGNTSLQLKIEVWVKTLMNDHLTENRQ 137

Query: 129 KTCEATVVMVAVDEKGNPKSIRTE 152
              EA    VA+D +GN + I  E
Sbjct: 138 LVTEAVFTYVAIDAEGNTRPIPKE 161


>gi|254483194|ref|ZP_05096427.1| thioesterase family protein [marine gamma proteobacterium HTCC2148]
 gi|214036565|gb|EEB77239.1| thioesterase family protein [marine gamma proteobacterium HTCC2148]
          Length = 130

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 70/121 (57%), Gaps = 2/121 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DIA  + A+++   RV T A+  + F  P+ 
Sbjct: 12  GDLALQTVAMPKDTNPNGDIFGGWLMSQMDIAGMVTAAEVAGGRVATVAIDAMAFLTPVH 71

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V  +V  Y  + +IG++S+ I  +VW   ++    +  K  E   V VA+D+ G  ++IR
Sbjct: 72  VGAVVTCYCDVLEIGRSSIRIIVEVWINSKHDGEPI--KVTEGEFVFVAIDDNGRTRAIR 129

Query: 151 T 151
            
Sbjct: 130 A 130


>gi|292488402|ref|YP_003531284.1| putative acyl-CoA thioester hydrolase [Erwinia amylovora CFBP1430]
 gi|292899597|ref|YP_003538966.1| acyl-CoA thioester hydrolase [Erwinia amylovora ATCC 49946]
 gi|291199445|emb|CBJ46562.1| putative acyl-CoA thioester hydrolase [Erwinia amylovora ATCC
           49946]
 gi|291553831|emb|CBA20876.1| putative acyl-CoA thioester hydrolase [Erwinia amylovora CFBP1430]
 gi|312172545|emb|CBX80801.1| putative acyl-CoA thioester hydrolase [Erwinia amylovora ATCC
           BAA-2158]
          Length = 142

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 73/126 (57%), Gaps = 3/126 (2%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q    G + L+   MP D N +G++FGGW+MSQ+D+   I A ++   RVVT  V  + F
Sbjct: 5   QRTPQGEMVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAGGRVVTVRVDGMTF 64

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEK 143
            KP+ V D+V  + +  + G +SVT+  +VW   + +S  + Q+ C  EA  + VAVD +
Sbjct: 65  MKPVAVGDVVCCHARCVRTGTSSVTVNIEVW-IKKVSSEPIGQRYCTTEAVFIYVAVDSQ 123

Query: 144 GNPKSI 149
           G P+ +
Sbjct: 124 GKPRPL 129


>gi|322833336|ref|YP_004213363.1| thioesterase superfamily protein [Rahnella sp. Y9602]
 gi|321168537|gb|ADW74236.1| thioesterase superfamily protein [Rahnella sp. Y9602]
          Length = 146

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 76/129 (58%), Gaps = 7/129 (5%)

Query: 26  QMHS--SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTEL 83
           + HS  +G + L+   MP D N +G++FGGW+MSQ+D+   I+A ++ K RVVT  V  +
Sbjct: 3   EKHSLPNGEMVLRTLAMPADTNANGDIFGGWLMSQMDMGGAIQAKEIAKGRVVTVRVDGM 62

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAV 140
            F KP+ V D+V  Y +  + G +S+TI  +VW   +  SS+ +    +  EA    VAV
Sbjct: 63  TFLKPVAVGDVVCCYARCIRTGNSSITINVEVWV--KKVSSEPIGQRYRATEAVFTYVAV 120

Query: 141 DEKGNPKSI 149
           D++G  + +
Sbjct: 121 DDEGKSRQL 129


>gi|296534731|ref|ZP_06897110.1| acyl-CoA thioester hydrolase YciA [Roseomonas cervicalis ATCC
           49957]
 gi|296264944|gb|EFH11190.1| acyl-CoA thioester hydrolase YciA [Roseomonas cervicalis ATCC
           49957]
          Length = 130

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 60/110 (54%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  G++FGGW+M+Q+D+A G  A +  + R  T AV  + F  P++V D V +Y 
Sbjct: 20  MPADTNPAGDIFGGWLMAQMDLAAGNAAVRRARGRCATVAVEAMTFHSPVRVGDEVSLYA 79

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++   G+TS+ I    W   R   SD   +  EA    VA+D  G P+ +
Sbjct: 80  EVISTGRTSMRIRVQAWR--RERESDHTNRVTEAVFTFVALDATGRPRPV 127


>gi|57242217|ref|ZP_00370156.1| acyl CoA thioester hydrolase family protein [Campylobacter
           upsaliensis RM3195]
 gi|57016897|gb|EAL53679.1| acyl CoA thioester hydrolase family protein [Campylobacter
           upsaliensis RM3195]
          Length = 137

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 75/130 (57%), Gaps = 7/130 (5%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M   G   LKI  MP+D N +GN+FGGWI+SQID+A  I A +L   RVVT ++ +++F+
Sbjct: 1   MKDMGEPKLKIVAMPSDTNPEGNIFGGWILSQIDLAGAITARELSPERVVTISMDKVIFK 60

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC----EATVVMVAVDE 142
           +P+ V D++  Y +I K+G TS+ +  +V         D+   +C     A    ++VD+
Sbjct: 61  EPVYVGDILSCYAKIEKVGNTSIGVKIEVVV---QRVDDIGCTSCINVTSAFATYISVDK 117

Query: 143 KGNPKSIRTE 152
           +G  K I  E
Sbjct: 118 RGRKKPISKE 127


>gi|238754957|ref|ZP_04616306.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia ruckeri ATCC
           29473]
 gi|238706816|gb|EEP99184.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia ruckeri ATCC
           29473]
          Length = 141

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 75/130 (57%), Gaps = 5/130 (3%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  Q+  +G L L+   MP D N +G++FGGW+MSQ+DI   I+A ++   RVVT  V  
Sbjct: 1   MTQQLLPNGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAHGRVVTVRVDG 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVA 139
           + F KP+ V D+V  Y +  K G++S+ +  +VW   +  SS+ +    +  EA    VA
Sbjct: 61  MTFLKPVAVGDVVCCYARCIKTGRSSIVVNVEVWV--KKVSSEPIGQRYRATEAVFTYVA 118

Query: 140 VDEKGNPKSI 149
           V+++G  + +
Sbjct: 119 VNDEGKSRPL 128


>gi|300723365|ref|YP_003712668.1| hypothetical protein XNC1_2444 [Xenorhabdus nematophila ATCC 19061]
 gi|297629885|emb|CBJ90503.1| putative enzyme with thioesterase/thiol ester dehydrase-isomerase
           domain [Xenorhabdus nematophila ATCC 19061]
          Length = 144

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 73/126 (57%), Gaps = 3/126 (2%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q   +G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT +V  + F
Sbjct: 5   QSLPNGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIALGRVVTVSVNGISF 64

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEK 143
            KP+ V D+V  Y +  K G +S+TI+ +VW   + AS  V Q  +  +A    VAVDE 
Sbjct: 65  LKPVAVGDVVCCYARCLKTGNSSITIHIEVW-VKKVASEPVGQRYRATDAVFTYVAVDEN 123

Query: 144 GNPKSI 149
            + + +
Sbjct: 124 NSSRPL 129


>gi|51244004|ref|YP_063888.1| acyl CoA thioester hydrolase [Desulfotalea psychrophila LSv54]
 gi|50875041|emb|CAG34881.1| probable acyl CoA thioester hydrolase [Desulfotalea psychrophila
           LSv54]
          Length = 148

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 72/127 (56%), Gaps = 4/127 (3%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G L L+   MP+D N +G++FGGWIMSQ+DIA GI A ++   R VT AV  ++F KP+
Sbjct: 9   AGELLLRTLAMPSDTNPNGDIFGGWIMSQMDIAGGILAKEISCARTVTVAVDSIVFIKPV 68

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK----TCEATVVMVAVDEKGN 145
            V D+V  + ++  IG TS+ I  +VWT   +AS            +A    VA+D  G 
Sbjct: 69  SVGDVVCCHGKVIHIGTTSMKINLEVWTKKTSASGTAHAHERFLVTKAAFTYVAIDAMGK 128

Query: 146 PKSIRTE 152
            + I  E
Sbjct: 129 KQVIDKE 135


>gi|15801479|ref|NP_287496.1| acyl-CoA thioester hydrolase [Escherichia coli O157:H7 EDL933]
 gi|15831007|ref|NP_309780.1| acyl-CoA thioester hydrolase [Escherichia coli O157:H7 str. Sakai]
 gi|168758178|ref|ZP_02783185.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4401]
 gi|168771723|ref|ZP_02796730.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4486]
 gi|168784164|ref|ZP_02809171.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4076]
 gi|168801566|ref|ZP_02826573.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC508]
 gi|195939140|ref|ZP_03084522.1| acyl-CoA thioester hydrolase [Escherichia coli O157:H7 str. EC4024]
 gi|208806154|ref|ZP_03248491.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4206]
 gi|208814907|ref|ZP_03256086.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4045]
 gi|208822303|ref|ZP_03262622.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4042]
 gi|209400218|ref|YP_002270185.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4115]
 gi|217328530|ref|ZP_03444612.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. TW14588]
 gi|254792723|ref|YP_003077560.1| acyl-CoA thioester hydrolase [Escherichia coli O157:H7 str.
           TW14359]
 gi|261224981|ref|ZP_05939262.1| esterase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261257161|ref|ZP_05949694.1| esterase [Escherichia coli O157:H7 str. FRIK966]
 gi|12514975|gb|AAG56108.1|AE005342_10 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13361218|dbj|BAB35176.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|188998616|gb|EDU67602.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4076]
 gi|189354987|gb|EDU73406.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4401]
 gi|189359589|gb|EDU78008.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4486]
 gi|189376311|gb|EDU94727.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC508]
 gi|208725955|gb|EDZ75556.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4206]
 gi|208731555|gb|EDZ80243.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4045]
 gi|208737788|gb|EDZ85471.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4042]
 gi|209161618|gb|ACI39051.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. EC4115]
 gi|209772168|gb|ACI84396.1| hypothetical protein ECs1753 [Escherichia coli]
 gi|209772170|gb|ACI84397.1| hypothetical protein ECs1753 [Escherichia coli]
 gi|209772172|gb|ACI84398.1| hypothetical protein ECs1753 [Escherichia coli]
 gi|209772176|gb|ACI84400.1| hypothetical protein ECs1753 [Escherichia coli]
 gi|217318957|gb|EEC27383.1| acyl-CoA thioesterase YciA [Escherichia coli O157:H7 str. TW14588]
 gi|254592123|gb|ACT71484.1| esterase [Escherichia coli O157:H7 str. TW14359]
 gi|320188045|gb|EFW62712.1| Acyl-CoA thioesterase YciA, involved in membrane biogenesis
           [Escherichia coli O157:H7 str. EC1212]
 gi|320637402|gb|EFX07209.1| acyl-CoA esterase [Escherichia coli O157:H7 str. G5101]
 gi|320642711|gb|EFX11932.1| acyl-CoA esterase [Escherichia coli O157:H- str. 493-89]
 gi|320648064|gb|EFX16744.1| acyl-CoA esterase [Escherichia coli O157:H- str. H 2687]
 gi|320664650|gb|EFX31801.1| acyl-CoA esterase [Escherichia coli O157:H7 str. LSU-61]
 gi|326344473|gb|EGD68224.1| Acyl-CoA thioesterase YciA, involved in membrane biogenesis
           [Escherichia coli O157:H7 str. 1044]
          Length = 132

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 72/124 (58%), Gaps = 3/124 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ 
Sbjct: 10  GDLVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  + G TSV+I  +VW   + AS  + Q  K  +A    VAVD +G P++
Sbjct: 70  VGDVVCCYARCVQKGTTSVSINIEVWV-KKVASEPIGQRYKATDALFKYVAVDPEGKPRA 128

Query: 149 IRTE 152
           +  E
Sbjct: 129 LPVE 132


>gi|259908316|ref|YP_002648672.1| Putative acyl-CoA thioester hydrolase [Erwinia pyrifoliae Ep1/96]
 gi|224963938|emb|CAX55443.1| Putative acyl-CoA thioester hydrolase [Erwinia pyrifoliae Ep1/96]
          Length = 142

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (59%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + L+   MP D N +G++FGGW+MSQ+D+   I A ++   RVVT  V  + F KP+ 
Sbjct: 10  GEMVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAGGRVVTVRVDGMTFMKPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGNPKS 148
           V D+V  + +  + G +SVT+  +VW   + +S  + Q+ C  EA  + VAVD +G P+ 
Sbjct: 70  VGDVVCCHARCVRTGTSSVTVNIEVWI-KKVSSEPIGQRYCTTEAVFIYVAVDSQGKPRP 128

Query: 149 I 149
           +
Sbjct: 129 L 129


>gi|308187023|ref|YP_003931154.1| acyl-CoA thioester hydrolase [Pantoea vagans C9-1]
 gi|308057533|gb|ADO09705.1| putative acyl-CoA thioester hydrolase [Pantoea vagans C9-1]
          Length = 140

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 72/122 (59%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + L+   MP D N +G++FGGW+MSQ+D+   I A ++ + RVVT  V  + F KP+ 
Sbjct: 10  GEMVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAEGRVVTVRVDGMSFMKPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKT---CEATVVMVAVDEKGNPK 147
           V D+V  +    + G +S+TI  +VW   +  SS+ + +T    EA  + VAVD +GN +
Sbjct: 70  VGDVVSCHASCLRTGNSSMTINVEVWI--KKVSSEPIGQTYCATEAVFIYVAVDNEGNSR 127

Query: 148 SI 149
            +
Sbjct: 128 PL 129


>gi|154246071|ref|YP_001417029.1| thioesterase superfamily protein [Xanthobacter autotrophicus Py2]
 gi|154160156|gb|ABS67372.1| thioesterase superfamily protein [Xanthobacter autotrophicus Py2]
          Length = 132

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 67/111 (60%), Gaps = 2/111 (1%)

Query: 39  TMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIY 98
            MP D N +G++FGGW+MSQ+D+A G  A++  + R  T AV  + F  P+ V D V ++
Sbjct: 19  AMPADTNPNGDIFGGWLMSQMDLAAGNVAARRSRGRAATVAVEAMSFLSPVAVGDEVSLF 78

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            ++ K+G+TS+ I  + W   R  +S+   K  EA    VA+DE+G P+ I
Sbjct: 79  ARVAKLGRTSMRIEVEAWR--RARASEQTTKVTEAVFTFVAIDEEGRPRPI 127


>gi|110835549|ref|YP_694408.1| acyl-CoA thioester hydrolase [Alcanivorax borkumensis SK2]
 gi|110648660|emb|CAL18136.1| acyl-CoA thioester hydrolase, putative [Alcanivorax borkumensis
           SK2]
          Length = 138

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 69/118 (58%), Gaps = 5/118 (4%)

Query: 34  TLKIQT--MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
           TL IQT  MP   N +G++FGGW++SQ+D+A  + A +  + RV T A+  + F +P+ V
Sbjct: 21  TLAIQTIAMPQSANWNGDIFGGWLVSQMDLAGAVTARKKARGRVATVAIDSMAFLRPVPV 80

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             +V  YTQ++ IG++S+ I  +VW       S  L K  E     VA+D+ G  +++
Sbjct: 81  GAVVSCYTQLQDIGRSSMQILVEVWI---REDSGTLSKVTEGHFTFVAIDDTGRTRAV 135


>gi|238785514|ref|ZP_04629496.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia bercovieri
           ATCC 43970]
 gi|238713556|gb|EEQ05586.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia bercovieri
           ATCC 43970]
          Length = 158

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 72/127 (56%), Gaps = 5/127 (3%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q   +G L L+   MP D N +G++FGGW+MSQ+DI   I+A ++   RVVT  V  + F
Sbjct: 21  QSLPNGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAHGRVVTVRVDGMTF 80

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ---KTCEATVVMVAVDE 142
            KP+ V D+V  Y +  K G +S+TI  +VW   +  SS+ +    +  EA    VAVD+
Sbjct: 81  LKPVAVGDVVCCYARCIKTGLSSITINIEVWV--KKVSSEPIGQRYRATEAVFTYVAVDD 138

Query: 143 KGNPKSI 149
            G  + +
Sbjct: 139 AGKARGL 145


>gi|304396097|ref|ZP_07377979.1| thioesterase superfamily protein [Pantoea sp. aB]
 gi|304356466|gb|EFM20831.1| thioesterase superfamily protein [Pantoea sp. aB]
          Length = 140

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 72/122 (59%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + L+   MP D N +G++FGGW+MSQ+D+   I A ++ + RVVT  V  + F KP+ 
Sbjct: 10  GEMVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAEGRVVTVRVDGMSFMKPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKT---CEATVVMVAVDEKGNPK 147
           V D+V  +    + G +S+TI  +VW   +  SS+ + +T    EA  + VAVD +GN +
Sbjct: 70  VGDVVSCHASCLRTGNSSMTINVEVWI--KKVSSEPIGQTYCATEAVFIYVAVDNEGNSR 127

Query: 148 SI 149
            +
Sbjct: 128 PL 129


>gi|315638698|ref|ZP_07893872.1| acyl-CoA thioester hydrolase YciA [Campylobacter upsaliensis JV21]
 gi|315481322|gb|EFU71952.1| acyl-CoA thioester hydrolase YciA [Campylobacter upsaliensis JV21]
          Length = 137

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 75/130 (57%), Gaps = 7/130 (5%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M   G   LKI  MP+D N +GN+FGGWI+SQID+A  I A +L   RVVT ++ +++F+
Sbjct: 1   MKDMGEPKLKIVAMPSDTNPEGNIFGGWILSQIDLAGAITARELSPERVVTISMDKVIFK 60

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC----EATVVMVAVDE 142
           +P+ V D++  Y +I K+G TS+ +  +V         D+   +C     A    ++VD+
Sbjct: 61  EPVYVGDILSCYAKIEKVGNTSIGVKIEVVV---QRVDDLGCTSCINVTSAFATYISVDK 117

Query: 143 KGNPKSIRTE 152
           +G  K I  E
Sbjct: 118 RGRKKPISKE 127


>gi|209964672|ref|YP_002297587.1| acyl-CoA thioester hydrolase, putative [Rhodospirillum centenum SW]
 gi|209958138|gb|ACI98774.1| acyl-CoA thioester hydrolase, putative [Rhodospirillum centenum SW]
          Length = 130

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 66/116 (56%), Gaps = 2/116 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            L+   MP D+N +G+VFGGW++SQ+D+A G+ A++  + RV T  +  + F +P+ + D
Sbjct: 14  ALRTFAMPRDLNGNGDVFGGWVLSQMDVAGGVIAARRAQGRVATIGIEAMKFHRPVSLGD 73

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V+ Y  + ++G TS+ +  DVW   R  ++    K  E     VA+ E   P+ +
Sbjct: 74  EVNCYCAVERVGTTSIRVKIDVWV--RRGAASQAYKVTEGVFTYVAIGEDRRPRPV 127


>gi|332283276|ref|YP_004415187.1| acyl-CoA hydrolase [Pusillimonas sp. T7-7]
 gi|330427229|gb|AEC18563.1| acyl-CoA hydrolase [Pusillimonas sp. T7-7]
          Length = 117

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 68/109 (62%), Gaps = 1/109 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           +++   P+D N+ G+VFGGWIM+Q+DIA  I +++    RV T AV    F++P+ V DL
Sbjct: 1   MRVMPQPSDANIHGDVFGGWIMAQVDIAGSIPSTRRAAGRVATIAVNAFTFKQPVFVGDL 60

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEK 143
           +  Y +I K+G TS+T+  +V+   +    +V+ K  EA +  VA D++
Sbjct: 61  LSFYAEIIKVGTTSITVSVEVYAERQRLELEVV-KVTEAILTYVATDDQ 108


>gi|283785455|ref|YP_003365320.1| acyl-coA thioester hydrolase [Citrobacter rodentium ICC168]
 gi|282948909|emb|CBG88512.1| putative acyl-coA thioester hydrolase [Citrobacter rodentium
           ICC168]
          Length = 120

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 69/117 (58%), Gaps = 3/117 (2%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           ++   MP D N +G++FGGW+MSQ+DI   I+A ++   RVVT  V  + F +P+ V D+
Sbjct: 1   MRTLAMPADTNANGDIFGGWLMSQMDIGGAIQAKEIAHGRVVTVRVEGMSFLRPVAVGDV 60

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKSI 149
           V  Y +  K G TSV+I  +VW   + AS  + Q  K  EA  + VAVD  G P+ +
Sbjct: 61  VCCYARCVKRGTTSVSINIEVWV-KKVASEPIGQRYKATEALFIYVAVDADGKPRPL 116


>gi|255067087|ref|ZP_05318942.1| acyl-CoA thioester hydrolase YciA [Neisseria sicca ATCC 29256]
 gi|255048683|gb|EET44147.1| acyl-CoA thioester hydrolase YciA [Neisseria sicca ATCC 29256]
          Length = 145

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 2/125 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
            G L L+   MP D N + ++FGGWIMSQ+D+  GI A+++ + R+VT AV E+ F +P+
Sbjct: 12  QGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAAEIAQGRIVTVAVQEMNFIRPV 71

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           +V ++V  Y +   +G TS+ +  +VW  T   +  ++  Q   EA    VA+D +GN +
Sbjct: 72  KVGNVVCCYGRCVSVGNTSLQLKIEVWVKTLMNDHLTEDRQLVTEAVFTYVAIDSEGNKR 131

Query: 148 SIRTE 152
            I  E
Sbjct: 132 PIPKE 136


>gi|225023208|ref|ZP_03712400.1| hypothetical protein EIKCOROL_00060 [Eikenella corrodens ATCC
           23834]
 gi|224944032|gb|EEG25241.1| hypothetical protein EIKCOROL_00060 [Eikenella corrodens ATCC
           23834]
          Length = 146

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 74/127 (58%), Gaps = 2/127 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
              G L L+   MP+D N + ++FGGWIMSQ+D+  GI A+++ + R+ T    E+ F +
Sbjct: 11  QPQGELLLRTVAMPSDTNPNQDIFGGWIMSQMDLGGGILAAEIAQGRIATVCAQEMNFIR 70

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           P++V ++V  Y +  ++G TS+ +  +VW  T   +  ++  +   EA    VA+D +GN
Sbjct: 71  PVKVGNVVCCYGRCVRVGNTSLQLKLEVWVKTLMNDHVTETRELVTEAMFTYVAIDAQGN 130

Query: 146 PKSIRTE 152
           P+ +  E
Sbjct: 131 PRPVPKE 137


>gi|311104021|ref|YP_003976874.1| thioesterase superfamily protein 3 [Achromobacter xylosoxidans A8]
 gi|310758710|gb|ADP14159.1| thioesterase superfamily protein 3 [Achromobacter xylosoxidans A8]
          Length = 136

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 70/117 (59%), Gaps = 1/117 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++  MP D N+ G+VFGGWIMSQ+DIA  I A++    RV T AV    F++P+ V DL
Sbjct: 20  LRVMPMPADANIHGDVFGGWIMSQVDIAGSIPAARRAAGRVATVAVNAFQFKEPVFVGDL 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           +  Y  I K G TSVT+  +V+   +   ++++ K  EAT+  VA DE    + + T
Sbjct: 80  LSFYAAITKTGTTSVTVSVEVYAERQRLDAEIV-KVTEATLTYVATDEARRRRPLPT 135


>gi|145628276|ref|ZP_01784077.1| Trp operon repressor [Haemophilus influenzae 22.1-21]
 gi|144980051|gb|EDJ89710.1| Trp operon repressor [Haemophilus influenzae 22.1-21]
          Length = 106

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 58/89 (65%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            S GVL L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F K
Sbjct: 12  QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIK 71

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVW 116
           PI V D+V  Y +  K+G++S+ I  +VW
Sbjct: 72  PISVGDVVCCYGECLKVGRSSIKIKVEVW 100


>gi|90023398|ref|YP_529225.1| putative acyl-CoA thioester hydrolase [Saccharophagus degradans
           2-40]
 gi|89952998|gb|ABD83013.1| thioesterase superfamily [Saccharophagus degradans 2-40]
          Length = 134

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 70/120 (58%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G L L+   +P D N +G+VFGGW+MSQ+D+A  I A +L K RV T AV  + F +P+
Sbjct: 13  TGELVLQTLALPKDTNSNGDVFGGWLMSQMDLAGAIAARELAKGRVTTVAVGAMHFLRPV 72

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V   V  Y +I ++G++S+    +VW   ++ S +  QK  +   V V++D  G  + +
Sbjct: 73  PVGATVSCYCEILEVGRSSIKALIEVWV--KHYSFEEQQKVTDGEFVYVSIDNAGRTRPV 130


>gi|37526376|ref|NP_929720.1| acyl-CoA thioester hydrolase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785807|emb|CAE14858.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 143

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 69/122 (56%), Gaps = 3/122 (2%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  Q   +G L L+   MP D N +G++FGGW+MSQ+DI   I A ++ + RVVT  V  
Sbjct: 1   MTQQQLPNGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAEGRVVTVRVDG 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAV 140
           + F KP+ V D+V  Y    K G +S+TI  +VW   + AS  V Q  +  EA    VAV
Sbjct: 61  ITFLKPVAVGDVVCCYAHCLKTGNSSITINIEVW-VKKVASEPVGQRYRATEAVFTYVAV 119

Query: 141 DE 142
           +E
Sbjct: 120 NE 121


>gi|300896109|ref|ZP_07114664.1| thioesterase family protein [Escherichia coli MS 198-1]
 gi|300359996|gb|EFJ75866.1| thioesterase family protein [Escherichia coli MS 198-1]
          Length = 114

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 68/115 (59%), Gaps = 3/115 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ V D+V  Y 
Sbjct: 1   MPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYA 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKSIRTE 152
           +  + G TSV+I  DVW   + AS  + Q  K  EA    VAVD +G P+++  E
Sbjct: 61  RCVQKGTTSVSINIDVWV-KKVASEPIGQRYKATEALFKYVAVDPEGKPRALPVE 114


>gi|315499543|ref|YP_004088346.1| thioesterase superfamily protein [Asticcacaulis excentricus CB 48]
 gi|315417555|gb|ADU14195.1| thioesterase superfamily protein [Asticcacaulis excentricus CB 48]
          Length = 140

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 68/118 (57%), Gaps = 2/118 (1%)

Query: 32  VLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
           ++ ++   MP D N  G++FGGW+MSQ+D+A G  A++    R  T AV  + F  P++V
Sbjct: 22  LIAIRTIAMPADTNPAGDIFGGWLMSQMDLAAGNVAARRAVGRAATIAVEGMTFHTPVRV 81

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            D V +Y ++   G+TS+ I+   W   R+  SDV  K  +A    VA+DE GN + +
Sbjct: 82  GDEVSVYAELISTGRTSMKIHVQAWR--RSRDSDVRIKVTDADFTFVAIDENGNSRPL 137


>gi|187479333|ref|YP_787358.1| acyl-CoA thioesterase [Bordetella avium 197N]
 gi|115423920|emb|CAJ50472.1| putative acyl-CoA thioesterase [Bordetella avium 197N]
          Length = 134

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 71/117 (60%), Gaps = 1/117 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++  MP D N+ G+VFGGWIM+Q+DIA  I A++    RV T AV    F++P+ V DL
Sbjct: 18  LRVMPMPADANIHGDVFGGWIMAQVDIAGSIPAARRAAGRVATVAVNAFQFKQPVFVGDL 77

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           +  Y QI K G TSVT+  +V+   +   ++V+ K  +AT+  VA D+    + + T
Sbjct: 78  LSFYAQIVKTGNTSVTVEVEVYAQRQRLDAEVV-KVTDATLTYVATDDARRSRPLPT 133


>gi|254428362|ref|ZP_05042069.1| thioesterase family protein [Alcanivorax sp. DG881]
 gi|196194531|gb|EDX89490.1| thioesterase family protein [Alcanivorax sp. DG881]
          Length = 131

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 69/118 (58%), Gaps = 5/118 (4%)

Query: 34  TLKIQT--MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
           TL IQT  MP   N +G++FGGW++SQ+D+A  + A +  + RV T A+  + F +P+ V
Sbjct: 14  TLAIQTIAMPQSANWNGDIFGGWLVSQMDLAGAVTARKKARGRVATVAIDSMAFLRPVPV 73

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             +V  YTQ++ IG++S+ I  +VW       +  L K  E     VA+D+ G  +++
Sbjct: 74  GAVVSCYTQLQDIGRSSMQILVEVWV---REDTGTLSKVTEGHFTFVAIDDTGRTRAV 128


>gi|254515939|ref|ZP_05127999.1| acyl-CoA thioester hydrolase YciA [gamma proteobacterium NOR5-3]
 gi|219675661|gb|EED32027.1| acyl-CoA thioester hydrolase YciA [gamma proteobacterium NOR5-3]
          Length = 131

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 68/120 (56%), Gaps = 4/120 (3%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N  G++FGGW++SQ+D+A  I A ++ K RV T A+  + F  P+Q
Sbjct: 12  GELALQTIAMPRDTNASGDIFGGWLLSQMDLAGAITAGEVAKGRVATVAIDGMAFITPVQ 71

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVW-TCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V  +V  Y  + +IG++SV I  +VW   P +       K  E   V VA+DE+   ++I
Sbjct: 72  VGAVVSCYCDVIEIGRSSVRIMVEVWINSPHDGEP---IKVTEGEFVFVAIDEQRRTRTI 128


>gi|293603463|ref|ZP_06685888.1| thioesterase [Achromobacter piechaudii ATCC 43553]
 gi|292818165|gb|EFF77221.1| thioesterase [Achromobacter piechaudii ATCC 43553]
          Length = 136

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 67/108 (62%), Gaps = 1/108 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++  MP D N+ G+VFGGWIM+Q+DIA  I A++    RV T AV    F++P+ V DL
Sbjct: 20  LRVMPMPADANIHGDVFGGWIMAQVDIAGSIPAARRAAGRVATVAVNAFQFKEPVFVGDL 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           +  Y  I K G TSVT+  +V+   +   ++V+ K  EAT+  VA DE
Sbjct: 80  LSFYAAIVKTGTTSVTVSVEVYAERQRLDAEVV-KVTEATLTYVATDE 126


>gi|33593762|ref|NP_881406.1| putative thioesterase [Bordetella pertussis Tohama I]
 gi|33598243|ref|NP_885886.1| putative thioesterase [Bordetella parapertussis 12822]
 gi|33603154|ref|NP_890714.1| putative thioesterase [Bordetella bronchiseptica RB50]
 gi|33563835|emb|CAE43080.1| putative thioesterase [Bordetella pertussis Tohama I]
 gi|33566801|emb|CAE39016.1| putative thioesterase [Bordetella parapertussis]
 gi|33568785|emb|CAE34543.1| putative thioesterase [Bordetella bronchiseptica RB50]
 gi|332383164|gb|AEE68011.1| putative thioesterase [Bordetella pertussis CS]
          Length = 136

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 70/117 (59%), Gaps = 1/117 (0%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++  MP D N+ G+VFGGWIM+Q+DIA  I A++    RV T AV    F++P+ V DL
Sbjct: 20  LRVMPMPADANIHGDVFGGWIMAQVDIAGSIPAARRAAGRVATVAVNAFQFKQPVFVGDL 79

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           +  YT I + G TSVT+  +V+   +   ++V+ K  EA +  VA DE    + + T
Sbjct: 80  LSFYTSITRTGTTSVTVSVEVYAERQRLDAEVV-KVTEAVLTYVATDEARRSRPLPT 135


>gi|329894797|ref|ZP_08270597.1| acyl-CoA thioester hydrolase [gamma proteobacterium IMCC3088]
 gi|328922691|gb|EGG30025.1| acyl-CoA thioester hydrolase [gamma proteobacterium IMCC3088]
          Length = 134

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 68/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L++  MP D N DG+++GGW++ Q+D+A G  A ++   RV T AV+ + F  P+ 
Sbjct: 14  GDLALQVVAMPKDTNADGDIYGGWLLQQMDMAGGAIAREVAGGRVATVAVSGMSFLTPVH 73

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  +V  Y  + ++G++S+ +  +VW   ++    +  K  E   V VA+D+ G  + I
Sbjct: 74  LGAIVSCYADVLEVGRSSIRMVVEVWISSKHDGEPI--KVTEGVFVFVAIDQNGRTRQI 130


>gi|218549054|ref|YP_002382845.1| acyl-CoA thioester hydrolase [Escherichia fergusonii ATCC 35469]
 gi|218356595|emb|CAQ89217.1| putative hydrolase [Escherichia fergusonii ATCC 35469]
 gi|324113128|gb|EGC07103.1| thioesterase superfamily protein [Escherichia fergusonii B253]
 gi|325497469|gb|EGC95328.1| acyl-CoA thioester hydrolase [Escherichia fergusonii ECD227]
          Length = 132

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 68/121 (56%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ 
Sbjct: 10  GDLVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +    G TSV+I  +VW   + AS  + Q  K  EA    VAVD  G P+ 
Sbjct: 70  VGDVVCCYARCVNKGTTSVSINIEVWV-KKVASEPIGQRYKATEALFKYVAVDPDGKPRP 128

Query: 149 I 149
           +
Sbjct: 129 L 129


>gi|182678266|ref|YP_001832412.1| thioesterase superfamily protein [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634149|gb|ACB94923.1| thioesterase superfamily protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 136

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G   ++   MP D N  G++FGGW+MSQ+D+A G  AS + + R  T     ++F  P+
Sbjct: 10  NGAPVIRTIAMPADTNPAGDIFGGWLMSQMDLAAGSVASLVSRGRAATIKAEAMVFHSPV 69

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V D V ++ ++ K G+TS+ I  + W   R+  S    K  EA    VA+DE   P+ +
Sbjct: 70  FVGDEVSLFGRLIKRGRTSMQIEVEAWR--RSRDSHETTKVTEAIFTFVAIDEHRRPRPL 127


>gi|170768048|ref|ZP_02902501.1| acyl-CoA thioester hydrolase YciA [Escherichia albertii TW07627]
 gi|170122814|gb|EDS91745.1| acyl-CoA thioester hydrolase YciA [Escherichia albertii TW07627]
          Length = 132

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 70/121 (57%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ 
Sbjct: 10  GDLVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  + G TSV+I  +VW   + AS  + Q  K  EA    VAV+ +G P+ 
Sbjct: 70  VGDVVCCYARCVQKGTTSVSINIEVWV-KKVASEPIGQRYKATEALFKYVAVNSEGKPRP 128

Query: 149 I 149
           +
Sbjct: 129 L 129


>gi|329297672|ref|ZP_08255008.1| thioesterase superfamily protein [Plautia stali symbiont]
          Length = 138

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 69/122 (56%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G +  +   MP D N +G++FGGW+MSQ+D+   I A ++ K RVVT  V  + F KP+ 
Sbjct: 10  GEMVSRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAKGRVVTVRVDGMTFLKPVA 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKT---CEATVVMVAVDEKGNPK 147
           V D+V  Y    + G +S+TI  +VW   +  SS+ + +T    EA  V VAVD  G  +
Sbjct: 70  VGDVVSCYAHCIRTGNSSMTINVEVWI--KKVSSEPIGQTYCATEAVFVYVAVDNSGKSR 127

Query: 148 SI 149
            +
Sbjct: 128 PL 129


>gi|290475419|ref|YP_003468307.1| thioesterase/thiol ester dehydrase-isomerase domain-containing
           protein [Xenorhabdus bovienii SS-2004]
 gi|289174740|emb|CBJ81539.1| putative enzyme with thioesterase/thiol ester dehydrase-isomerase
           domain [Xenorhabdus bovienii SS-2004]
          Length = 144

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 72/122 (59%), Gaps = 3/122 (2%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G L L+   MP D N +G++FGGW+MSQ+DI   I A ++ + RVVT +V  + F KP+
Sbjct: 9   NGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAEGRVVTVSVDGISFLKPV 68

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPK 147
            V D+V  Y +  K G +S+TI+ +VW   + AS  V Q  +  +A    VAV+E    +
Sbjct: 69  AVGDVVCCYARCLKTGNSSITIHIEVWV-KKVASDPVGQRYRATDAVFTYVAVNEDNTSR 127

Query: 148 SI 149
            +
Sbjct: 128 RL 129


>gi|15616885|ref|NP_240098.1| hypothetical protein BU274 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681640|ref|YP_002468026.1| acyl-CoA thioesterase (YciA) [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682197|ref|YP_002468581.1| acyl-CoA thioesterase (YciA) [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471328|ref|ZP_05635327.1| acyl-CoA thioesterase (YciA) [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|12644598|sp|P57362|Y274_BUCAI RecName: Full=Uncharacterized acyl-CoA thioester hydrolase BU274
 gi|25349131|pir||H84961 hypothetical protein [imported] - Buchnera sp. (strain APS)
 gi|10038949|dbj|BAB12984.1| hypothetical protein [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
 gi|219621930|gb|ACL30086.1| acyl-CoA thioesterase (YciA) [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624483|gb|ACL30638.1| acyl-CoA thioesterase (YciA) [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311086012|gb|ADP66094.1| acyl-CoA thioesterase (YciA) [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086587|gb|ADP66668.1| acyl-CoA thioesterase (YciA) [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087168|gb|ADP67248.1| acyl-CoA thioesterase (YciA) [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087699|gb|ADP67778.1| acyl-CoA thioesterase (YciA) [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 135

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 72/121 (59%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G++ LK  +MP ++N +G++FGGWIMSQ+D+   I A ++   +V T  V  + F K + 
Sbjct: 10  GIIVLKTLSMPENINANGDIFGGWIMSQMDLGGAILAKEISGGKVATVRVDSINFLKSVS 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGNPKS 148
           V D+V+ Y    KIGK+S+ I  ++W   +  S  + Q  C  EA  + VA+++ G P+ 
Sbjct: 70  VGDIVNCYANCIKIGKSSIKINVEIWI-KKIYSKPLGQYYCAAEAIFIYVAINKTGQPRE 128

Query: 149 I 149
           +
Sbjct: 129 L 129


>gi|227886317|ref|ZP_04004122.1| possible hydrolase [Escherichia coli 83972]
 gi|300819663|ref|ZP_07099854.1| thioesterase family protein [Escherichia coli MS 107-1]
 gi|300822584|ref|ZP_07102723.1| thioesterase family protein [Escherichia coli MS 119-7]
 gi|300904151|ref|ZP_07122023.1| thioesterase family protein [Escherichia coli MS 84-1]
 gi|300919431|ref|ZP_07135933.1| thioesterase family protein [Escherichia coli MS 115-1]
 gi|300926632|ref|ZP_07142410.1| thioesterase family protein [Escherichia coli MS 182-1]
 gi|300927757|ref|ZP_07143322.1| thioesterase family protein [Escherichia coli MS 187-1]
 gi|300936984|ref|ZP_07151860.1| thioesterase family protein [Escherichia coli MS 21-1]
 gi|300951940|ref|ZP_07165742.1| thioesterase family protein [Escherichia coli MS 116-1]
 gi|300955882|ref|ZP_07168220.1| thioesterase family protein [Escherichia coli MS 175-1]
 gi|300971738|ref|ZP_07171607.1| thioesterase family protein [Escherichia coli MS 200-1]
 gi|300982427|ref|ZP_07176124.1| thioesterase family protein [Escherichia coli MS 45-1]
 gi|301019460|ref|ZP_07183631.1| thioesterase family protein [Escherichia coli MS 69-1]
 gi|301028128|ref|ZP_07191402.1| thioesterase family protein [Escherichia coli MS 196-1]
 gi|301046916|ref|ZP_07194030.1| thioesterase family protein [Escherichia coli MS 185-1]
 gi|301304796|ref|ZP_07210902.1| thioesterase family protein [Escherichia coli MS 124-1]
 gi|301327025|ref|ZP_07220311.1| thioesterase family protein [Escherichia coli MS 78-1]
 gi|301647253|ref|ZP_07247072.1| thioesterase family protein [Escherichia coli MS 146-1]
 gi|309789094|ref|ZP_07683688.1| thioesterase superfamily protein [Shigella dysenteriae 1617]
 gi|309794346|ref|ZP_07688770.1| thioesterase family protein [Escherichia coli MS 145-7]
 gi|312971442|ref|ZP_07785617.1| thioesterase superfamily protein [Escherichia coli 1827-70]
 gi|227836521|gb|EEJ46987.1| possible hydrolase [Escherichia coli 83972]
 gi|299878797|gb|EFI87008.1| thioesterase family protein [Escherichia coli MS 196-1]
 gi|300301142|gb|EFJ57527.1| thioesterase family protein [Escherichia coli MS 185-1]
 gi|300309341|gb|EFJ63861.1| thioesterase family protein [Escherichia coli MS 200-1]
 gi|300317259|gb|EFJ67043.1| thioesterase family protein [Escherichia coli MS 175-1]
 gi|300399247|gb|EFJ82785.1| thioesterase family protein [Escherichia coli MS 69-1]
 gi|300403877|gb|EFJ87415.1| thioesterase family protein [Escherichia coli MS 84-1]
 gi|300408765|gb|EFJ92303.1| thioesterase family protein [Escherichia coli MS 45-1]
 gi|300413489|gb|EFJ96799.1| thioesterase family protein [Escherichia coli MS 115-1]
 gi|300417357|gb|EFK00668.1| thioesterase family protein [Escherichia coli MS 182-1]
 gi|300448833|gb|EFK12453.1| thioesterase family protein [Escherichia coli MS 116-1]
 gi|300457927|gb|EFK21420.1| thioesterase family protein [Escherichia coli MS 21-1]
 gi|300464198|gb|EFK27691.1| thioesterase family protein [Escherichia coli MS 187-1]
 gi|300525000|gb|EFK46069.1| thioesterase family protein [Escherichia coli MS 119-7]
 gi|300527749|gb|EFK48811.1| thioesterase family protein [Escherichia coli MS 107-1]
 gi|300839917|gb|EFK67677.1| thioesterase family protein [Escherichia coli MS 124-1]
 gi|300846356|gb|EFK74116.1| thioesterase family protein [Escherichia coli MS 78-1]
 gi|301074615|gb|EFK89421.1| thioesterase family protein [Escherichia coli MS 146-1]
 gi|308122251|gb|EFO59513.1| thioesterase family protein [Escherichia coli MS 145-7]
 gi|308923031|gb|EFP68544.1| thioesterase superfamily protein [Shigella dysenteriae 1617]
 gi|310336039|gb|EFQ01239.1| thioesterase superfamily protein [Escherichia coli 1827-70]
 gi|313649444|gb|EFS13875.1| thioesterase superfamily protein [Shigella flexneri 2a str. 2457T]
 gi|315254788|gb|EFU34756.1| thioesterase family protein [Escherichia coli MS 85-1]
 gi|315288654|gb|EFU48052.1| thioesterase family protein [Escherichia coli MS 110-3]
 gi|315295213|gb|EFU54548.1| thioesterase family protein [Escherichia coli MS 153-1]
 gi|315297280|gb|EFU56560.1| thioesterase family protein [Escherichia coli MS 16-3]
 gi|315615902|gb|EFU96528.1| thioesterase superfamily protein [Escherichia coli 3431]
 gi|320173164|gb|EFW48378.1| Acyl-CoA thioesterase YciA, involved in membrane biogenesis
           [Shigella dysenteriae CDC 74-1112]
 gi|320181692|gb|EFW56603.1| Acyl-CoA thioesterase YciA, involved in membrane biogenesis
           [Shigella boydii ATCC 9905]
 gi|320187661|gb|EFW62340.1| Acyl-CoA thioesterase YciA, involved in membrane biogenesis
           [Shigella flexneri CDC 796-83]
 gi|320199289|gb|EFW73880.1| Acyl-CoA thioesterase YciA, involved in membrane biogenesis
           [Escherichia coli EC4100B]
 gi|323153209|gb|EFZ39470.1| thioesterase superfamily protein [Escherichia coli EPECa14]
 gi|323162385|gb|EFZ48240.1| thioesterase superfamily protein [Escherichia coli E128010]
 gi|323168427|gb|EFZ54108.1| thioesterase superfamily protein [Shigella sonnei 53G]
 gi|323172392|gb|EFZ58029.1| thioesterase superfamily protein [Escherichia coli LT-68]
 gi|323178034|gb|EFZ63616.1| thioesterase superfamily protein [Escherichia coli 1180]
 gi|323185587|gb|EFZ70948.1| thioesterase superfamily protein [Escherichia coli 1357]
 gi|323187488|gb|EFZ72797.1| thioesterase superfamily protein [Escherichia coli RN587/1]
 gi|324011264|gb|EGB80483.1| thioesterase family protein [Escherichia coli MS 60-1]
 gi|324018960|gb|EGB88179.1| thioesterase family protein [Escherichia coli MS 117-3]
 gi|330911124|gb|EGH39634.1| acyl-CoA thioesterase YciA, involved in membrane biogenesis
           [Escherichia coli AA86]
 gi|332091644|gb|EGI96724.1| thioesterase superfamily protein [Shigella boydii 5216-82]
 gi|332094861|gb|EGI99905.1| thioesterase superfamily protein [Shigella boydii 3594-74]
 gi|332757906|gb|EGJ88233.1| thioesterase superfamily protein [Shigella flexneri 4343-70]
 gi|332759493|gb|EGJ89801.1| thioesterase superfamily protein [Shigella flexneri 2747-71]
 gi|332760348|gb|EGJ90638.1| thioesterase superfamily protein [Shigella flexneri K-671]
 gi|332767487|gb|EGJ97681.1| acyl-CoA thioesterase [Shigella flexneri 2930-71]
 gi|333004568|gb|EGK24092.1| thioesterase superfamily protein [Shigella flexneri VA-6]
 gi|333007591|gb|EGK27069.1| thioesterase superfamily protein [Shigella flexneri K-272]
 gi|333019525|gb|EGK38805.1| thioesterase superfamily protein [Shigella flexneri K-227]
          Length = 114

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 68/115 (59%), Gaps = 3/115 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ V D+V  Y 
Sbjct: 1   MPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYA 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKSIRTE 152
           +  + G TSV+I  +VW   + AS  + Q  K  EA    VAVD +G P+++  E
Sbjct: 61  RCVQKGTTSVSINIEVWV-KKVASEPIGQRYKATEALFKYVAVDPEGKPRALPVE 114


>gi|90415305|ref|ZP_01223239.1| hypothetical protein GB2207_08316 [marine gamma proteobacterium
           HTCC2207]
 gi|90332628|gb|EAS47798.1| hypothetical protein GB2207_08316 [marine gamma proteobacterium
           HTCC2207]
          Length = 129

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 67/122 (54%), Gaps = 2/122 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           SG L  +   MP + N +G++FGGW++SQ+D+A  I A ++ K RV T A++ + F  P+
Sbjct: 9   SGKLISQTIAMPRETNANGDIFGGWLLSQMDLAGAILAGRIGKGRVATVAISSMSFLNPV 68

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V  +V  Y Q   +G +S+ I  + W    N +     K  E   V VA+D+ GN + +
Sbjct: 69  PVGAVVGCYAQTLSVGTSSIRILIEAWI--DNDAEGEQSKVTEGEFVFVAIDDNGNTREV 126

Query: 150 RT 151
            T
Sbjct: 127 PT 128


>gi|126642970|ref|YP_001085954.1| hypothetical protein A1S_2947 [Acinetobacter baumannii ATCC 17978]
          Length = 122

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 65/113 (57%), Gaps = 2/113 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  G+VFGGWI+SQ+D+A  I A +  + R  T ++ ++ F  P++V  ++  YT
Sbjct: 1   MPADTNWSGDVFGGWIVSQMDLAGAIHAERFSRGRCATISINQMTFLVPVKVGFVISCYT 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           +I K+G TS+ +  +VW    ++   +  +  E     VAVD KGN + I  E
Sbjct: 61  KILKVGNTSIQMQIEVWDSHDDSREPI--RITEGVFTFVAVDVKGNKRQIPEE 111


>gi|260363744|ref|ZP_05776520.1| acyl-CoA thioester hydrolase YciA [Vibrio parahaemolyticus K5030]
 gi|308114911|gb|EFO52451.1| acyl-CoA thioester hydrolase YciA [Vibrio parahaemolyticus K5030]
          Length = 93

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGWIMSQ+D+A  I A ++C  RVVT +V+ + F+KP+ 
Sbjct: 10  GQLLLRTLAMPADTNANGDIFGGWIMSQLDLAGAILAKEICSGRVVTVSVSSITFKKPVS 69

Query: 91  VSDLVHIYTQIRKIGKTSVTI 111
           V D+V  Y   +KIG+TS+++
Sbjct: 70  VGDVVCCYGVCKKIGRTSMSV 90


>gi|123442480|ref|YP_001006459.1| putative acyl-CoA thioester hydrolase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122089441|emb|CAL12289.1| putative acyl-CoA thioester hydrolase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 124

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 69/113 (61%), Gaps = 5/113 (4%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N +G++FGGW+MSQ+DI   I+A ++ + RVVT  V  + F KP+ V D+V  Y 
Sbjct: 1   MPADTNANGDIFGGWLMSQMDIGGAIQAKEIAQGRVVTVRVDGMTFLKPVAVGDVVCCYA 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEKGNPKSI 149
           +  K G++S+TI  +VW   +  SS+ +    K  EA    VAVD+ G  +++
Sbjct: 61  RCIKSGRSSITINIEVWV--KKVSSEPIGQRYKATEAVFTYVAVDDIGKARAL 111


>gi|256825331|ref|YP_003149291.1| acyl-CoA hydrolase [Kytococcus sedentarius DSM 20547]
 gi|256688724|gb|ACV06526.1| acyl-CoA hydrolase [Kytococcus sedentarius DSM 20547]
          Length = 152

 Score = 85.9 bits (211), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 66/115 (57%), Gaps = 2/115 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           +++  MP D N+ G++FGGW+M+Q+D+A    AS+  + R  T AV  + F +P+ V   
Sbjct: 37  IRVTAMPGDANMYGDIFGGWLMAQMDLAASSVASRRSRGRAATVAVQSMSFHRPVMVGAE 96

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V +Y ++   G+TS+ +    W+  R+A  + L    E T   VA D+ G P+++
Sbjct: 97  VSVYAELVHEGRTSLQVTVQAWSRDRHAEDEHLITRGEFT--FVATDDAGRPRAL 149


>gi|320195731|gb|EFW70356.1| Acyl-CoA thioesterase YciA, involved in membrane biogenesis
           [Escherichia coli WV_060327]
          Length = 114

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 68/115 (59%), Gaps = 3/115 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ V D+V  Y 
Sbjct: 1   MPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYA 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKSIRTE 152
           +  + G TSV+I  +VW   + AS  + Q  K  EA    VAVD +G P+++  E
Sbjct: 61  RCIQKGTTSVSINIEVWV-KKVASEPIGQRYKATEALFKYVAVDPEGKPRALPIE 114


>gi|238757057|ref|ZP_04618245.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia aldovae ATCC
           35236]
 gi|238704887|gb|EEP97416.1| Uncharacterized acyl-CoA thioester hydrolase [Yersinia aldovae ATCC
           35236]
          Length = 124

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 68/113 (60%), Gaps = 5/113 (4%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N +G++FGGW+MSQ+DI   I+A ++   RVVT  V  + F KP+ V D+V  Y 
Sbjct: 1   MPADTNANGDIFGGWLMSQMDIGGAIQAKEIAHGRVVTVRVDGMTFLKPVAVGDVVCCYA 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVL---QKTCEATVVMVAVDEKGNPKSI 149
           +  K G++S+TI  +VW   +  SS+ +    +  EA    VAVD+ G  +++
Sbjct: 61  RCIKTGRSSITINIEVWV--KKVSSEPIGQRYRATEAIFTYVAVDDAGKARAL 111


>gi|332098064|gb|EGJ03037.1| thioesterase superfamily protein [Shigella dysenteriae 155-74]
          Length = 114

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 68/115 (59%), Gaps = 3/115 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ V D+V  Y 
Sbjct: 1   MPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYA 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKSIRTE 152
           +  + G TS++I  +VW   + AS  + Q  K  EA    VAVD +G P+++  E
Sbjct: 61  RCVQKGTTSISINIEVWV-KKVASEPIGQRYKATEALFKYVAVDPEGKPRALPVE 114


>gi|88799188|ref|ZP_01114768.1| Thioesterase superfamily protein [Reinekea sp. MED297]
 gi|88778171|gb|EAR09366.1| Thioesterase superfamily protein [Reinekea sp. MED297]
          Length = 139

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L++   P D N +G++ GGW+++Q+D A  I A++L   R  T A+ ++ F +PI+
Sbjct: 13  GELQLRVMARPADANPNGDISGGWLVTQMDTAASIVANRLSNGRTATMAIGDMSFVRPIK 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V  +V  YT +  +G++SV I  +VW+  R    +  QK  EA  V VA+D+    +S+
Sbjct: 73  VGSVVCCYTHVISMGRSSVRIMVEVWS--RMPEDEERQKVTEAEFVYVAIDDNRRIRSL 129


>gi|254282422|ref|ZP_04957390.1| acyl-CoA thioester hydrolase YciA [gamma proteobacterium NOR51-B]
 gi|219678625|gb|EED34974.1| acyl-CoA thioester hydrolase YciA [gamma proteobacterium NOR51-B]
          Length = 131

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 66/122 (54%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N  G++FGGW++SQ+D+A  I A +    R+ T A+  + F  P+ 
Sbjct: 12  GDLALQTIAMPKDTNASGDIFGGWLLSQMDLAGAITAEETAGRRIATVAIEGMAFLTPVH 71

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V  +V  Y  + +IG++S+ I  +VW   R+    +  K  E   V VA+DE G  + I 
Sbjct: 72  VGAVVSCYCDVIEIGRSSMRIVVEVWINSRHDGEPI--KVTEGIFVFVAIDENGRTRHIN 129

Query: 151 TE 152
            +
Sbjct: 130 PD 131


>gi|77164342|ref|YP_342867.1| thioesterase superfamily protein [Nitrosococcus oceani ATCC 19707]
 gi|254434438|ref|ZP_05047946.1| thioesterase family protein [Nitrosococcus oceani AFC27]
 gi|76882656|gb|ABA57337.1| Thioesterase superfamily [Nitrosococcus oceani ATCC 19707]
 gi|207090771|gb|EDZ68042.1| thioesterase family protein [Nitrosococcus oceani AFC27]
          Length = 139

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 66/116 (56%), Gaps = 1/116 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            L+I   PTD N  G++FGGW+MS  DIA  I A +  + R+VT AV +  F +P+ V D
Sbjct: 10  ALRILARPTDTNAAGDIFGGWLMSWTDIAGSIVAFRRARGRIVTVAVKDFDFIQPVYVDD 69

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           LV  Y +I K+G TS+T+   V+   R    +  ++   A +V VA+ +   P+ +
Sbjct: 70  LVSFYAEITKVGHTSLTVEVMVY-AERKRGKETCERVASARLVYVALGKDRRPRPV 124


>gi|288958483|ref|YP_003448824.1| acyl-CoA thioesterase [Azospirillum sp. B510]
 gi|288910791|dbj|BAI72280.1| acyl-CoA thioesterase [Azospirillum sp. B510]
          Length = 131

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 64/119 (53%), Gaps = 1/119 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            L+   MP D N +G++FGGW+++Q+D+A G  A +    RV T  +  + F KP+ V D
Sbjct: 14  ALRAIAMPGDTNPNGDIFGGWLLAQMDLAGGTVAVRRSHGRVATVGIEAMTFHKPVFVGD 73

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
            V  + +I K+G+TS+ +  + W     + SD + K  E     VA+ E   P+ +  E
Sbjct: 74  EVSCFARIEKVGRTSLRVRIETWVRRERSGSDPI-KVTEGVFTYVAIGEDRKPREVPPE 131


>gi|330806790|ref|YP_004351252.1| thioesterase [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327374898|gb|AEA66248.1| Putative thioesterase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 134

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G++FGGW++SQ+D+A    AS++   RV T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIFGGWLVSQMDLAGTAMASKVAGGRVATVAIDRMAFLVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   +  YTQ  +IG++S+ +  +VW+   +  S   +K  EA  V VA+D  G  +S+
Sbjct: 73  VGAQLSFYTQALEIGRSSIQMMVEVWS--DDPLSSEWRKVTEAVFVFVAIDGSGRTRSV 129


>gi|305432027|ref|ZP_07401194.1| acyl-CoA thioester hydrolase YciA [Campylobacter coli JV20]
 gi|304445111|gb|EFM37757.1| acyl-CoA thioester hydrolase YciA [Campylobacter coli JV20]
          Length = 137

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 75/133 (56%), Gaps = 13/133 (9%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M   G   LKI  MP+D N  GN+FGGWI+SQID+A  I A +L   RVVT ++ +++F+
Sbjct: 1   MRDMGEPKLKIVAMPSDTNPAGNIFGGWILSQIDLAGAIAARELSPERVVTISMDKVVFK 60

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC-------EATVVMVA 139
           +P+ + D++  Y++I  +GKTS+ +  +V      ++  V  + C        A V  V+
Sbjct: 61  EPVFIGDIISCYSKIVSVGKTSIGVEVEV------SAQRVDSQGCTSCINVTSALVTYVS 114

Query: 140 VDEKGNPKSIRTE 152
           V  +G  K I  E
Sbjct: 115 VTREGKKKPISEE 127


>gi|28872594|ref|NP_795213.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213968533|ref|ZP_03396676.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato T1]
 gi|301384348|ref|ZP_07232766.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato Max13]
 gi|302062555|ref|ZP_07254096.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato K40]
 gi|302130222|ref|ZP_07256212.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28855850|gb|AAO58908.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213926821|gb|EEB60373.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato T1]
 gi|330878119|gb|EGH12268.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
 gi|330962847|gb|EGH63107.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. maculicola str. ES4326]
 gi|330964472|gb|EGH64732.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. actinidiae str. M302091]
 gi|331017816|gb|EGH97872.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 133

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G++FGGW++SQ+D+A    AS++   RV T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIFGGWLVSQMDLAGTAMASKVAGGRVATVAIDRMAFLVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V + +  YT+  ++G+TS+ +  +VW+   +  +   +K  EA  V VA+D  G  +S+
Sbjct: 73  VGEQLSFYTRTLEVGRTSIKMMVEVWSD--DPVTSEWRKVTEAAFVFVAIDSSGRTRSV 129


>gi|71737695|ref|YP_277202.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257485704|ref|ZP_05639745.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289625485|ref|ZP_06458439.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289649740|ref|ZP_06481083.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298489429|ref|ZP_07007440.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|71558248|gb|AAZ37459.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298156003|gb|EFH97112.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|320321744|gb|EFW77842.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331494|gb|EFW87434.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330870955|gb|EGH05664.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330880943|gb|EGH15092.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330890611|gb|EGH23272.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. mori str. 301020]
 gi|330986920|gb|EGH85023.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331011989|gb|EGH92045.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 133

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G++FGGW++SQ+D+A    AS++   RV T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIFGGWLVSQMDLAGTAMASKVAGGRVATVAIDRMAFLVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V + +  YT+  ++G+TS+ +  +VW+   +  +   +K  EA  V VA+D  G  +S+
Sbjct: 73  VGEQLSFYTRTLEVGRTSIKMMVEVWSD--DPLTSEWRKVTEAAFVFVAIDSSGRTRSV 129


>gi|254788389|ref|YP_003075818.1| thioesterase family protein [Teredinibacter turnerae T7901]
 gi|237684782|gb|ACR12046.1| thioesterase family protein [Teredinibacter turnerae T7901]
          Length = 131

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 67/120 (55%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G L L+   +P D N +G++FGGW+MSQ+D+   I A ++ + RV T AV  + F +P+
Sbjct: 11  NGELVLQTLALPADTNSNGDIFGGWLMSQMDLGGAIAAREIARGRVTTVAVGAMAFLRPV 70

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V   V  Y ++ ++G+ S+    +VW    + +    QK  E   V VA+D+ G  + I
Sbjct: 71  PVGATVSCYCEVLEVGRASIKTLIEVWVKTYHRTEQ--QKVTEGEFVYVAIDDNGRTRPI 128


>gi|57504973|ref|ZP_00370925.1| probable hydrolase Cj0915 [Campylobacter coli RM2228]
 gi|57019245|gb|EAL55951.1| probable hydrolase Cj0915 [Campylobacter coli RM2228]
          Length = 102

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 60/89 (67%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M   G   LKI  MP+D N  GN+FGGWI+SQID+A  I A +L   RVVT ++ +++F+
Sbjct: 1   MRDMGEPKLKIVAMPSDTNPAGNIFGGWILSQIDLAGAIAARELSPERVVTISMDKVVFK 60

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDV 115
           +P+ + D++  Y++I  +GKTS+ +  +V
Sbjct: 61  EPVFIGDIISCYSKIVSVGKTSIGVEVEV 89


>gi|300716963|ref|YP_003741766.1| acyl-CoA thioester hydrolase [Erwinia billingiae Eb661]
 gi|299062799|emb|CAX59919.1| Acyl-CoA thioester hydrolase [Erwinia billingiae Eb661]
          Length = 143

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 3/121 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + L+   MP D N +G++FGGW+MSQ+D+   I A ++   RVVT     + F KP+ 
Sbjct: 11  GEMVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAGGRVVTVRADGMTFLKPVA 70

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGNPKS 148
           V D+V  + +  + G +S+TI  +VW   + +S  + Q+ C  EA  V VAVD  G  + 
Sbjct: 71  VGDVVSCHARCIRTGTSSITINIEVW-IKKVSSEPIGQRYCTTEAVFVYVAVDGAGKSRP 129

Query: 149 I 149
           +
Sbjct: 130 L 130


>gi|329890844|ref|ZP_08269187.1| thioesterase superfamily protein [Brevundimonas diminuta ATCC
           11568]
 gi|328846145|gb|EGF95709.1| thioesterase superfamily protein [Brevundimonas diminuta ATCC
           11568]
          Length = 135

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 64/114 (56%)

Query: 36  KIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLV 95
           ++  MP D N +G++FGGW+++Q+D+A    A +    R  T A+  ++F +P+ V D V
Sbjct: 19  RVIAMPADTNPEGDIFGGWLLAQMDLAGATPAFERAGGRCATVALDGMVFHQPVSVGDEV 78

Query: 96  HIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            IY +I + G+TS+ ++ + W   R  +     +  E     VA+D++  P+ +
Sbjct: 79  SIYAKIIRTGRTSIRVHVEAWKRARGQAEAQSVRVTEGVFTYVAIDQERKPREV 132


>gi|254419067|ref|ZP_05032791.1| thioesterase family protein [Brevundimonas sp. BAL3]
 gi|196185244|gb|EDX80220.1| thioesterase family protein [Brevundimonas sp. BAL3]
          Length = 133

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 62/114 (54%)

Query: 36  KIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLV 95
           +I  MP D N +G++FGGW+++Q+D+A    A +L + R  T A+  ++F +P+ V D V
Sbjct: 16  RIIAMPADTNPEGDIFGGWLLAQMDVAGATPAFELAQGRCATVALDGMVFHQPVAVGDEV 75

Query: 96  HIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            IY  +   G+TS+ I+ + W   R        +  +     VA+DE   P+ +
Sbjct: 76  SIYADVISTGRTSIRIHVEAWKRARGQPLATSVRVTQGVFTYVAIDENRKPRPL 129


>gi|326346347|gb|EGD70084.1| Acyl-CoA thioesterase YciA, involved in membrane biogenesis
           [Escherichia coli O157:H7 str. 1125]
          Length = 114

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 68/115 (59%), Gaps = 3/115 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ V D+V  Y 
Sbjct: 1   MPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYA 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKSIRTE 152
           +  + G TSV+I  +VW   + AS  + Q  K  +A    VAVD +G P+++  E
Sbjct: 61  RCVQKGTTSVSINIEVWV-KKVASEPIGQRYKATDALFKYVAVDPEGKPRALPVE 114


>gi|237801789|ref|ZP_04590250.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331024648|gb|EGI04704.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 133

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G++FGGW++SQ+D+A    AS++   RV T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIFGGWLVSQMDLAGTAMASKVAGGRVATVAIDRMAFLVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V + +  YT+  ++G+TS+ +  +VW+   +  +   +K  EA  V VA+D  G  +S+
Sbjct: 73  VGEQLSFYTRTLEVGRTSIKMMVEVWSD--DPVTSEWRKVTEAAFVFVAIDASGRTRSV 129


>gi|251792996|ref|YP_003007722.1| acyl-CoA thioester hydrolase YciA [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534389|gb|ACS97635.1| acyl-CoA thioester hydrolase YciA [Aggregatibacter aphrophilus
           NJ8700]
          Length = 153

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 74/124 (59%), Gaps = 3/124 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP+D N +G++FGGWIMSQ+D+   I A ++   RVVT AV  + F +P+ 
Sbjct: 16  GTLLLRTLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIRPVT 75

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC--EATVVMVAVDEKGNPKS 148
           V D+V  Y +   +G++S+ +  +VW   + AS  + ++ C  EA    VAVD KG  ++
Sbjct: 76  VGDVVCCYGKCLHVGRSSIKVKVEVWVK-KVASEPIGERYCVTEAQFTFVAVDPKGKSRT 134

Query: 149 IRTE 152
           I  E
Sbjct: 135 IPRE 138


>gi|302184687|ref|ZP_07261360.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. syringae 642]
          Length = 133

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G++FGGW++SQ+D+A    AS++   RV T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIFGGWLVSQMDLAGTAMASKVAGGRVATVAIDRMAFLVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V + +  YT+  ++G+TS+ +  +VW+   +  +   +K  EA  V VA+D  G  +S+
Sbjct: 73  VGEQLSFYTRTLEVGRTSIKMMVEVWSD--DPLTSEWRKVTEAAFVFVAIDPSGRTRSV 129


>gi|66048267|ref|YP_238108.1| thioesterase superfamily protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|289677424|ref|ZP_06498314.1| thioesterase superfamily protein [Pseudomonas syringae pv. syringae
           FF5]
 gi|63258974|gb|AAY40070.1| Thioesterase superfamily [Pseudomonas syringae pv. syringae B728a]
 gi|330898743|gb|EGH30162.1| thioesterase superfamily protein [Pseudomonas syringae pv. japonica
           str. M301072PT]
 gi|330937429|gb|EGH41404.1| thioesterase superfamily protein [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330952431|gb|EGH52691.1| thioesterase superfamily protein [Pseudomonas syringae Cit 7]
 gi|330970231|gb|EGH70297.1| thioesterase superfamily protein [Pseudomonas syringae pv. aceris
           str. M302273PT]
 gi|330976295|gb|EGH76355.1| thioesterase superfamily protein [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 133

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G++FGGW++SQ+D+A    AS++   RV T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIFGGWLVSQMDLAGTAMASKVAGGRVATVAIDRMAFLVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V + +  YT+  ++G+TS+ +  +VW+   +  +   +K  EA  V VA+D  G  +S+
Sbjct: 73  VGEQLSFYTRTLEVGRTSIKMMVEVWSD--DPLTSEWRKVTEAAFVFVAIDASGRTRSV 129


>gi|217968614|ref|YP_002353848.1| thioesterase superfamily protein [Thauera sp. MZ1T]
 gi|217505941|gb|ACK52952.1| thioesterase superfamily protein [Thauera sp. MZ1T]
          Length = 138

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G   ++   MP D N  G++FGGW+M+Q+D+A G  A++  + R  T +V  + F +P+ 
Sbjct: 12  GEPAIRTIAMPADANPAGDIFGGWLMAQMDLAAGNVAARRARSRCATVSVDRITFLRPVY 71

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           + D V +Y  I ++G++S+TI  + W   R+    V  K  +A+ V VA+D+ G P+ I
Sbjct: 72  IGDEVSLYADIVRVGRSSMTIQVEAWRRSRDGEEQV--KVTDASFVFVALDQGGRPRVI 128


>gi|220936215|ref|YP_002515114.1| thioesterase superfamily protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997525|gb|ACL74127.1| thioesterase superfamily protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 126

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 66/117 (56%), Gaps = 3/117 (2%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L L     PT  N  G++FGGWIM+Q+DIA  I A +  + RVVT AV  + F +P+Q  
Sbjct: 10  LRLPAAAAPT--NAGGDIFGGWIMAQMDIAGSIPAVRRARGRVVTAAVEAMHFRRPVQRG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           D+V +Y ++   G++S+T+  +V    RN     +    +  +V VAVD  G P+ +
Sbjct: 68  DMVSLYAEVLTEGRSSMTVAVEV-CVERNPYEPEILTVADGRLVYVAVDADGKPRPL 123


>gi|167036366|ref|YP_001671597.1| thioesterase superfamily protein [Pseudomonas putida GB-1]
 gi|166862854|gb|ABZ01262.1| thioesterase superfamily protein [Pseudomonas putida GB-1]
          Length = 132

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G++FGGW+++Q+D+A    AS++   RV T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIFGGWLVAQMDLAGTAMASRVAGGRVATVAIDRMAFLVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   +  YTQ  +IG++S+ +  +VW+   +  S   +K  EA  V VA+D  G  +S+
Sbjct: 73  VGAQLSFYTQTLEIGRSSIQMMVEVWSD--DPLSSEWRKVTEAAFVFVAIDGSGRTRSV 129


>gi|169632414|ref|YP_001706150.1| putative acyl-CoA thioester hydrolase [Acinetobacter baumannii SDF]
 gi|169151206|emb|CAO99886.1| putative acyl-CoA thioester hydrolase [Acinetobacter baumannii]
          Length = 127

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 66/111 (59%), Gaps = 2/111 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G+L+L+   MP D N  G+VFGGWI+SQ+D+A  I A +  + R  T ++ ++ F  P++
Sbjct: 10  GILSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHAERFSRGRCATISINQMTFLVPVK 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVD 141
           V  ++  YT+I K+G TS+ +  +VW    ++ + +  +  E     VAVD
Sbjct: 70  VGFVISCYTKILKVGNTSIQMQIEVWDSHDDSRAPI--RITEGVFTFVAVD 118


>gi|311696281|gb|ADP99154.1| thioesterase superfamily protein [marine bacterium HP15]
          Length = 134

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G LTL+I  +P+D N +G+VF GW++ Q+D+A    A ++ + R  T A+  + F  P++
Sbjct: 13  GELTLQIIPLPSDTNANGDVFAGWLVKQMDLAAATMAGRISQGRNATVAMDRMEFLSPLR 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   V  Y ++  IG++S+ I  +VWT  R A +   +K  E   V VA+DE G  + +
Sbjct: 73  VGSQVGCYCELVDIGRSSMKISVEVWTLDRTAKNP--RKVTEGLFVYVAIDEHGRIREV 129


>gi|160872795|ref|ZP_02062927.1| thioesterase family protein [Rickettsiella grylli]
 gi|159121594|gb|EDP46932.1| thioesterase family protein [Rickettsiella grylli]
          Length = 129

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 75/123 (60%), Gaps = 6/123 (4%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           TL+++T P D N  G++FGGW+MSQIDIA  I A++  K  VVT AV EL F KP+ + D
Sbjct: 9   TLRVKTRPNDANKAGDIFGGWLMSQIDIAGAIAAAKRAKGPVVTVAVKELKFLKPLFIYD 68

Query: 94  LVHIYTQIRKIGKTS----VTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +   YT+I  +GKTS    V +Y + +    N +S++  K  EA ++ VAV + G  + +
Sbjct: 69  IASFYTRIIGVGKTSLFIDVDVYAERYNGGVNETSNI--KVSEARLIYVAVSKPGEKRLV 126

Query: 150 RTE 152
             E
Sbjct: 127 PNE 129


>gi|229593414|ref|YP_002875533.1| putative thioesterase [Pseudomonas fluorescens SBW25]
 gi|312963915|ref|ZP_07778386.1| long-chain acyl-CoA thioester hydrolase family protein [Pseudomonas
           fluorescens WH6]
 gi|229365280|emb|CAY53614.1| putative thioesterase [Pseudomonas fluorescens SBW25]
 gi|311281950|gb|EFQ60560.1| long-chain acyl-CoA thioester hydrolase family protein [Pseudomonas
           fluorescens WH6]
          Length = 134

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G++FGGW+++Q+D+A    AS++   RV T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIFGGWLVAQMDLAGTAMASKVAGGRVATVAIDRMAFLVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   +  YTQ  +IG++S+ +  +VW+   +  S   +K  EA  V VA+D  G  +S+
Sbjct: 73  VGAQLSFYTQALEIGRSSIQMMVEVWS--DDPLSSEWRKVTEAVFVFVAIDGSGRTRSV 129


>gi|26992007|ref|NP_747432.1| thioesterase superfamily protein [Pseudomonas putida KT2440]
 gi|148550439|ref|YP_001270541.1| thioesterase superfamily protein [Pseudomonas putida F1]
 gi|170719330|ref|YP_001747018.1| thioesterase superfamily protein [Pseudomonas putida W619]
 gi|325275126|ref|ZP_08141100.1| thioesterase superfamily protein [Pseudomonas sp. TJI-51]
 gi|24987140|gb|AAN70896.1|AE016733_8 long-chain acyl-CoA thioester hydrolase family protein [Pseudomonas
           putida KT2440]
 gi|148514497|gb|ABQ81357.1| thioesterase superfamily protein [Pseudomonas putida F1]
 gi|169757333|gb|ACA70649.1| thioesterase superfamily protein [Pseudomonas putida W619]
 gi|313501304|gb|ADR62670.1| Thioesterase superfamily protein [Pseudomonas putida BIRD-1]
 gi|324099734|gb|EGB97606.1| thioesterase superfamily protein [Pseudomonas sp. TJI-51]
          Length = 132

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G++FGGW+++Q+D+A    AS++   RV T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIFGGWLVAQMDLAGTAMASRVAGGRVATVAIDRMAFLVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   +  YTQ  +IG++S+ +  +VW+   +  S   +K  EA  V VA+D  G  +S+
Sbjct: 73  VGAQLSFYTQTLEIGRSSIQMMVEVWSD--DPLSSEWRKVTEAVFVFVAIDGSGRTRSV 129


>gi|256396752|ref|YP_003118316.1| thioesterase superfamily protein [Catenulispora acidiphila DSM
           44928]
 gi|256362978|gb|ACU76475.1| thioesterase superfamily protein [Catenulispora acidiphila DSM
           44928]
          Length = 248

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           PT+VNL G V GG +M  +D   G  A +      VT A+ E+ F  P++V DLVH Y Q
Sbjct: 77  PTEVNLLGTVHGGVVMKFVDDVAGAVAGRHSGGPAVTAAMDEMQFLNPVRVGDLVHAYAQ 136

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  +G TS+ I   V   P N +    +    A +V VAVD+KG P+S+
Sbjct: 137 VNWVGATSMEIGVRVMAEPWNEAGTAPRHVASAYLVFVAVDDKGQPRSV 185


>gi|70733404|ref|YP_263179.1| long-chain acyl-CoA thioester hydrolase family protein [Pseudomonas
           fluorescens Pf-5]
 gi|68347703|gb|AAY95309.1| long-chain acyl-CoA thioester hydrolase family protein [Pseudomonas
           fluorescens Pf-5]
          Length = 134

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G++FGGW+++Q+D+A    AS++   RV T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIFGGWLVAQMDLAGTAMASRVAGGRVATVAIDRMAFLVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   +  YTQ  +IG++S+ +  +VW+   +  S   +K  EA  V VA+D  G  +S+
Sbjct: 73  VGAQLSFYTQTLEIGRSSIQMMVEVWSD--DPLSSEWRKVTEAVFVFVAIDGSGRTRSV 129


>gi|283954474|ref|ZP_06371994.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           414]
 gi|283794091|gb|EFC32840.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           414]
          Length = 137

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 75/133 (56%), Gaps = 13/133 (9%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M   G   LKI  MP+D N  GN+FGGWI+SQID+A  I A +L   RVVT ++ +++F+
Sbjct: 1   MRDMGEPKLKIVAMPSDTNPAGNIFGGWILSQIDLAGAIAARELSPERVVTISMDKVVFK 60

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC-------EATVVMVA 139
           +P+ + D++  Y++I  +G TS+++  +V      ++  V  + C        A V  V+
Sbjct: 61  EPVFIGDIISCYSKIVNVGNTSISVEVEV------SAQRVDSQGCTSCINVTSALVTYVS 114

Query: 140 VDEKGNPKSIRTE 152
           V + G  K I  E
Sbjct: 115 VTKDGKKKPISEE 127


>gi|317048321|ref|YP_004115969.1| thioesterase superfamily protein [Pantoea sp. At-9b]
 gi|316949938|gb|ADU69413.1| thioesterase superfamily protein [Pantoea sp. At-9b]
          Length = 158

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 70/122 (57%), Gaps = 5/122 (4%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + L+   MP D N +G++FGGW+MSQ+D+   I A ++ + RV T  V  + F KP+ 
Sbjct: 30  GEMVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAEGRVATVRVDGMSFLKPVA 89

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKT---CEATVVMVAVDEKGNPK 147
           V D+V  Y +  + G +S+TI  +VW   +  SS+ + +T    EA  + VA+D  G  +
Sbjct: 90  VGDVVSCYCRCIRTGNSSMTINVEVWI--KKVSSEPIGQTYCATEAVFIYVAIDNTGKSR 147

Query: 148 SI 149
            +
Sbjct: 148 PL 149


>gi|77461838|ref|YP_351345.1| thioesterase superfamily protein [Pseudomonas fluorescens Pf0-1]
 gi|77385841|gb|ABA77354.1| putative thioesterase [Pseudomonas fluorescens Pf0-1]
          Length = 162

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G++FGGW+++Q+D+A    AS++   RV T A+  + F  P+ 
Sbjct: 41  GDLALQITALPRETNGFGDIFGGWLVAQMDLAGTAMASRVAGGRVATVAIDRMAFLVPVA 100

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   +  YTQ  +IG++S+ +  +VW+   +  S   +K  EA  V VA+D  G  +S+
Sbjct: 101 VGAQLSFYTQTLEIGRSSIQMMVEVWSD--DPLSSEWRKVTEAVFVFVAIDGSGRTRSV 157


>gi|153951670|ref|YP_001398015.1| thioesterase family protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152939116|gb|ABS43857.1| thioesterase family protein [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 137

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 72/128 (56%), Gaps = 3/128 (2%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M   G   LKI  MP+D N  GN+FGGWI+SQID+A  I A +L   RVVT ++ +++F+
Sbjct: 1   MRDMGEPKLKIVAMPSDTNPAGNIFGGWILSQIDLAGAIAARELSPERVVTISMDKVVFK 60

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKG 144
           +P+ + D++  Y++I  +G TS+++  ++ T  R  S           A V  V+V   G
Sbjct: 61  EPVFIGDIISCYSKIVNVGNTSISVEVEI-TAQRVDSQGCTSCINVTSALVTYVSVTRDG 119

Query: 145 NPKSIRTE 152
             K I  E
Sbjct: 120 KKKPISEE 127


>gi|56551407|ref|YP_162246.1| thioesterase superfamily protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|260752982|ref|YP_003225875.1| thioesterase superfamily protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|12230664|sp|O66120|Y511_ZYMMO RecName: Full=Uncharacterized acyl-CoA thioester hydrolase ZMO0511
 gi|2995392|emb|CAA63809.1| hypothetical protein YciA [Zymomonas mobilis subsp. mobilis ATCC
           29191]
 gi|56542981|gb|AAV89135.1| thioesterase superfamily protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|258552345|gb|ACV75291.1| thioesterase superfamily protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 149

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 63/117 (53%), Gaps = 2/117 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G   +++  MP + N DG +FGGW+M  +D A G+ A++    RVVT A   + F  P+
Sbjct: 17  AGEPAIRVIAMPANTNADGRMFGGWLMGMLDQAAGLVAARHALARVVTVAADSITFHAPV 76

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           QV D + +Y ++ K+G+TS+ I  + W   R+    +  K        VA+DE   P
Sbjct: 77  QVGDELSLYARLVKVGRTSMKIEVEGWRRVRHELETI--KAISGLFTFVAIDEDRRP 131


>gi|57237743|ref|YP_178991.1| thioesterase family protein [Campylobacter jejuni RM1221]
 gi|86150768|ref|ZP_01068984.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|86152799|ref|ZP_01071004.1| acyl-CoA thioester hydrolase yciA [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|121613649|ref|YP_001000589.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|148926596|ref|ZP_01810278.1| putative hydrolase [Campylobacter jejuni subsp. jejuni CG8486]
 gi|157415171|ref|YP_001482427.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           81116]
 gi|167005520|ref|ZP_02271278.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|205356398|ref|ZP_03223163.1| putative hydrolase [Campylobacter jejuni subsp. jejuni CG8421]
 gi|283956258|ref|ZP_06373738.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           1336]
 gi|315124409|ref|YP_004066413.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|57166547|gb|AAW35326.1| thioesterase family protein [Campylobacter jejuni RM1221]
 gi|85841938|gb|EAQ59184.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|85843684|gb|EAQ60894.1| acyl-CoA thioester hydrolase yciA [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|87248914|gb|EAQ71877.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|145845290|gb|EDK22384.1| putative hydrolase [Campylobacter jejuni subsp. jejuni CG8486]
 gi|157386135|gb|ABV52450.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           81116]
 gi|205345783|gb|EDZ32421.1| putative hydrolase [Campylobacter jejuni subsp. jejuni CG8421]
 gi|283791978|gb|EFC30767.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           1336]
 gi|307747814|gb|ADN91084.1| Thioesterase family protein [Campylobacter jejuni subsp. jejuni M1]
 gi|315018131|gb|ADT66224.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|315058355|gb|ADT72684.1| Putative acyl-CoA thioester hydrolase [Campylobacter jejuni subsp.
           jejuni S3]
 gi|315932604|gb|EFV11535.1| thioesterase superfamily protein [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 137

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 72/128 (56%), Gaps = 3/128 (2%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M   G   LKI  MP+D N  GN+FGGWI+SQID+A  I A +L   RVVT ++ +++F+
Sbjct: 1   MRDMGEPKLKIVAMPSDTNPAGNIFGGWILSQIDLAGAIAARELSPERVVTISMDKVVFK 60

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKG 144
           +P+ + D++  Y+++  +G TS+++  +V T  R  S           A V  V+V   G
Sbjct: 61  EPVFIGDIISCYSKVVNVGNTSISVEVEV-TAQRVDSQGCTSCINVTSALVTYVSVTRDG 119

Query: 145 NPKSIRTE 152
             K I  E
Sbjct: 120 KKKPISEE 127


>gi|241761052|ref|ZP_04759141.1| thioesterase superfamily protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241374671|gb|EER64132.1| thioesterase superfamily protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 149

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 63/117 (53%), Gaps = 2/117 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G   +++  MP + N DG +FGGW+M  +D A G+ A++    RVVT A   + F  P+
Sbjct: 17  AGEPAIRVIAMPANTNADGRMFGGWLMGMLDQAAGLVAARHALARVVTVAADSITFHAPV 76

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           QV D + +Y ++ K+G+TS+ I  + W   R+    +  K        VA+DE   P
Sbjct: 77  QVGDELSLYARLVKVGRTSMKIEVEGWRRVRHELETI--KAISGLFTFVAIDEDRRP 131


>gi|114329024|ref|YP_746181.1| acyl-CoA hydrolase [Granulibacter bethesdensis CGDNIH1]
 gi|114317198|gb|ABI63258.1| acyl-CoA hydrolase [Granulibacter bethesdensis CGDNIH1]
          Length = 150

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 62/113 (54%), Gaps = 2/113 (1%)

Query: 39  TMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIY 98
            MP D N  G++FGGW+MS +D+A G  A++  + R VT AV  + F  P+ V D V +Y
Sbjct: 34  AMPADTNPAGDIFGGWLMSLMDMAAGNVATRYARGRCVTVAVDSIAFLAPVVVGDEVSLY 93

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
            ++   G++S+ I  + W  PR A     +K   A  V VA+DE    + + T
Sbjct: 94  AKLLSTGRSSMRIAVEAWRRPRVAED--YRKVTRAVFVFVAIDENRRARPLPT 144


>gi|104784371|ref|YP_610869.1| long-chain acyl-CoA thioester hydrolase [Pseudomonas entomophila
           L48]
 gi|95113358|emb|CAK18086.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           entomophila L48]
          Length = 132

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 68/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G++FGGW+++Q+D+A    AS++   RV T ++  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIFGGWLVAQMDLAGTAMASRVAGGRVATVSIDRMAFLVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   +  YTQ  KIG++S+ +  +VW    +  S   +K  EA  V VA+D  G  +S+
Sbjct: 73  VGAQLSFYTQTLKIGRSSIQMRVEVWND--DPLSGEWRKVTEAEFVFVAIDGSGRTRSV 129


>gi|268680494|ref|YP_003304925.1| thioesterase superfamily protein [Sulfurospirillum deleyianum DSM
           6946]
 gi|268618525|gb|ACZ12890.1| thioesterase superfamily protein [Sulfurospirillum deleyianum DSM
           6946]
          Length = 139

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 70/123 (56%), Gaps = 10/123 (8%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M++ G   +K+  MP D N  GN+FGGWIMSQIDIA  +    L   RVVT AV  + F+
Sbjct: 1   MNTMGEPRIKMVAMPKDTNPAGNIFGGWIMSQIDIAGALATRDLNVGRVVTVAVHSMEFK 60

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL-QKTC----EATVVMVAVD 141
           +P+ V D++  Y +I ++G TS+T+  +V     NA      ++ C     A +  V VD
Sbjct: 61  EPLHVGDVISCYGKIMRVGTTSLTVQVEV-----NAERSYFGERRCLHVTSAVLTYVHVD 115

Query: 142 EKG 144
           ++G
Sbjct: 116 KEG 118


>gi|307293149|ref|ZP_07572995.1| thioesterase superfamily protein [Sphingobium chlorophenolicum L-1]
 gi|306881215|gb|EFN12431.1| thioesterase superfamily protein [Sphingobium chlorophenolicum L-1]
          Length = 135

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 67/116 (57%), Gaps = 2/116 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           ++++  MP D N  G++FGGW+MS +D A G  A++    R VT AV  + F +P+ V D
Sbjct: 14  SVRVIAMPADTNPYGDIFGGWLMSLMDSAAGSVAARHSHGRAVTIAVEGMTFLRPVVVGD 73

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V ++ ++  +G+TS++I  + W   R+   D   +  +AT   VA+ E   P+S+
Sbjct: 74  EVSVFARLVSVGRTSMSIDVEAWRRARH--DDRSYRVTKATFTFVAIGEDRQPRSV 127


>gi|213650435|ref|ZP_03380488.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
          Length = 129

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 68/121 (56%), Gaps = 4/121 (3%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V E     P+ 
Sbjct: 7   GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRV-EGDISAPVA 65

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKS 148
           V D+V  Y +  K G TS++I  +VW   + AS  + Q  K  EA  + VAVD  G P+ 
Sbjct: 66  VGDVVCCYARCVKRGTTSISINIEVWV-KKVASEPIGQRYKATEALFIYVAVDPDGKPRP 124

Query: 149 I 149
           +
Sbjct: 125 L 125


>gi|163795528|ref|ZP_02189494.1| hypothetical protein BAL199_26047 [alpha proteobacterium BAL199]
 gi|159179127|gb|EDP63660.1| hypothetical protein BAL199_26047 [alpha proteobacterium BAL199]
          Length = 137

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 64/119 (53%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + ++   MP D N +G++FGGW++SQ+D+A G+ A+   + RV T  +  + F  P+ 
Sbjct: 17  GEMQIRTVAMPADANPNGDIFGGWVLSQMDVAGGVAAASRAQGRVATVGIEAMTFIGPVA 76

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V D++  Y  I ++G+TS+T+  + W        +      E     VA+D+ G  + +
Sbjct: 77  VGDVLCCYGDIERVGRTSITVAIEAWKIRWFDRREERALVTEGRFTYVAIDDNGRKRPV 135


>gi|94498245|ref|ZP_01304805.1| acyl-CoA hydrolase [Sphingomonas sp. SKA58]
 gi|94422247|gb|EAT07288.1| acyl-CoA hydrolase [Sphingomonas sp. SKA58]
          Length = 133

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 63/115 (54%), Gaps = 2/115 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           ++I  MP D N  G++FGGW+MS +D A G  A++    R VT AV  + F +P+ V D 
Sbjct: 15  VRIIAMPADTNPYGDIFGGWLMSLMDSAAGSVAARHSHGRAVTIAVEGMTFLRPVVVGDE 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V ++  ++ +G+TS+ I  + W   R    D   +   AT   VA+ E   P+S+
Sbjct: 75  VSVFATLKSVGRTSMKIDVEAWR--RTRHDDRSYRVTRATFTFVAIGEDRQPRSV 127


>gi|86150646|ref|ZP_01068868.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88596477|ref|ZP_01099714.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|218562534|ref|YP_002344313.1| putative hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|229597706|pdb|3D6L|A Chain A, Crystal Structure Of Cj0915, A Hexameric Hotdog Fold
           Thioesterase Of Campylobacter Jejuni
 gi|85838907|gb|EAQ56174.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88191318|gb|EAQ95290.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           84-25]
 gi|112360240|emb|CAL35035.1| putative hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|315929861|gb|EFV09024.1| thioesterase superfamily protein [Campylobacter jejuni subsp.
           jejuni 305]
          Length = 137

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 60/89 (67%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M   G   LKI  MP+D N  GN+FGGWI+SQID+A  I A +L   RVVT ++ +++F+
Sbjct: 1   MRDMGEPKLKIVAMPSDTNPAGNIFGGWILSQIDLAGAIAARELSPERVVTISMDKVVFK 60

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDV 115
           +P+ + D++  Y+++  +G TS+++  +V
Sbjct: 61  EPVFIGDIISCYSKVVNVGNTSISVEVEV 89


>gi|284926148|gb|ADC28500.1| thioesterase family protein [Campylobacter jejuni subsp. jejuni
           IA3902]
          Length = 137

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 74/126 (58%), Gaps = 5/126 (3%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M   G   LKI  MP+D N  GN+FGGWI+SQID+A  I A +L   RVVT ++ +++F+
Sbjct: 1   MRDMGEPKLKIVAMPSDTNPAGNIFGGWILSQIDLAGAIAARELSPERVVTISMDKVVFK 60

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAV--DE 142
           +P+ + D++  Y+++  +G TS+++  +V T  R  S           A V+ V+V  D 
Sbjct: 61  EPVFIGDIISCYSKVVNVGNTSISVEVEV-TAQRVDSQGCTSCINVTSALVIYVSVTRDG 119

Query: 143 KGNPKS 148
           K NP S
Sbjct: 120 KKNPIS 125


>gi|119503545|ref|ZP_01625628.1| putative acyl-CoA thioester hydrolase [marine gamma proteobacterium
           HTCC2080]
 gi|119460607|gb|EAW41699.1| putative acyl-CoA thioester hydrolase [marine gamma proteobacterium
           HTCC2080]
          Length = 134

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 67/120 (55%), Gaps = 2/120 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L+L+   MP D N  G++FGGW+MSQ+D+A  + A  +   RV T AV  ++F  P+ 
Sbjct: 12  GELSLQAVAMPADTNPHGDIFGGWLMSQMDLAGYVTACDVAGGRVATVAVEGMVFLTPVH 71

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V  +V  Y+ I +IG++SV +  +VW   R     +  K  E T + VA+      ++I+
Sbjct: 72  VGAVVSCYSDILEIGRSSVRVIVEVWINSRQDGEPI--KVTEGTFIYVAIGGDKRTRAIQ 129


>gi|162146343|ref|YP_001600802.1| acyl-CoA thioester hydrolase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209543654|ref|YP_002275883.1| thioesterase superfamily protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161784918|emb|CAP54461.1| putative acyl-CoA thioester hydrolase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531331|gb|ACI51268.1| thioesterase superfamily protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 142

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           T+++  MP D N  G++FGGW+MSQ+D+A G  A+   + R VT A+ +++  +P+ + D
Sbjct: 24  TIRVVAMPADANASGDIFGGWLMSQMDLAAGTAAALRARGRCVTVAIDKVVLHQPVLIGD 83

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
            V +Y  I + G+TS++I+ + W   R++   +  K  E     VA+D++  P+ +  E
Sbjct: 84  EVSLYATITRAGRTSMSIHVETWRRARHSHESI--KVTEGVFTFVAIDDERRPRPLPPE 140


>gi|330501021|ref|YP_004377890.1| thioesterase superfamily protein [Pseudomonas mendocina NK-01]
 gi|328915307|gb|AEB56138.1| thioesterase superfamily protein [Pseudomonas mendocina NK-01]
          Length = 134

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G+++GGW++SQ+D+A    AS++   RV T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIYGGWLVSQMDLAGTAMASKVAGGRVATVAIDRMAFLVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   +  YTQ  +IG++S+ +  +VW+   +  S+  +K  EA  V VA+D  G  + +
Sbjct: 73  VGAQLSFYTQALEIGRSSIQMMVEVWSD--DPLSNEWRKVTEAVFVFVAIDGSGRTRPV 129


>gi|149921783|ref|ZP_01910229.1| thioesterase superfamily protein [Plesiocystis pacifica SIR-1]
 gi|149817344|gb|EDM76818.1| thioesterase superfamily protein [Plesiocystis pacifica SIR-1]
          Length = 132

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 67/117 (57%), Gaps = 1/117 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            +++  +P D N  G +FGG I+S ID A  I A ++   RVVT A+ E++F+ P++V D
Sbjct: 12  AIRVSMLPADTNAHGTIFGGKILSLIDQAGAIGAHRIGAGRVVTVAMREVVFQHPVRVGD 71

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           +V  Y  + K+G+TS+T+ C      R   +    +  +A VV V +D+ G P  IR
Sbjct: 72  IVSCYADVLKVGRTSITV-CVRVEAHRPTDTKRAVQVTKAEVVYVHIDDAGRPVPIR 127


>gi|213418590|ref|ZP_03351656.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
          Length = 130

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 65/112 (58%), Gaps = 3/112 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ 
Sbjct: 20  GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVA 79

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAV 140
           V D+V  Y +  K G TS++I  +VW   + AS  + Q  K  EA  + VAV
Sbjct: 80  VGDVVCCYARCVKRGTTSISINIEVWV-KKVASEPIGQRYKATEALFIYVAV 130


>gi|300114860|ref|YP_003761435.1| thioesterase superfamily protein [Nitrosococcus watsonii C-113]
 gi|299540797|gb|ADJ29114.1| thioesterase superfamily protein [Nitrosococcus watsonii C-113]
          Length = 140

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 67/116 (57%), Gaps = 1/116 (0%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           TL+I   PTD N  G++FGGW+MS  DIA  I A +  + R+VT AV +  F +P+ V D
Sbjct: 10  TLRILARPTDTNAAGDIFGGWLMSWTDIAGSIVAFRRARGRIVTVAVKDFNFIQPVYVDD 69

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           LV  Y ++ K+G TS+T+   V+   R    +  ++   A +V VA+ +   P+ +
Sbjct: 70  LVSFYAEVTKVGNTSLTVEVIVYA-ERKRGEETCEQVASACLVYVALGKDHCPRPV 124


>gi|149376557|ref|ZP_01894318.1| Acyl-CoA hydrolase [Marinobacter algicola DG893]
 gi|149359224|gb|EDM47687.1| Acyl-CoA hydrolase [Marinobacter algicola DG893]
          Length = 134

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 67/114 (58%), Gaps = 2/114 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L +++  +P+D N +G+VF GW++ Q+DIA    A ++ + R  T A+  + F  P++
Sbjct: 13  GELVIQVIPLPSDTNPNGDVFAGWLVKQMDIAAATMAGRISQGRNATVAMDRMEFLSPLR 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           V   V  Y ++ ++G++S+ I  +VWT  R A +   +K  E   V VA+DE G
Sbjct: 73  VGSQVGCYGELVEVGRSSMKINIEVWTLDRTAKAP--RKVTEGLFVYVAIDEHG 124


>gi|294012049|ref|YP_003545509.1| acyl-CoA hydrolase [Sphingobium japonicum UT26S]
 gi|292675379|dbj|BAI96897.1| acyl-CoA hydrolase [Sphingobium japonicum UT26S]
          Length = 135

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 64/116 (55%), Gaps = 2/116 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            +++  MP D N  G++FGGW+MS +D A G  A++    R VT AV  + F +P+ V D
Sbjct: 14  AVRVIAMPADTNPYGDIFGGWLMSLMDSAAGSVAARHSHGRAVTIAVEGMTFLRPVVVGD 73

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V ++ ++  +G+TS+ I  + W   R    D   +  +AT   VA+ E   P+S+
Sbjct: 74  EVSVFAKLVSVGRTSMKIEVEAWR--RTRHDDRSYRVTKATFAFVAIGEDRQPRSV 127


>gi|119475191|ref|ZP_01615544.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [marine gamma proteobacterium HTCC2143]
 gi|119451394|gb|EAW32627.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [marine gamma proteobacterium HTCC2143]
          Length = 134

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 72/120 (60%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G L L+   MP D N   ++FGGW++SQ+D+A    A+++ + RVVT A+  ++F  P+
Sbjct: 14  AGELALRTIAMPADTNASNDIFGGWLVSQMDLAAAATATKIARGRVVTVAIDSMVFLTPV 73

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V  +V  Y  + ++G++S+ I  +VWT  ++ ++    K  E   V VAVD+ G  +++
Sbjct: 74  HVGAVVTCYANVLEVGRSSIKINVEVWT--KHQTTYEPTKVTEGDFVFVAVDDAGKTRAV 131


>gi|94499912|ref|ZP_01306448.1| hypothetical protein RED65_15362 [Oceanobacter sp. RED65]
 gi|94428113|gb|EAT13087.1| hypothetical protein RED65_15362 [Oceanobacter sp. RED65]
          Length = 132

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 66/115 (57%), Gaps = 2/115 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G LTL++   P D N  G+V GGW+++++D+A    A  + K RV   A     F  P+
Sbjct: 12  NGRLTLRLVPTPADTNASGDVSGGWVLNKMDMAAEDTARMIAKGRVTMVATESTTFLSPV 71

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           +    +  YT++ +IG++S+ I  +VW+  +N   D L K  E+T V VA+DE G
Sbjct: 72  KAGHAICCYTKVTEIGRSSIRIQVEVWS--QNTFYDELTKVSESTFVYVAMDENG 124


>gi|299132228|ref|ZP_07025423.1| thioesterase superfamily protein [Afipia sp. 1NLS2]
 gi|298592365|gb|EFI52565.1| thioesterase superfamily protein [Afipia sp. 1NLS2]
          Length = 133

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 61/110 (55%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP+D N  G++FGGW+M Q+D+A G  A++L + R  T AV  + F  P+ V D V  + 
Sbjct: 1   MPSDTNPAGDIFGGWLMWQMDLAAGSLATRLARGRCATVAVDAMEFISPVFVGDEVTFFA 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +++ G+TS+ I  + W   R+  S+   K   A    VA+D    P+ +
Sbjct: 61  SLKETGRTSLRISVEAWR--RSRDSEETNKVTSAIFAFVAIDNGRKPRPL 108


>gi|83643633|ref|YP_432068.1| acyl-CoA hydrolase [Hahella chejuensis KCTC 2396]
 gi|83631676|gb|ABC27643.1| Acyl-CoA hydrolase [Hahella chejuensis KCTC 2396]
          Length = 131

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 70/120 (58%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +G L L++  +  D N +G+++ GW+MSQ+D+A    A ++ K R  T +V +L F  P+
Sbjct: 10  NGELALRVIALDKDTNSNGDIYAGWLMSQMDLAAASMAGRIAKGRTATVSVKQLDFLSPV 69

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +V   V  Y ++  IG +S+ I  +VWT  R+   +  +K  E   V+VA+D+ G  +++
Sbjct: 70  RVGAEVSCYARMVNIGTSSMHIEVEVWT--RDNHQNTPRKVTEGVFVLVAIDDSGRIRAV 127


>gi|126664592|ref|ZP_01735576.1| Acyl-CoA hydrolase [Marinobacter sp. ELB17]
 gi|126630918|gb|EBA01532.1| Acyl-CoA hydrolase [Marinobacter sp. ELB17]
          Length = 133

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 68/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I   P D N +G+VF GW++ Q+DIA    A+++ + R  T A+  + F  P++
Sbjct: 13  GELILRIIPFPGDTNANGDVFAGWLVKQMDIAAATLAARISQGRSATVAMDRMEFLSPVR 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   V  Y ++ +IG++S+ I  +VWT  R   S+  +K  E   V VA+DE G  + +
Sbjct: 73  VGSQVGCYCELIEIGRSSMNIKVEVWTMDR--YSEDRRKVTEGRFVYVAIDEVGRIREV 129


>gi|296284119|ref|ZP_06862117.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Citromicrobium bathyomarinum JL354]
          Length = 138

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 65/118 (55%), Gaps = 2/118 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           +++  MPTD+N  G VFGGW+MSQ+ +  G  AS+  + + V  + T+  F   + + D 
Sbjct: 7   IRVTAMPTDMNPYGGVFGGWLMSQMALGAGSLASREGQGKAVVVSATDFAFPGAMALGDE 66

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           +++Y +I K G TS+TI  +     R+     L   C+ T V V  D+ G P+ +R +
Sbjct: 67  LNVYCEILKEGNTSITIAAEGIARARHGEETKL--VCKGTFVFVLADDDGKPRPVRMQ 122


>gi|146305123|ref|YP_001185588.1| thioesterase superfamily protein [Pseudomonas mendocina ymp]
 gi|145573324|gb|ABP82856.1| thioesterase superfamily protein [Pseudomonas mendocina ymp]
          Length = 133

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G+++GGW++SQ+D+A    AS++   RV T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIYGGWLVSQMDLAGTAMASKVAGGRVATVAIDRMAFLVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   +  YTQ  ++G++S+ +  +VW+   +  S+  +K  EA  V VA+D  G  + +
Sbjct: 73  VGAQLSFYTQALEVGRSSIQMMVEVWSD--DPLSNEWRKVTEAVFVFVAIDGSGRTRPV 129


>gi|120556535|ref|YP_960886.1| thioesterase superfamily protein [Marinobacter aquaeolei VT8]
 gi|120326384|gb|ABM20699.1| thioesterase superfamily protein [Marinobacter aquaeolei VT8]
          Length = 134

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 68/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + L++  +P+D N +G+VF GW++ Q+DIA    A ++ + R  T A+  + F  P++
Sbjct: 13  GEMMLQVVPLPSDTNANGDVFAGWLVKQMDIAAATMAGRISQGRNATVAMDRMEFLSPLR 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   V  Y ++  IG++S+ I  +VWT  R  +S   +K  E   V VA+DE G  + +
Sbjct: 73  VGSQVGCYCELVDIGRSSMKINVEVWTLDR--ASKTPRKVTEGLFVYVAIDEHGRIREV 129


>gi|307296975|ref|ZP_07576791.1| thioesterase superfamily protein [Sphingobium chlorophenolicum L-1]
 gi|306877501|gb|EFN08729.1| thioesterase superfamily protein [Sphingobium chlorophenolicum L-1]
          Length = 125

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 67/119 (56%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + L++    TD+N +G++FGGW++SQ+DIA GI AS++ +  V T A+  + F  PI 
Sbjct: 6   GEVVLRVVPHMTDINTNGHIFGGWVLSQMDIAGGIVASRIAQGPVATVAIESMTFIAPIL 65

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           + D+V +Y    + G+TSV +  DV       ++ V  +        VA+DE   P+ +
Sbjct: 66  LGDIVSVYAHEERRGRTSVAVRIDVVATRGRKAAKV--ELTSGLFTFVALDENHRPRPL 122


>gi|327482724|gb|AEA86034.1| long-chain acyl-CoA thioester hydrolase family protein [Pseudomonas
           stutzeri DSM 4166]
          Length = 133

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L++  +P + N  G+++GGW++SQ+D+A    AS++   RV T ++  + F  P+ 
Sbjct: 13  GDLALQLTALPRETNGFGDIYGGWLVSQMDLAGTAMASRVAAGRVATVSIDRMAFMVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   +  YTQ  ++G++S+ +  +VW+   +  S   +K  EA  V VA+D  G  +S+
Sbjct: 73  VGAQLSFYTQTLEVGRSSIRMLVEVWSD--DPLSSEWRKVTEAVFVFVAIDGSGRTRSV 129


>gi|15600564|ref|NP_254058.1| hypothetical protein PA5371 [Pseudomonas aeruginosa PAO1]
 gi|107104473|ref|ZP_01368391.1| hypothetical protein PaerPA_01005550 [Pseudomonas aeruginosa PACS2]
 gi|116053518|ref|YP_793845.1| hypothetical protein PA14_70930 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152988984|ref|YP_001351467.1| hypothetical protein PSPA7_6156 [Pseudomonas aeruginosa PA7]
 gi|218894474|ref|YP_002443344.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           aeruginosa LESB58]
 gi|254237941|ref|ZP_04931264.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|296392231|ref|ZP_06881706.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           aeruginosa PAb1]
 gi|313111700|ref|ZP_07797494.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           aeruginosa 39016]
 gi|9951693|gb|AAG08756.1|AE004949_3 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115588739|gb|ABJ14754.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126169872|gb|EAZ55383.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|150964142|gb|ABR86167.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
 gi|218774703|emb|CAW30520.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           aeruginosa LESB58]
 gi|310883996|gb|EFQ42590.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           aeruginosa 39016]
          Length = 134

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 68/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P + N  G+++GGW++SQ+D+A    AS++   R+ T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRETNGFGDIYGGWLVSQMDLAGTAMASKIAGGRIATVAIDRMAFMVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   +  YTQ  ++G++S+ +  +VW+   +  S   +K  EA  V VA+D  G  + +
Sbjct: 73  VGAQLSFYTQTLEVGRSSIRMLVEVWSD--DPLSSEWRKVTEAVFVFVAIDGSGRTRPV 129


>gi|103488186|ref|YP_617747.1| thioesterase superfamily protein [Sphingopyxis alaskensis RB2256]
 gi|98978263|gb|ABF54414.1| thioesterase superfamily [Sphingopyxis alaskensis RB2256]
          Length = 130

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 66/115 (57%), Gaps = 2/115 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L++   P D+N +G++FGGW+++Q+DIA GI A ++ +  V T A+  + F  PI + D+
Sbjct: 15  LRVVPRPADINANGHIFGGWVLAQMDIAGGIVAGRVAQGAVATVAIESMEFIAPILLRDI 74

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           + +Y  + + G+TS+ I  +V        ++  +K        VA+DE   P+++
Sbjct: 75  ISVYAHLERRGRTSMAIRIEVIATRDGGRTE--EKVTGGLFTFVALDENHRPRAL 127


>gi|146284340|ref|YP_001174493.1| long-chain acyl-CoA thioester hydrolase family protein [Pseudomonas
           stutzeri A1501]
 gi|145572545|gb|ABP81651.1| long-chain acyl-CoA thioester hydrolase family protein [Pseudomonas
           stutzeri A1501]
          Length = 170

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L++  +P + N  G+++GGW++SQ+D+A    AS++   RV T ++  + F  P+ 
Sbjct: 50  GDLALQLTALPRETNGFGDIYGGWLVSQMDLAGTAMASRVAAGRVATVSIDRMAFMVPVA 109

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   +  YTQ  ++G++S+ +  +VW+   +  S   +K  EA  V VA+D  G  +S+
Sbjct: 110 VGAQLSFYTQTLEVGRSSIRMLVEVWSD--DPLSSEWRKVTEAVFVFVAIDGSGRTRSV 166


>gi|213023913|ref|ZP_03338360.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
          Length = 112

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (58%), Gaps = 3/109 (2%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ V D+V  Y +  
Sbjct: 1   DTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYARCV 60

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKSI 149
           K G TS++I  +VW   + AS  + Q  K  EA  + VAVD  G P+ +
Sbjct: 61  KRGTTSISINIEVWV-KKVASEPIGQRYKATEALFIYVAVDPDGKPRPL 108


>gi|88705434|ref|ZP_01103145.1| acyl-CoA thioester hydrolase [Congregibacter litoralis KT71]
 gi|88700524|gb|EAQ97632.1| acyl-CoA thioester hydrolase [Congregibacter litoralis KT71]
          Length = 133

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 67/120 (55%), Gaps = 4/120 (3%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L ++   MP D N  G++FGGW++SQ+D+A  I A ++ K RV T A+  + F  P+ 
Sbjct: 12  GELAIQTIAMPKDTNASGDIFGGWLLSQMDLAGAITAEEVAKGRVATVAIDGMAFITPVH 71

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVW-TCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V  +V  +  + +IG++S+ I  +VW   P +       K  E   V VA+D++   ++I
Sbjct: 72  VGAVVSCFCDVIEIGRSSIRIMVEVWINSPHDGDP---IKVTEGEFVFVAIDDQRRTRTI 128


>gi|154174028|ref|YP_001407630.1| acyl-CoA thioester hydrolase YciA [Campylobacter curvus 525.92]
 gi|112802286|gb|EAT99630.1| acyl-CoA thioester hydrolase YciA [Campylobacter curvus 525.92]
          Length = 137

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/126 (35%), Positives = 70/126 (55%), Gaps = 5/126 (3%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           +   G   +K+  +P D N  GN+FGGWIMSQID+A    A ++   RVVT ++ E++F+
Sbjct: 4   LEDFGEPRIKLVALPKDTNSAGNIFGGWIMSQIDLAGAQAAREVAPERVVTISMKEVIFK 63

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCE---ATVVMVAVDEK 143
           +P+ V D+V  Y +I  +GKTS+T   +V     N      +++     AT   V+V + 
Sbjct: 64  QPVFVGDVVSCYAKIIGVGKTSITTQIEVTALRLNKGG--FRESVHVTSATATYVSVTKD 121

Query: 144 GNPKSI 149
           G  K I
Sbjct: 122 GEKKPI 127


>gi|226946864|ref|YP_002801937.1| Thioesterase superfamily protein [Azotobacter vinelandii DJ]
 gi|226721791|gb|ACO80962.1| Thioesterase superfamily protein [Azotobacter vinelandii DJ]
          Length = 132

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 68/119 (57%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+I  +P D N  G+++GGW+++Q+D+A    AS+L   RV T A+  + F  P+ 
Sbjct: 13  GDLALQITALPRDANGFGDIYGGWLVAQMDLAGTATASRLAGGRVATVAIDRMAFMVPVA 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V   +  YT+  + G++S+ +  +VW+   +  S   +K  EA  V VA+D  G  +++
Sbjct: 73  VGAQLSFYTKPLQQGRSSIQMLVEVWSD--DPLSSEWRKVTEAVFVFVAIDGSGRTRAV 129


>gi|144898430|emb|CAM75294.1| Thioesterase superfamily [Magnetospirillum gryphiswaldense MSR-1]
          Length = 137

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 65/122 (53%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L+++   MP D N  G +FGGW+++Q+D+A G  A    K  VVT AV  + F +P+ 
Sbjct: 18  GRLSIRTVAMPADTNPHGAIFGGWLLAQMDLAGGTHALHRAKGMVVTVAVDSMTFHEPVF 77

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V D V  YT + ++G +S+++  + W   R  + D   K   A    VAV+   + + + 
Sbjct: 78  VGDEVSCYTDVVRVGNSSISVRVEAWV--RRDNKDEQIKVTSALFHFVAVNPDRSKRRVP 135

Query: 151 TE 152
            E
Sbjct: 136 PE 137


>gi|23011513|ref|ZP_00051849.1| COG1607: Acyl-CoA hydrolase [Magnetospirillum magnetotacticum MS-1]
          Length = 139

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 64/126 (50%), Gaps = 2/126 (1%)

Query: 24  VCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTEL 83
             Q    G   ++   MPTD N  G++FGGW+M+Q+D+A G  A++  + R  T +   +
Sbjct: 10  ATQPTDRGPPVIRTVAMPTDTNPAGDIFGGWLMAQMDMAAGNVAARRARGRCATISAEAM 69

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEK 143
            F +P+ V D V  Y  I KIG TS+ I  +VW   R   S+V  K  E     VA+   
Sbjct: 70  TFHRPVIVGDEVTFYAWIVKIGHTSMRIQVEVWR--RERESEVTMKVTEGLFTFVAIGPD 127

Query: 144 GNPKSI 149
             P+ I
Sbjct: 128 RRPRPI 133


>gi|149184549|ref|ZP_01862867.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Erythrobacter sp. SD-21]
 gi|148831869|gb|EDL50302.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Erythrobacter sp. SD-21]
          Length = 125

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 2/115 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           +++  MP D N  G VFGGW+MSQ+ +  G  AS+  K + V  + T+  F   +QV D 
Sbjct: 8   IRVTAMPADTNPYGGVFGGWLMSQMALGAGSLASRHGKGKAVVVSATDFAFPGAMQVGDE 67

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           + +Y  I   G TS+TI  +     RN  ++   +  + T   V +DE+  P+++
Sbjct: 68  LSVYCDIAATGNTSLTITAEAIARERNGEAET--RVAQGTFKFVLLDEENRPRAV 120


>gi|294010053|ref|YP_003543513.1| acyl-CoA hydrolase [Sphingobium japonicum UT26S]
 gi|292673383|dbj|BAI94901.1| acyl-CoA hydrolase [Sphingobium japonicum UT26S]
          Length = 125

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 64/119 (53%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + L++     D+N +G++FGGW++SQ+DIA GI A+++ +  V T A+  + F  PI 
Sbjct: 6   GEVVLRVMPRMADINSNGHIFGGWVLSQMDIAGGIIAARIAQGPVATVAIESMTFIAPIL 65

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           + D+V +Y    + G+TSV I  DV         +V           VA+DE   P+ +
Sbjct: 66  LGDIVSVYAHEERRGRTSVAIRIDVVATRGRQGREV--GLTSGLFTFVALDENHRPRPL 122


>gi|295691318|ref|YP_003595011.1| thioesterase superfamily protein [Caulobacter segnis ATCC 21756]
 gi|295433221|gb|ADG12393.1| thioesterase superfamily protein [Caulobacter segnis ATCC 21756]
          Length = 144

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 59/115 (51%), Gaps = 2/115 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L+   MP+D N +G++FGGW++SQ+D+A    A      R  T A+  + F  P+ V D 
Sbjct: 30  LRAIAMPSDTNPEGDIFGGWLLSQMDLAAASIAFHRAAGRCATIAIDGMTFISPVFVGDE 89

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V ++ ++   G+TS+ +  + W   R    +   K  E     VA+DE   P+ +
Sbjct: 90  VSLFAKVVHTGRTSIKVAVEAWR--RRRDGEQAHKVTEGVFTFVAIDEHRKPRPL 142


>gi|218530164|ref|YP_002420980.1| thioesterase superfamily protein [Methylobacterium chloromethanicum
           CM4]
 gi|218522467|gb|ACK83052.1| thioesterase superfamily protein [Methylobacterium chloromethanicum
           CM4]
          Length = 139

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 63/128 (49%), Gaps = 2/128 (1%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
            Q    G   ++   MPTD N  G++FGGW+M+Q+D+A G  A++  + R  T +   + 
Sbjct: 11  VQPTDRGQAVIRTVAMPTDTNPAGDIFGGWLMAQMDMAAGNVAARRARGRCATISAEAMT 70

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           F +P+ V D V  Y  I K G+TS+ I  +VW   R    +   K  E     VA+    
Sbjct: 71  FHRPVFVGDEVSFYAWIVKTGRTSMRIQVEVWR--REREGEATMKVTEGLFTFVAIGPDR 128

Query: 145 NPKSIRTE 152
            P+ I  E
Sbjct: 129 RPRPIPEE 136


>gi|240138450|ref|YP_002962922.1| thioesterase/thiol ester dehydrase-isomerase domain protein
           [Methylobacterium extorquens AM1]
 gi|240008419|gb|ACS39645.1| thioesterase/thiol ester dehydrase-isomerase domain protein
           [Methylobacterium extorquens AM1]
          Length = 139

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 63/128 (49%), Gaps = 2/128 (1%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
            Q    G   ++   MPTD N  G++FGGW+M+Q+D+A G  A++  + R  T +   + 
Sbjct: 11  VQPTDRGQAVIRTVAMPTDTNPAGDIFGGWLMAQMDMAAGNVAARRARGRCATISAEAMT 70

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           F +P+ V D V  Y  I K G+TS+ I  +VW   R    +   K  E     VA+    
Sbjct: 71  FHRPVFVGDEVSFYAWIVKTGRTSMRIQVEVWR--REREGEATMKVTEGLFTFVAIGPDR 128

Query: 145 NPKSIRTE 152
            P+ I  E
Sbjct: 129 RPRPIPEE 136


>gi|254561114|ref|YP_003068209.1| thioesterase/thiol ester dehydrase-isomerase domain-containing
           protein [Methylobacterium extorquens DM4]
 gi|254268392|emb|CAX24348.1| thioesterase/thiol ester dehydrase-isomerase domain protein
           [Methylobacterium extorquens DM4]
          Length = 139

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 63/128 (49%), Gaps = 2/128 (1%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
            Q    G   ++   MPTD N  G++FGGW+M+Q+D+A G  A++  + R  T +   + 
Sbjct: 11  VQPTDRGQAVIRTVAMPTDTNPAGDIFGGWLMAQMDMAAGNVAARRARGRCATISAEAMT 70

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           F +P+ V D V  Y  I K G+TS+ I  +VW   R    +   K  E     VA+    
Sbjct: 71  FHRPVFVGDEVSFYAWIVKTGRTSMRIQVEVWR--REREGEATMKVTEGLFTFVAIGPDR 128

Query: 145 NPKSIRTE 152
            P+ I  E
Sbjct: 129 RPRPIPEE 136


>gi|157165613|ref|YP_001467539.1| thioesterase family protein [Campylobacter concisus 13826]
 gi|157101550|gb|EAT98442.2| acyl-CoA thioester hydrolase YciA [Campylobacter concisus 13826]
          Length = 137

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 65/113 (57%), Gaps = 5/113 (4%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  GN+FGGWIMSQID+A    A ++   RVVT ++ E++F++P+ V D++  Y 
Sbjct: 17  LPKDTNSAGNIFGGWIMSQIDLAGAQAAREISPERVVTISMKEIIFKQPVFVGDVLSCYA 76

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCE---ATVVMVAVDEKGNPKSI 149
           +I  +GKTS+T   +V     N      ++T     AT   V+V + G  K I
Sbjct: 77  KIIAVGKTSITTQIEVTALRLNDGG--FRETIHVTSATATYVSVTKDGLKKPI 127


>gi|163851356|ref|YP_001639399.1| thioesterase superfamily protein [Methylobacterium extorquens PA1]
 gi|163662961|gb|ABY30328.1| thioesterase superfamily protein [Methylobacterium extorquens PA1]
          Length = 139

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 62/122 (50%), Gaps = 2/122 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G   ++   MPTD N  G++FGGW+M+Q+D+A G  A++  + R  T +   + F +P+ 
Sbjct: 17  GQAVIRTVAMPTDTNPAGDIFGGWLMAQMDMAAGNVAARRARGRCATISAEAMTFHRPVF 76

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V D V  Y  I K G+TS+ I  +VW   R    +   K  E     VA+     P+ I 
Sbjct: 77  VGDEVSFYAWIVKTGRTSMRIQVEVWR--REREGEATMKVTEGLFTFVAIGPDRRPRPIP 134

Query: 151 TE 152
            E
Sbjct: 135 EE 136


>gi|188581073|ref|YP_001924518.1| thioesterase [Methylobacterium populi BJ001]
 gi|179344571|gb|ACB79983.1| thioesterase superfamily protein [Methylobacterium populi BJ001]
          Length = 139

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 62/125 (49%), Gaps = 2/125 (1%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
            Q    G   ++   MPTD N  G++FGGW+M+Q+D+A G  A++  + R  T +   + 
Sbjct: 11  VQPTDRGPPVIRTVAMPTDTNPAGDIFGGWLMAQMDMAAGNVAARRARGRCATISAEAMT 70

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           F +P+ V D V  Y  I K G+TS+ I  +VW   R    +   K  E     VA+    
Sbjct: 71  FHRPVFVGDEVSFYAWIVKTGRTSMRIQVEVWR--REREGEATMKVTEGLFTFVAIGPDR 128

Query: 145 NPKSI 149
            P+ I
Sbjct: 129 RPRPI 133


>gi|257458677|ref|ZP_05623802.1| acyl-CoA thioester hydrolase YciA [Campylobacter gracilis RM3268]
 gi|257443920|gb|EEV19038.1| acyl-CoA thioester hydrolase YciA [Campylobacter gracilis RM3268]
          Length = 139

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 68/124 (54%), Gaps = 3/124 (2%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G   +K+  +P D N  GN+FGGWI+SQID+A    A ++   RVVT ++ E+ F++P+ 
Sbjct: 10  GEPRIKVVALPKDTNSSGNIFGGWILSQIDLAGATAAREIAPERVVTISMQEVTFKQPVF 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWT--CPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           + D++  Y ++  +G TS+ +  +V       +   + L  T  A  + V+V + G  K 
Sbjct: 70  IGDVISCYAKVLSVGNTSIRVQIEVAALRLGEDGFRECLHVTS-AIAIYVSVTKSGQKKP 128

Query: 149 IRTE 152
           I  E
Sbjct: 129 ISAE 132


>gi|94496672|ref|ZP_01303248.1| putative Acyl-CoA hydrolase [Sphingomonas sp. SKA58]
 gi|94424032|gb|EAT09057.1| putative Acyl-CoA hydrolase [Sphingomonas sp. SKA58]
          Length = 129

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 63/116 (54%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G   L++     D+N +G++FGGW++SQ+DIA GI A +L +  V T A+  + F  PI 
Sbjct: 10  GEAVLRVMPRLADINANGHIFGGWVLSQMDIAGGIIAHRLAQGPVATVAIESMKFIAPIL 69

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           + D+V +Y +  + G+TS+ I  DV      A  +V   +   T V +  D +  P
Sbjct: 70  LGDIVSVYAREERRGRTSLAIRIDVVATRGIAQEEVPLTSGVYTFVALDADHRPRP 125


>gi|304313384|ref|YP_003812982.1| putative thioesterase superfamily protein [gamma proteobacterium
           HdN1]
 gi|301799117|emb|CBL47360.1| putative thioesterase superfamily protein [gamma proteobacterium
           HdN1]
          Length = 117

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 66/117 (56%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +T +   +P D N DG++ GGW+++Q+D+A    A ++   RV T A+  ++F +PI   
Sbjct: 1   MTTQTIALPCDTNADGDINGGWVVNQMDLAGASVAQRIAGGRVATVAMDTMVFLRPILPG 60

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             V  Y ++  IG++S+TI+ DVW C   A+    +K  +     VA+D   + ++I
Sbjct: 61  STVSCYCKVGTIGRSSITIHVDVWAC--GATESERKKITDGQFTFVAIDANRHTRAI 115


>gi|223040523|ref|ZP_03610796.1| acyl-CoA thioester hydrolase YciA [Campylobacter rectus RM3267]
 gi|222878269|gb|EEF13377.1| acyl-CoA thioester hydrolase YciA [Campylobacter rectus RM3267]
          Length = 138

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 57/98 (58%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           +   G   +K+  +P D N  GN+FGGWIMSQID+A    A ++   RVVT ++ E++F+
Sbjct: 5   LEGMGEPRIKVVALPKDTNSAGNIFGGWIMSQIDLAGAQAAREIAPERVVTISMQEIIFK 64

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASS 124
           +P+ + D+V  Y +I   G TS+    +V     NA+ 
Sbjct: 65  QPVFIGDVVSCYAKIVSAGNTSIKTKIEVTALRLNAAG 102


>gi|117619412|ref|YP_856171.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117560819|gb|ABK37767.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 156

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 61/117 (52%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LTL+    P DVN  G V GG +M  ID A    A+  C    VT  V  + F +PIQ+ 
Sbjct: 7   LTLQFLAEPADVNFGGKVHGGMVMKWIDQAGYACAAGWCGGYAVTVYVGGIRFLRPIQIG 66

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            LV ++ Q+   G TS+ +  DV++  R+ +S    KT    ++ VA+DE G P  +
Sbjct: 67  QLVEVHAQVIHTGTTSMHLAVDVYS--RHPASRERHKTTHCIIIFVAMDESGKPTPV 121


>gi|396664|emb|CAA79506.1| hypothetical protein p14 [Buchnera aphidicola]
          Length = 104

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (61%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G + LK  TM +D N +G++FGGWIMSQ+D+   I A ++   RVVT  V  + F KP+ 
Sbjct: 22  GTIVLKTLTMRSDTNANGDIFGGWIMSQMDMGGAILAKEIAGGRVVTVQVNGITFFKPVS 81

Query: 91  VSDLVHIYTQIRKIGKTSVTI 111
           V D+V  Y    K G +S+TI
Sbjct: 82  VGDIVSCYAHCIKTGNSSITI 102


>gi|330830227|ref|YP_004393179.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Aeromonas veronii B565]
 gi|328805363|gb|AEB50562.1| Cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Aeromonas veronii B565]
          Length = 155

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 62/117 (52%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LTL+    P+DVN  G V GG +M  ID A    A+  C    VT  V  + F +PIQ+ 
Sbjct: 6   LTLQFLAEPSDVNFGGKVHGGMVMKWIDQAGYACAAGWCGGYAVTVYVGGIRFLRPIQIG 65

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            LV ++ Q+   G TS+ +  DV++  R+ +     KT    ++ VA+DE+G P  +
Sbjct: 66  QLVEVHAQVIHTGTTSMHLAVDVYS--RHPTETERHKTTHCIIIFVAMDEQGKPTPV 120


>gi|158425719|ref|YP_001527011.1| acyl-CoA thioester hydrolase [Azorhizobium caulinodans ORS 571]
 gi|158332608|dbj|BAF90093.1| acyl-CoA thioester hydrolase [Azorhizobium caulinodans ORS 571]
          Length = 131

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 65/128 (50%), Gaps = 3/128 (2%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
            QM   G+  ++   MP D N  G++FGGW+MSQ+D+A G  A++  + R  T AV  + 
Sbjct: 6   AQM-PDGMPVIRTIAMPADTNPAGDIFGGWLMSQMDLAAGNVAARRSRGRAATIAVEAIT 64

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           F  P+ V D V ++  +  +G+TS+ I  + W   R    +   K  EA    VA+D   
Sbjct: 65  FHSPVYVGDEVSLFATLLSVGRTSMRIEVEAWR--RAREGEETHKVTEAIFTFVAIDADR 122

Query: 145 NPKSIRTE 152
             + +  E
Sbjct: 123 KARPVPPE 130


>gi|197105863|ref|YP_002131240.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Phenylobacterium zucineum HLK1]
 gi|196479283|gb|ACG78811.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Phenylobacterium zucineum HLK1]
          Length = 147

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 68/116 (58%), Gaps = 2/116 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
            +++  MP D N  G++FGGW+MSQ+D A G+ A++    R VT AV  + F +P++V D
Sbjct: 27  AIRVCAMPADANPYGDIFGGWLMSQMDTAAGLVAARAAGGRAVTVAVDGMSFVRPVKVGD 86

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +  ++ + G+TS++I+   W   R+   +  +   EAT   VA+D  G P+ I
Sbjct: 87  EVSVVGEVVRRGRTSLSIHIQAWR--RDRHEEGAELVTEATFTFVALDADGRPRRI 140


>gi|255323103|ref|ZP_05364239.1| acyl-CoA thioester hydrolase YciA [Campylobacter showae RM3277]
 gi|255299965|gb|EET79246.1| acyl-CoA thioester hydrolase YciA [Campylobacter showae RM3277]
          Length = 138

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 55/89 (61%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           +   G   +K   +P D N  GN+FGGWI+SQID+A    A ++   RVVT ++ E++F+
Sbjct: 5   LEGMGEPRMKQVALPKDTNSAGNIFGGWILSQIDLAGAQAAREVAPERVVTISMQEIIFK 64

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDV 115
           +P+ V D+V  Y +I ++G TS+    +V
Sbjct: 65  QPVFVGDVVSCYAKITEVGNTSIKTKIEV 93


>gi|324006092|gb|EGB75311.1| thioesterase family protein [Escherichia coli MS 57-2]
          Length = 101

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 58/95 (61%), Gaps = 2/95 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ V D+V  Y 
Sbjct: 1   MPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYA 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEAT 134
           +  + G TSV+I  +VW   +  +S+ + +  +AT
Sbjct: 61  RCVQKGTTSVSINIEVWV--KKVASEPIGQRYKAT 93


>gi|220962301|gb|ACL93657.1| acyl-CoA hydrolase [Caulobacter crescentus NA1000]
          Length = 115

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 56/108 (51%), Gaps = 2/108 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L+   MP+D N +G++FGGW++SQ+D+A    A      R  T A+  + F  P+ V D 
Sbjct: 2   LRAIAMPSDTNPEGDIFGGWLLSQMDLAAASIAFHRAAGRCATIAIDGMTFLSPVFVGDE 61

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           V ++ ++   G+TS+ +  + W   R    +   K  E     VA+DE
Sbjct: 62  VSLFAKVVHTGRTSLKVAVEAWR--RRRDGEQANKVTEGVFTFVAIDE 107


>gi|170744566|ref|YP_001773221.1| thioesterase superfamily protein [Methylobacterium sp. 4-46]
 gi|168198840|gb|ACA20787.1| thioesterase superfamily protein [Methylobacterium sp. 4-46]
          Length = 147

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 63/113 (55%), Gaps = 2/113 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G   ++   MP D N  G++FGGW+M+Q+D+A G  A++  + R  T AV  + F +P+ 
Sbjct: 13  GAPVIRTIAMPADTNPAGDIFGGWLMAQMDLAAGNVAARRARGRCATIAVEGMTFLQPVL 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEK 143
           V D V +Y +I  +G++S+ I  + W   R +   +  K  +A    VA+DE 
Sbjct: 73  VGDEVSLYARIVAVGRSSIRIQIEAWRRARESEETI--KVTQALFTFVAIDES 123


>gi|16124445|ref|NP_419009.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Caulobacter crescentus CB15]
 gi|13421311|gb|AAK22177.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Caulobacter crescentus CB15]
          Length = 152

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 56/108 (51%), Gaps = 2/108 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L+   MP+D N +G++FGGW++SQ+D+A    A      R  T A+  + F  P+ V D 
Sbjct: 39  LRAIAMPSDTNPEGDIFGGWLLSQMDLAAASIAFHRAAGRCATIAIDGMTFLSPVFVGDE 98

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           V ++ ++   G+TS+ +  + W   R    +   K  E     VA+DE
Sbjct: 99  VSLFAKVVHTGRTSLKVAVEAWR--RRRDGEQANKVTEGVFTFVAIDE 144


>gi|94985872|ref|YP_605236.1| thioesterase superfamily protein [Deinococcus geothermalis DSM
           11300]
 gi|94556153|gb|ABF46067.1| thioesterase superfamily [Deinococcus geothermalis DSM 11300]
          Length = 139

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 60/110 (54%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  G +FGG  ++ +D A  I A++ C+ +VVT+ + E  F +P+    LV +  
Sbjct: 23  FPGTTNHHGTLFGGEALAYMDSAAFIAATRHCRRKVVTRHLGETEFRRPVPAGTLVELIA 82

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++   G+TS+T+  ++WT      S+  +  C  T V+VA+DE G P  +
Sbjct: 83  RVVATGRTSMTVQVELWT--EQLYSEERELGCVGTFVLVALDEAGRPTPV 130


>gi|304570784|ref|YP_002515565.2| acyl-CoA hydrolase [Caulobacter crescentus NA1000]
          Length = 144

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 56/108 (51%), Gaps = 2/108 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L+   MP+D N +G++FGGW++SQ+D+A    A      R  T A+  + F  P+ V D 
Sbjct: 31  LRAIAMPSDTNPEGDIFGGWLLSQMDLAAASIAFHRAAGRCATIAIDGMTFLSPVFVGDE 90

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           V ++ ++   G+TS+ +  + W   R    +   K  E     VA+DE
Sbjct: 91  VSLFAKVVHTGRTSLKVAVEAWR--RRRDGEQANKVTEGVFTFVAIDE 136


>gi|167648146|ref|YP_001685809.1| thioesterase superfamily protein [Caulobacter sp. K31]
 gi|167350576|gb|ABZ73311.1| thioesterase superfamily protein [Caulobacter sp. K31]
          Length = 145

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 58/113 (51%), Gaps = 2/113 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L+   MP+D N +G++FGGW++SQ+D+A    A      R  T A+  + F  P+ V D 
Sbjct: 30  LRAIAMPSDTNPEGDIFGGWLLSQMDLAAASIAFHRAAGRCATIAIDGMTFISPVFVGDE 89

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           V ++ ++  +G+TS+ +  + W   R    +   K  +     VA+ E   P+
Sbjct: 90  VSLFAKVVHVGRTSLKVQVEAWR--RRRDGEQAHKVTQGVFTFVAIGEDRKPR 140


>gi|291295353|ref|YP_003506751.1| thioesterase superfamily protein [Meiothermus ruber DSM 1279]
 gi|290470312|gb|ADD27731.1| thioesterase superfamily protein [Meiothermus ruber DSM 1279]
          Length = 136

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 61/112 (54%), Gaps = 2/112 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P D N  GN++GG  M+ +D A  + A++  +C+VVT     + F  P+    +V +   
Sbjct: 18  PPDCNHYGNLYGGTAMAWMDEAAFVAATRYARCKVVTVHTDAIDFHHPVPQGSIVELVAW 77

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           +  +G++S+ +  ++W  P +    +L   C A  VMVA+ E G PK+IR +
Sbjct: 78  VTSVGRSSMRLEVEMWVEPIDKEERIL--ACRAGFVMVALGEDGRPKTIRNQ 127


>gi|34498177|ref|NP_902392.1| medium-chain acyl coenzyme A hydrolase [Chromobacterium violaceum
           ATCC 12472]
 gi|34104032|gb|AAQ60392.1| probable medium-chain acyl coenzyme A hydrolase [Chromobacterium
           violaceum ATCC 12472]
          Length = 125

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 65/125 (52%), Gaps = 5/125 (4%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  Q H + VL  +++ +PT  N  G V  GW+MSQID+A  + A +L +  V T AV  
Sbjct: 1   MEQQEHRTPVL--RVRALPTSTNAYGRVQAGWLMSQIDMAGSLDAERLSRGPVTTVAVNA 58

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
             F  PI + D+V +Y +  +IG+ S+T+   V    R   S V  +  E     VAVD 
Sbjct: 59  FQFAAPILLGDVVDMYVERLRIGQKSITLKISV-EAERMDGSHV--RITEVIATFVAVDA 115

Query: 143 KGNPK 147
           +G  +
Sbjct: 116 EGKSR 120


>gi|226357071|ref|YP_002786811.1| acetyl-CoA hydrolase [Deinococcus deserti VCD115]
 gi|226319061|gb|ACO47057.1| putative acetyl-CoA hydrolase [Deinococcus deserti VCD115]
          Length = 145

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  G  FGGW++S +D A  + A +     VVT  +  + F  PI+V D V +  
Sbjct: 20  FPKDTNYHGTAFGGWVLSLMDKAASVAAVRHASGNVVTARMDGVDFHVPIRVGDAVALDA 79

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ ++G+TS+TI  DV+    + +S   +       V VA+DE+G P+++
Sbjct: 80  RVVRVGRTSMTIQVDVYR--EHIASGEQELATTGFFVFVALDEQGRPRAV 127


>gi|320355336|ref|YP_004196675.1| thioesterase superfamily protein [Desulfobulbus propionicus DSM
           2032]
 gi|320123838|gb|ADW19384.1| thioesterase superfamily protein [Desulfobulbus propionicus DSM
           2032]
          Length = 137

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 64/109 (58%), Gaps = 3/109 (2%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKC-RVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           +++ L+GN+FGG ++S +D A    A  LC+   +VT  + E+LF +P+++S  V IY +
Sbjct: 12  SEIGLNGNLFGGTLLSWLDEAGAAFAGYLCRAPNMVTLKMEEVLFRRPVKISHHVRIYAR 71

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           + K+G TS+TI  DV     +   D+ +  C   +V V +D +GN   I
Sbjct: 72  VYKVGTTSLTI--DVEARRFDFEKDLEELVCSTRMVYVKIDAQGNASPI 118


>gi|23009152|ref|ZP_00050308.1| COG1607: Acyl-CoA hydrolase [Magnetospirillum magnetotacticum MS-1]
          Length = 129

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 63/115 (54%), Gaps = 2/115 (1%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L+  T+P++ NL+G VFGGWIM+++D A G+   +  +    T AV  L F   ++V + 
Sbjct: 12  LRTLTLPSEANLNGGVFGGWIMAELDKAAGLLGMRRAQGACATVAVENLRFLAALKVGEE 71

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             +Y ++  +G++S+ +  D +    + +    +   EA  V VA+D +G  + I
Sbjct: 72  FSVYGRVESVGRSSMRLKLDGFAG--SPAGGERRPVVEALFVSVALDAEGRSRPI 124


>gi|85708659|ref|ZP_01039725.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Erythrobacter sp. NAP1]
 gi|85690193|gb|EAQ30196.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Erythrobacter sp. NAP1]
          Length = 124

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L ++   MPTD+N  G VFGGW+M+Q+ +  G  AS++ K + V    T+  F   + V 
Sbjct: 6   LMIRATAMPTDLNPYGGVFGGWLMAQMALGAGALASRVGKGKAVVVHATDFTFPGAMVVG 65

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           D + +Y +I   G TS+TI  +     R    +   K    T   V +DE   P+ +
Sbjct: 66  DELSVYCEITASGTTSLTIKAE--GVGRERDGEATTKVSAGTFKFVLLDENDRPRKV 120


>gi|291297809|ref|YP_003509087.1| thioesterase superfamily protein [Stackebrandtia nassauensis DSM
           44728]
 gi|290567029|gb|ADD39994.1| thioesterase superfamily protein [Stackebrandtia nassauensis DSM
           44728]
          Length = 176

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 64/128 (50%), Gaps = 13/128 (10%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q  S   LTL     P D NL G V GG I+  ID   G+ A++  +   VT ++ E +F
Sbjct: 14  QAPSDSRLTLSSIMSPQDTNLMGTVHGGVILKLIDSVAGVVAARHSQGPAVTASMDETVF 73

Query: 86  EKPIQVSDLVHIYTQIRKIGKTS----VTIYCDVW--TCPRNASSDVLQKTCEATVVMVA 139
             P++V D+ H+  +I   G+TS    VT+  D W  T P             A +VMVA
Sbjct: 74  LAPVRVGDVAHVDARITWAGRTSMEVAVTVTADRWNETVP-------ATTVATAHLVMVA 126

Query: 140 VDEKGNPK 147
           VD+ GNP+
Sbjct: 127 VDDNGNPR 134


>gi|220926483|ref|YP_002501785.1| thioesterase superfamily protein [Methylobacterium nodulans ORS
           2060]
 gi|219951090|gb|ACL61482.1| thioesterase superfamily protein [Methylobacterium nodulans ORS
           2060]
          Length = 149

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 62/112 (55%), Gaps = 2/112 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G   ++   MP D N  G++FGGW+M+Q+D+A G  A++  + R  T AV  + F  P+ 
Sbjct: 13  GAPVIRTIAMPADTNPAGDIFGGWLMAQMDLAAGNVAARRARGRCATIAVEGMTFLHPVS 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           V D V +Y +I  +G++S+ I  + W   R +   +  K  +A    VA+D+
Sbjct: 73  VGDEVSLYARIVAVGRSSIRIQIEAWRRARESEETI--KVTQALFTFVAIDK 122


>gi|145299650|ref|YP_001142491.1| acyl-CoA thioester hydrolase-related protein [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142852422|gb|ABO90743.1| acyl-CoA thioester hydrolase-related protein [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 156

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 60/117 (51%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LTL+    P DVN  G V GG +M  ID A    A+  C    VT  V  + F +PIQ+ 
Sbjct: 7   LTLQFLAEPADVNFGGKVHGGMVMKWIDQAGYACAAGWCSGYAVTVYVGGIRFLRPIQIG 66

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            LV ++ ++   G TS+ +  D+++  R+ +     KT    ++ VA+DE G P  +
Sbjct: 67  QLVEVHAEVIHTGTTSMHLAVDIYS--RHPADRQRHKTTHCIIIFVAMDETGTPTRV 121


>gi|85374054|ref|YP_458116.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Erythrobacter litoralis HTCC2594]
 gi|84787137|gb|ABC63319.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Erythrobacter litoralis HTCC2594]
          Length = 115

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  G +FGGW+MSQ+ +  G  AS+  + + V  + T+  F   + V D + +Y 
Sbjct: 1   MPADTNPYGGIFGGWLMSQMALGAGALASREGRGKAVVVSATDFAFPGAMAVGDELSVYC 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +   G TS+TI  +     RN   +   K  + T   V +DE   P+++
Sbjct: 61  GVLATGTTSLTIAAEAIARERN--GEATTKVAQGTFKFVLLDENDRPRNV 108


>gi|332519516|ref|ZP_08395983.1| thioesterase superfamily protein [Lacinutrix algicola 5H-3-7-4]
 gi|332045364|gb|EGI81557.1| thioesterase superfamily protein [Lacinutrix algicola 5H-3-7-4]
          Length = 169

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P + N   N+FGG +++++D A GI A +  +  VVT +V  + F + I +  +V +  
Sbjct: 18  LPGETNPINNLFGGELLARMDRAAGISARRHSRRIVVTASVNHVAFNRAIPLGSVVTVDA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ +  K+S+ IY DVW   R   S +  K  EA    VAVDE G P
Sbjct: 78  KVSRAFKSSMEIYIDVWIEDRE--SGIKDKANEAIYTFVAVDETGRP 122


>gi|224824964|ref|ZP_03698070.1| thioesterase superfamily protein [Lutiella nitroferrum 2002]
 gi|224602635|gb|EEG08812.1| thioesterase superfamily protein [Lutiella nitroferrum 2002]
          Length = 126

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 58/114 (50%), Gaps = 3/114 (2%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           TL+++ +P+  N  G V  GW+M QID+A  + A +L K  V T AV    F  PIQV D
Sbjct: 10  TLRVRALPSSTNAYGQVQAGWLMGQIDMAGSMVAERLSKGPVTTVAVNAFQFAAPIQVGD 69

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
            V +Y    ++G+ S+T    V    R    +VL    E  V  VA+D  G  +
Sbjct: 70  TVSLYVDTLRVGQKSLTFKICVL-AERLQGEEVL--VTEVIVTFVAIDSNGKSR 120


>gi|86135179|ref|ZP_01053761.1| acyl-CoA thioester hydrolase [Polaribacter sp. MED152]
 gi|85822042|gb|EAQ43189.1| acyl-CoA thioester hydrolase [Polaribacter sp. MED152]
          Length = 170

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 57/107 (53%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N   N+FGG +++++D AC I A +     VVT +V  + F K + V  +V +  
Sbjct: 18  LPGDTNYLDNLFGGELLARMDRACSIAARRHSSRIVVTASVNHVAFNKSVPVGSVVTLEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ +  K+S+ IY DVW   R   S +  K  E     VAVDE G P
Sbjct: 78  KVSRAFKSSMEIYVDVWIEDRQ--SGMRTKVNEGIYTFVAVDETGKP 122


>gi|94986263|ref|YP_605627.1| thioesterase superfamily protein [Deinococcus geothermalis DSM
           11300]
 gi|94556544|gb|ABF46458.1| thioesterase superfamily [Deinococcus geothermalis DSM 11300]
          Length = 176

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 59/110 (53%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  G  FGG+++S +D A  + A +  +  VVT  +  + F  PI+V D V +  
Sbjct: 53  FPKDTNYLGTAFGGFVLSLMDKAASVAAVRHARGAVVTARMDGVDFHVPIRVGDAVALDA 112

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ K+G++S+TI  DV+    N +S   Q       V VAVDE G P+ +
Sbjct: 113 RVVKVGRSSMTIQVDVFR--ENMASGEQQLATTGFFVFVAVDEHGKPRPV 160


>gi|163786971|ref|ZP_02181418.1| possible acyl-CoA thioester hydrolase [Flavobacteriales bacterium
           ALC-1]
 gi|159876859|gb|EDP70916.1| possible acyl-CoA thioester hydrolase [Flavobacteriales bacterium
           ALC-1]
          Length = 169

 Score = 70.1 bits (170), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P++ N   N+FGG +++++D A  I A +  +  VVT +V  + F + + +  +V I  
Sbjct: 18  LPSETNPINNLFGGELLARMDRAASISARRHSRRIVVTASVNHVAFNRSVPLGSVVMIEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ +  K+S+ IY DVW   R +   V  K  EA    VAVDE G P
Sbjct: 78  KVSRAFKSSMEIYMDVWIEDRESGERV--KANEAIYTFVAVDETGRP 122


>gi|282866263|ref|ZP_06275309.1| thioesterase superfamily protein [Streptomyces sp. ACTE]
 gi|282558849|gb|EFB64405.1| thioesterase superfamily protein [Streptomyces sp. ACTE]
          Length = 182

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 59/108 (54%), Gaps = 1/108 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D NL G V GG IM  +D A G  A +      VT ++ E++F +P++V DLVH+  Q+
Sbjct: 31  SDTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRVGDLVHVRAQV 90

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              G++S+ +   V     N S+   Q+   A +V  AVDE G P+ +
Sbjct: 91  NWTGRSSMEVGVRVMAERWNESTPA-QQVGSAYLVFAAVDEAGRPRQV 137


>gi|327404925|ref|YP_004345763.1| thioesterase superfamily protein [Fluviicola taffensis DSM 16823]
 gi|327320433|gb|AEA44925.1| thioesterase superfamily protein [Fluviicola taffensis DSM 16823]
          Length = 158

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 59/115 (51%), Gaps = 2/115 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +T +  + PTDVN  G V GG +M  ID A    AS   +   VT  V  + F KPI + 
Sbjct: 5   ITFQFVSEPTDVNFGGKVHGGAVMKWIDQAAYACASTWSEGYCVTVYVGGIRFFKPIHIG 64

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
            LV I  ++   GK+S+ I  DV++  R  S    +KT    +V V+VDE G  K
Sbjct: 65  SLVKIQARVIYTGKSSIHIGVDVFS--RKMSEHKYEKTTHCVIVFVSVDENGKSK 117


>gi|89092201|ref|ZP_01165155.1| hypothetical protein MED92_05298 [Oceanospirillum sp. MED92]
 gi|89083289|gb|EAR62507.1| hypothetical protein MED92_05298 [Oceanospirillum sp. MED92]
          Length = 133

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 68/123 (55%), Gaps = 2/123 (1%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           +   G L+L +       N+ G+VFGGW+ +++  A  I A++L K RV T ++ ++ F 
Sbjct: 9   LQPEGELSLLLPAGSDATNMFGDVFGGWVSAKMVQASEIYAAKLSKGRVSTVSIGQMAFM 68

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            P++   ++  YT++ + G++S+ +  + W C  + S   L+K  E   V VA+D  G+ 
Sbjct: 69  SPVREGTVMSFYTKLIESGRSSLRVSVEAWGCCPDGSE--LRKVTETECVQVAIDGHGHI 126

Query: 147 KSI 149
           + I
Sbjct: 127 RDI 129


>gi|148657200|ref|YP_001277405.1| thioesterase superfamily protein [Roseiflexus sp. RS-1]
 gi|148569310|gb|ABQ91455.1| thioesterase superfamily protein [Roseiflexus sp. RS-1]
          Length = 131

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 63/110 (57%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N    +FGG  ++ ID A  I A++ C+ +VVT  ++E+ F  PI+   +V +  
Sbjct: 16  FPVDTNHYRTLFGGKAVAWIDQAAFICATRWCRRKVVTVRISEVNFHHPIREGSIVEVIA 75

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ + G++S+ I  DVW  P +    VL   C+AT V+VA+D+   P ++
Sbjct: 76  RLVRTGRSSMQIAVDVWWEPMDYEERVL--ACQATCVLVALDDNNRPVAV 123


>gi|255531168|ref|YP_003091540.1| thioesterase superfamily protein [Pedobacter heparinus DSM 2366]
 gi|255344152|gb|ACU03478.1| thioesterase superfamily protein [Pedobacter heparinus DSM 2366]
          Length = 174

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 57/105 (54%), Gaps = 2/105 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N   N+ GG ++  +DIA  I A + C   VVT +V  + F++PI++ D++ I  
Sbjct: 20  LPNDTNTLNNLMGGRLLHWMDIAAAISAQKHCNRIVVTASVDNVSFQQPIKLGDVITIEA 79

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           ++ +   TSV +  DVW    N  S    K+ EA    VAVD+ G
Sbjct: 80  KVTRAFNTSVEVRLDVWA--ENIPSGSRAKSNEAYYTFVAVDQSG 122


>gi|149280363|ref|ZP_01886484.1| possible acyl-CoA thioester hydrolase [Pedobacter sp. BAL39]
 gi|149228912|gb|EDM34310.1| possible acyl-CoA thioester hydrolase [Pedobacter sp. BAL39]
          Length = 173

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 57/105 (54%), Gaps = 2/105 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N   N+ GG ++  +DIA  I A + C   VVT +V  + F++PI++ D++ I  
Sbjct: 20  LPNDTNTLNNLMGGRLLHWMDIAAAISAQKHCNRIVVTASVDNVSFKQPIKLGDVITIEA 79

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           ++ +   TSV +  DVW    N  S    K+ EA    VAVD+ G
Sbjct: 80  KVTRAFNTSVEVRLDVWA--ENIPSGTRMKSNEAYYTFVAVDQSG 122


>gi|297565921|ref|YP_003684893.1| thioesterase superfamily protein [Meiothermus silvanus DSM 9946]
 gi|296850370|gb|ADH63385.1| thioesterase superfamily protein [Meiothermus silvanus DSM 9946]
          Length = 120

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 59/110 (53%), Gaps = 3/110 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  GN FGG+++  +D      A +  + R VT  V E++FE PI+V DL+ +  
Sbjct: 12  FPEHANPGGNAFGGFVLGLMDKVGSYAAIRRARKRCVTVRVGEVVFEVPIRVGDLLEVIA 71

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ ++G+TS+T+  +V+   R   ++         +  VAVDE+G P  +
Sbjct: 72  RVVRVGRTSITVEVEVY---RENLTEPKMLATRGNLTYVAVDEQGKPTPV 118


>gi|91217996|ref|ZP_01254948.1| thioesterase domain protein [Psychroflexus torquis ATCC 700755]
 gi|91183854|gb|EAS70245.1| thioesterase domain protein [Psychroflexus torquis ATCC 700755]
          Length = 172

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P++ N   N+FGG +++++D A  I A +  +  VVT +V  + F K I +  +V +  
Sbjct: 18  LPSETNPLNNLFGGELLARMDRAASIAARRHSRRIVVTASVNHVAFNKAIPLGSVVTVEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ +  KTS+ I+ DVW   R   S    K  EA    VAVD+ GNP
Sbjct: 78  KVTRSFKTSMEIFLDVWIEDR--ESGKRSKANEAIYTFVAVDDTGNP 122


>gi|320010424|gb|ADW05274.1| thioesterase superfamily protein [Streptomyces flavogriseus ATCC
           33331]
          Length = 182

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +D A G  A +      VT ++ E++F +P++V DLVH+  Q+ 
Sbjct: 32  DTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRVGDLVHVRAQVN 91

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G++S+ +   V     N S+   Q+   A +V  AVDE G P+ +
Sbjct: 92  WTGRSSMEVGVRVMAERWNESTPA-QQVGSAYLVFAAVDEDGKPRRV 137


>gi|163754746|ref|ZP_02161868.1| possible acyl-CoA thioester hydrolase [Kordia algicida OT-1]
 gi|161325687|gb|EDP97014.1| possible acyl-CoA thioester hydrolase [Kordia algicida OT-1]
          Length = 170

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 58/107 (54%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P++ N   N+FGG +++++D A  I A +  +  VVT +V  + F + I V  +V +  
Sbjct: 18  LPSETNPLNNLFGGELLARMDRAASIAARRHSRRIVVTASVNHVAFNRSIPVGSVVTVEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            I +  K+S+ IY DVW   R   S +  K  EA    VAVD+ G P
Sbjct: 78  NISRAFKSSMEIYIDVWIEDRE--SGMRDKANEAIYTFVAVDDTGRP 122


>gi|313679332|ref|YP_004057071.1| thioesterase superfamily protein [Oceanithermus profundus DSM
           14977]
 gi|313152047|gb|ADR35898.1| thioesterase superfamily protein [Oceanithermus profundus DSM
           14977]
          Length = 123

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 56/110 (50%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  GN FGG+++  +D      A++  K  VVT AV  + FE PI+  DL+ +  
Sbjct: 12  FPEHTNPLGNAFGGFVLGLMDKVGSYAAARRAKKPVVTVAVGRVEFEVPIRAGDLLEVVA 71

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ ++G+TS+T+  DV+                  +V VA++E+G P  +
Sbjct: 72  RVARVGRTSLTVQVDVFKERFGGGEATRVLATRGELVYVAINEEGQPTPV 121


>gi|117927619|ref|YP_872170.1| thioesterase superfamily protein [Acidothermus cellulolyticus 11B]
 gi|117648082|gb|ABK52184.1| thioesterase superfamily protein [Acidothermus cellulolyticus 11B]
          Length = 171

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 56/107 (52%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG +M  ID   G  AS+ C  R VT AV E++F  P+ + D++    Q+ 
Sbjct: 24  DANLYGIVHGGTVMRMIDETAGAVASRHCGGRAVTVAVDEMVFLVPVHIGDIITCQAQVN 83

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G+TS  I   V   P + + +  +    A +V VA+DE   P++I
Sbjct: 84  WTGRTSCEIGVRVTAQPWDRADEEPRHVASAYLVFVAIDENERPRAI 130


>gi|217976557|ref|YP_002360704.1| thioesterase superfamily protein [Methylocella silvestris BL2]
 gi|217501933|gb|ACK49342.1| thioesterase superfamily protein [Methylocella silvestris BL2]
          Length = 148

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 59/113 (52%), Gaps = 4/113 (3%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  G++FGGW+M+Q+D+A G  A++  + R  T  V  + F  P+ V D V +Y 
Sbjct: 31  MPADTNPAGDIFGGWLMAQMDLAAGNVAARRARGRCATVTVEGMTFLSPVFVGDEVSLYA 90

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAV--DEKGNPKSIR 150
            +   G+TS+ +  + W   R    + + K  EA  V VA+  D K  P   R
Sbjct: 91  WLVSEGRTSMRVKVEAWR--RYREEEAVNKVTEALFVFVAIGKDRKPTPLPPR 141


>gi|88802023|ref|ZP_01117551.1| thioesterase domain protein [Polaribacter irgensii 23-P]
 gi|88782681|gb|EAR13858.1| thioesterase domain protein [Polaribacter irgensii 23-P]
          Length = 169

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P + N   N+FGG +++++D AC I A +  +  VVT +V  + F K + V  +V +  
Sbjct: 18  LPGETNYLDNLFGGELLARMDRACSIAARRHSRRIVVTASVNHVAFNKSVPVGSVVTVEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ +   +S+ IY DVW   R +      K  E     VAVDE G P
Sbjct: 78  KVSRAFNSSMEIYVDVWIEDRQSRHRT--KVNEGIYTFVAVDETGKP 122


>gi|10957412|ref|NP_051638.1| hypothetical protein DR_B0106 [Deinococcus radiodurans R1]
 gi|6460841|gb|AAF12545.1|AE001826_14 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 147

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 60/110 (54%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  G +FGG  +S +D A  I A++ C+ +VVT+ +  + F +PI    LV +  
Sbjct: 32  FPGTTNHHGTLFGGEALSMMDSAAFIAATRYCRRKVVTRHLDAMEFSRPIPQGSLVELIA 91

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ K G++S+T+  +++T   +  S+  +  C  T V+VA+   G P  +
Sbjct: 92  RVVKTGRSSMTVLVELFT--EDMYSEKRELGCSGTFVLVALGADGQPTPV 139


>gi|192361965|ref|YP_001981489.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Cellvibrio japonicus Ueda107]
 gi|190688130|gb|ACE85808.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Cellvibrio japonicus Ueda107]
          Length = 160

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LTL+    PTD+N  G V GG  M  ID+A    AS       +T  +  + F KPI V 
Sbjct: 8   LTLRFLAEPTDINFGGKVHGGAAMKWIDLAAYACASAWSGKYCITAYMGGMRFVKPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +V +  ++   G+TS+ +  +V + P  + +  L   C A  +MVAVDE+G P  +
Sbjct: 68  HMVEVDAKVIYTGRTSMHLGIEVRSGPPTSVTKELTTHCVA--IMVAVDEQGRPTQV 122


>gi|307330541|ref|ZP_07609682.1| thioesterase superfamily protein [Streptomyces violaceusniger Tu
           4113]
 gi|306883790|gb|EFN14835.1| thioesterase superfamily protein [Streptomyces violaceusniger Tu
           4113]
          Length = 190

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 58/108 (53%), Gaps = 1/108 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D NL G V GG IM  +D A G  A +  +   VT ++ E++F +P++V DLVH+  Q+
Sbjct: 31  SDTNLLGTVHGGVIMKLVDDAAGAVAGRHSEGPAVTASMDEMVFLEPVRVGDLVHVKAQV 90

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              G++S+ I   V     N S+   Q    A +V  AVD  G P+ +
Sbjct: 91  NWTGRSSMEIGVRVLAERWNESTPATQ-VGSAYLVFAAVDADGKPRPV 137


>gi|256425565|ref|YP_003126218.1| thioesterase superfamily protein [Chitinophaga pinensis DSM 2588]
 gi|256040473|gb|ACU64017.1| thioesterase superfamily protein [Chitinophaga pinensis DSM 2588]
          Length = 171

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 57/108 (52%), Gaps = 2/108 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  GN+ GG +M  +DIA  +   + C   VVT +V  + FE PI++ ++VHI  
Sbjct: 20  LPNDTNTFGNLMGGRLMYWMDIAGALATMKHCSAPVVTASVDNISFETPIKLGNVVHIEA 79

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           ++ +   TS+ ++  VW    +       K+ EA +  VA+D  G  +
Sbjct: 80  KVSRAFSTSMEVHLRVWG--EDPVQQYRYKSNEAFMTFVALDPNGKSR 125


>gi|323211100|gb|EFZ95954.1| acyl-CoA thioester hydrolase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
          Length = 80

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L L+   MP D N +G++FGGW+MSQ+DI   I A ++   RVVT  V  + F +P+ 
Sbjct: 7   GELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVA 66

Query: 91  VSDLVHIYTQ 100
           V D+V  Y +
Sbjct: 67  VGDVVCCYAR 76


>gi|120437578|ref|YP_863264.1| acyl-CoA thioester hydrolase [Gramella forsetii KT0803]
 gi|117579728|emb|CAL68197.1| acyl-CoA thioester hydrolase [Gramella forsetii KT0803]
          Length = 170

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 62/124 (50%), Gaps = 2/124 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  +  S    TL    +P++ N   N+FGG +++++D A  I A +  +  VVT +V  
Sbjct: 1   MEAKPPSESRTTLTDLVLPSETNPLNNLFGGELLARMDRAASIAARRHSRRIVVTASVNH 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + F K I +  +V +   + +  K+S+ IY DVW   R +      K  EA    VAVDE
Sbjct: 61  VAFNKAIPLGSVVTVEAVVSRAFKSSMEIYIDVWVEDRESGRRT--KANEAIYTFVAVDE 118

Query: 143 KGNP 146
            G P
Sbjct: 119 TGVP 122


>gi|302544875|ref|ZP_07297217.1| putative acyl-CoA hydrolase [Streptomyces hygroscopicus ATCC 53653]
 gi|302462493|gb|EFL25586.1| putative acyl-CoA hydrolase [Streptomyces himastatinicus ATCC
           53653]
          Length = 187

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 58/108 (53%), Gaps = 1/108 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D NL G V GG IM  +D A G  A +  +   VT ++ E+ F +P++V DLVH+  Q+
Sbjct: 35  SDTNLLGTVHGGVIMKLVDDAAGAVAGRHSEGPAVTASMDEMAFLEPVRVGDLVHVKAQV 94

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              G++S+ +   V     N S+   Q    A +V  AVD  G P+++
Sbjct: 95  NWTGRSSMEVGVRVLAERWNESTPATQ-VGSAYLVFAAVDADGKPRTV 141


>gi|320333802|ref|YP_004170513.1| thioesterase superfamily protein [Deinococcus maricopensis DSM
           21211]
 gi|319755091|gb|ADV66848.1| thioesterase superfamily protein [Deinococcus maricopensis DSM
           21211]
          Length = 138

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  G  FGG+++S +D    + A +  K  VVT  +  + F  PI+V D V +  
Sbjct: 20  FPKDTNYHGTAFGGFVLSLMDKVASVAAIRHSKSGVVTARMDAVDFHVPIRVGDAVALEA 79

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
            + K+G+TS+TI  DV+    + +S   Q     + V VAVD +G 
Sbjct: 80  HVVKVGRTSMTIRVDVYR--EHLASGEQQLATSGSFVFVAVDAQGR 123


>gi|291294790|ref|YP_003506188.1| thioesterase superfamily protein [Meiothermus ruber DSM 1279]
 gi|290469749|gb|ADD27168.1| thioesterase superfamily protein [Meiothermus ruber DSM 1279]
          Length = 119

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 3/110 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  GN FGG+++  +D      A +  + R VT  V E++FE PI+V DL+ +  
Sbjct: 11  FPEHANPGGNAFGGFVLGLMDKVGSYAAIRHARKRCVTVRVGEVVFEVPIKVGDLLEVVA 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ ++G+TS+T+  +V+   R    +      +  +  VAVDE G P  +
Sbjct: 71  KVVRVGRTSLTVEVEVY---RENLREPKVLATKGNLTYVAVDEHGKPTPV 117


>gi|182438282|ref|YP_001826001.1| putative acyl-CoA hydrolase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178466798|dbj|BAG21318.1| putative acyl-CoA hydrolase [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 189

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 58/108 (53%), Gaps = 1/108 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D NL G V GG IM  +D A G  A +      VT ++ E++F +P++V DLVH+  Q+
Sbjct: 38  SDTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRVGDLVHVRAQV 97

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              G++S+ +   V     N S+   Q+   A +V  AVD  G P+ +
Sbjct: 98  NWTGRSSMEVGVRVMAERWNESTPA-QQVGSAYLVFAAVDGDGKPRPV 144


>gi|156742888|ref|YP_001433017.1| thioesterase superfamily protein [Roseiflexus castenholzii DSM
           13941]
 gi|156234216|gb|ABU58999.1| thioesterase superfamily protein [Roseiflexus castenholzii DSM
           13941]
          Length = 131

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 63/110 (57%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P + N    +FGG  ++ ID A  I A++ C+ +VVT  ++E+ F  P++   +V +  
Sbjct: 16  FPMNTNHYRTLFGGTAVAWIDQAAFICATRWCRRKVVTVRISEVNFHHPVREGSIVEVIA 75

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++   G++S+ I  DVW  P + +  VL   C+A  V+VAVDE+  P ++
Sbjct: 76  RLVGTGRSSMRIAVDVWWEPMDHNERVL--VCQAECVLVAVDEQNRPVTV 123


>gi|326778933|ref|ZP_08238198.1| thioesterase superfamily protein [Streptomyces cf. griseus
           XylebKG-1]
 gi|326659266|gb|EGE44112.1| thioesterase superfamily protein [Streptomyces cf. griseus
           XylebKG-1]
          Length = 189

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 58/108 (53%), Gaps = 1/108 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D NL G V GG IM  +D A G  A +      VT ++ E++F +P++V DLVH+  Q+
Sbjct: 38  SDTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRVGDLVHVRAQV 97

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              G++S+ +   V     N S+   Q+   A +V  AVD  G P+ +
Sbjct: 98  NWTGRSSMEVGVRVMAERWNESTPA-QQVGSAYLVFAAVDGDGKPRPV 144


>gi|239941739|ref|ZP_04693676.1| putative acyl-CoA hydrolase [Streptomyces roseosporus NRRL 15998]
          Length = 155

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 58/108 (53%), Gaps = 1/108 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D NL G V GG IM  +D A G  A +      VT ++ E++F +P++V DLVH+  Q+
Sbjct: 4   SDTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRVGDLVHVKAQV 63

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              G++S+ +   V     N S+   Q+   A +V  AVD  G P+ +
Sbjct: 64  NWTGRSSMEVGVRVMAERWNESTPA-QQVGSAYLVFAAVDGDGKPRRV 110


>gi|297157911|gb|ADI07623.1| putative acyl-CoA hydrolase [Streptomyces bingchenggensis BCW-1]
          Length = 187

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D NL G V GG IM  +D A G  A +  +   VT ++ E+ F +P++V DLVH+  Q+
Sbjct: 35  SDTNLLGTVHGGVIMKLVDDAAGAVAGRHSEGPAVTASMDEMAFLEPVRVGDLVHVKAQV 94

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
              G++S+ I   V     N S+   Q    A +V  AVD  G P+
Sbjct: 95  NWTGRSSMEIGVRVMAERWNESTPATQ-VGSAYLVFAAVDADGKPR 139


>gi|213966232|ref|ZP_03394417.1| 4-hydroxybenzoyl-CoA thioesterase [Corynebacterium amycolatum SK46]
 gi|213951167|gb|EEB62564.1| 4-hydroxybenzoyl-CoA thioesterase [Corynebacterium amycolatum SK46]
          Length = 335

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 62/134 (46%), Gaps = 4/134 (2%)

Query: 20  EVLMVCQMHSSGV----LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRV 75
           E  M  Q +S+      LT +    PTDVN  GNV GG  M  ID A     +     + 
Sbjct: 164 EASMRAQTYSADSSAPELTTRFLAKPTDVNWGGNVHGGTAMEWIDEAATAVTTNWAGRQT 223

Query: 76  VTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATV 135
           ++     + F  PI + DLV +  +I + G TS+ +   V+ C        L+K   +T+
Sbjct: 224 ISVYAGGIRFYNPIHIGDLVEVRARILRTGTTSMHLSVQVYCCEPRKGVGGLRKALHSTM 283

Query: 136 VMVAVDEKGNPKSI 149
             VA+D+  NP+ +
Sbjct: 284 TYVAIDDDFNPQPV 297



 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (47%), Gaps = 8/124 (6%)

Query: 26  QMHS--SGVLTLKIQTMPTDVNLDG--NVFGGWIMSQIDIACGIRASQLCKCRVVTKAVT 81
           Q+H+  S  L L+    PTDV + G  +V GG ++  ID A    A+       VT    
Sbjct: 11  QVHAPASPSLVLRFMASPTDVIMAGTNSVHGGRVLQWIDKAAYACATGWSGRYCVTAYFG 70

Query: 82  ELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAV 140
            + F +PI    +V + ++I   G++S+ I  +V +  PR        +  +  V+ VA+
Sbjct: 71  HIHFTRPIPSGHIVEVRSKIAHTGRSSMHIVNEVLSADPREGK---FTRAADCLVIFVAM 127

Query: 141 DEKG 144
           DE G
Sbjct: 128 DENG 131


>gi|150026467|ref|YP_001297293.1| acyl-CoA hydrolase family protein [Flavobacterium psychrophilum
           JIP02/86]
 gi|149773008|emb|CAL44492.1| Acyl-CoA hydrolase family protein [Flavobacterium psychrophilum
           JIP02/86]
          Length = 169

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 63/124 (50%), Gaps = 2/124 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  +  S  +  L    +P + N   N+FGG +++++D A  I A +  +   VT +V  
Sbjct: 1   MQVKYPSESLTILTDMVLPGETNPLNNLFGGELLARMDRAASISARRHSRRITVTASVNH 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + F K I +  +V +  ++ +  +TS+ I+ DVW   R + +    K  EA    VAVDE
Sbjct: 61  VAFNKAIPLGSVVTVEAKVSRSFRTSMEIFIDVWVEDRESGNK--SKANEAIYTFVAVDE 118

Query: 143 KGNP 146
            G+P
Sbjct: 119 TGHP 122


>gi|15805310|ref|NP_294002.1| hypothetical protein DR_0279 [Deinococcus radiodurans R1]
 gi|6457951|gb|AAF09861.1|AE001889_7 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 222

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  G  FGGW+++ +D A  + A +     VVT  +  + F  PI+V D V +  
Sbjct: 96  FPKDTNYHGTAFGGWVLALMDKAASVAAVRHAGGNVVTARMDGVDFHVPIRVGDAVALDA 155

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ ++G++S+TI  DV+    N +S   Q         VA+ E G P+ +
Sbjct: 156 RVIRVGRSSMTIRVDVYR--ENMASGEQQLATGGLFTFVALGEDGKPRPV 203


>gi|302560298|ref|ZP_07312640.1| acyl-CoA hydrolase [Streptomyces griseoflavus Tu4000]
 gi|302477916|gb|EFL41009.1| acyl-CoA hydrolase [Streptomyces griseoflavus Tu4000]
          Length = 185

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +D A G  A +      VT ++ E+ F +P++V DLVH+  Q+ 
Sbjct: 35  DTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMAFLEPVRVGDLVHVKAQVN 94

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G+TS+ +   V     N S+   Q    A +V  AVD  G P+ +
Sbjct: 95  WTGRTSMEVGVRVLAERWNESAPATQ-VGSAYLVFAAVDADGKPRRV 140


>gi|260773945|ref|ZP_05882860.1| acyl-CoA hydrolase [Vibrio metschnikovii CIP 69.14]
 gi|260610906|gb|EEX36110.1| acyl-CoA hydrolase [Vibrio metschnikovii CIP 69.14]
          Length = 164

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACAAGWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   GKTS+ +  DV      A ++ L   C   V+MVAVDE+G P  +
Sbjct: 68  NLVEVNAKVIYTGKTSMHVAIDVQASEPTALNNRLTTHC--IVIMVAVDEQGKPTPV 122


>gi|239988200|ref|ZP_04708864.1| putative acyl-CoA hydrolase [Streptomyces roseosporus NRRL 11379]
          Length = 189

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 58/108 (53%), Gaps = 1/108 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D NL G V GG IM  +D A G  A +      VT ++ E++F +P++V DLVH+  Q+
Sbjct: 38  SDTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRVGDLVHVKAQV 97

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              G++S+ +   V     N S+   Q+   A +V  AVD  G P+ +
Sbjct: 98  NWTGRSSMEVGVRVMAERWNESTPA-QQVGSAYLVFAAVDGDGKPRRV 144


>gi|168701443|ref|ZP_02733720.1| Putative acyl-CoA thioester hydrolase [Gemmata obscuriglobus UQM
           2246]
          Length = 137

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 62/116 (53%), Gaps = 11/116 (9%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCR-------VVTKAVTELLF 85
           + +++  MP D N  G +FGG ++S ID+A  I A +  + R        VT A+  + F
Sbjct: 9   IAIQVPMMPKDTNRHGTIFGGVLLSYIDLAGAITAQRELQLRGGNPKASFVTVAINRVEF 68

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVD 141
           +KP+ V D+V   T + K G+TS+T++ +V+       +D +  T  A  V V VD
Sbjct: 69  KKPVLVGDVVRFETNVVKTGRTSMTVHVEVFA---ERGADTVHVTS-AEGVFVGVD 120


>gi|291445182|ref|ZP_06584572.1| acyl-CoA hydrolase [Streptomyces roseosporus NRRL 15998]
 gi|291348129|gb|EFE75033.1| acyl-CoA hydrolase [Streptomyces roseosporus NRRL 15998]
          Length = 203

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 58/108 (53%), Gaps = 1/108 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D NL G V GG IM  +D A G  A +      VT ++ E++F +P++V DLVH+  Q+
Sbjct: 52  SDTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRVGDLVHVKAQV 111

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              G++S+ +   V     N S+   Q+   A +V  AVD  G P+ +
Sbjct: 112 NWTGRSSMEVGVRVMAERWNESTPA-QQVGSAYLVFAAVDGDGKPRRV 158


>gi|224824496|ref|ZP_03697603.1| thioesterase superfamily protein [Lutiella nitroferrum 2002]
 gi|224602989|gb|EEG09165.1| thioesterase superfamily protein [Lutiella nitroferrum 2002]
          Length = 162

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 63/121 (52%), Gaps = 11/121 (9%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +  MP   N  GNV GG ++  +D      AS+   C VVT +V ++LF++PI V 
Sbjct: 13  LVMSVLMMPDMANFSGNVHGGVLLKLLDQVAYACASRYAGCYVVTLSVDQVLFKQPIHVG 72

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEAT----VVMVAVDEKGNPKS 148
           +LV  Y  +  +G+TS+ +   V       + D+ Q+T   T      MVA+ E+G P +
Sbjct: 73  ELVTFYASVNHVGRTSMEVGIKV------VAEDIQQRTVRHTNSCYFTMVAM-EQGKPAA 125

Query: 149 I 149
           +
Sbjct: 126 V 126


>gi|256787322|ref|ZP_05525753.1| acyl-CoA hydrolase [Streptomyces lividans TK24]
          Length = 188

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 57/108 (52%), Gaps = 1/108 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D NL G V GG IM  +D A G  A +      VT ++ E+ F +P++V DLVH+  Q+
Sbjct: 37  SDTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMAFLEPVRVGDLVHVKAQV 96

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              G++S+ +   V     N S+   Q    A +V  AVD  G P+++
Sbjct: 97  NWTGRSSMEVGVRVLAERWNESTPATQ-VGSAYLVFAAVDADGKPRTV 143


>gi|297200142|ref|ZP_06917539.1| acyl-CoA hydrolase [Streptomyces sviceus ATCC 29083]
 gi|197713408|gb|EDY57442.1| acyl-CoA hydrolase [Streptomyces sviceus ATCC 29083]
          Length = 187

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +D A G  A +      VT ++ E+ F +P++V DLVH+  Q+ 
Sbjct: 37  DTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMAFLEPVRVGDLVHVKAQVN 96

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G+TS+ +   V     N S+   Q    A +V  AVD  G P+ +
Sbjct: 97  WTGRTSMEVGVRVLAERWNESTPATQ-VGSAYLVFAAVDADGKPRRV 142


>gi|325283847|ref|YP_004256388.1| thioesterase superfamily protein [Deinococcus proteolyticus MRP]
 gi|324315656|gb|ADY26771.1| thioesterase superfamily protein [Deinococcus proteolyticus MRP]
          Length = 154

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  G  FGG+++S +D A  + A +     VVT  +  + F  P++V D V +  
Sbjct: 28  FPKDTNYHGTAFGGFLLSLMDKAASVAAVRHAGGAVVTARMDGVDFRMPLRVGDAVALDA 87

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ K+G++S+TI  DV+    + +S   +     T V VAV E G P+ +
Sbjct: 88  RVVKVGRSSMTIQVDVYR--EHMASGEQELATTGTFVFVAVYENGKPRPV 135


>gi|312891698|ref|ZP_07751207.1| thioesterase superfamily protein [Mucilaginibacter paludis DSM
           18603]
 gi|311295781|gb|EFQ72941.1| thioesterase superfamily protein [Mucilaginibacter paludis DSM
           18603]
          Length = 173

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 2/106 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N   N+ GG ++  +DIA  I A + C   VVT +V  + F+ P+++ D++ I +
Sbjct: 18  LPNDTNTLNNLMGGRLLHWMDIAAAIAAQKHCNRIVVTASVDTVSFKHPVKLGDVISIES 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           ++ +   TSV +  DVW   +N  S    K+ EA    VA+DE  +
Sbjct: 78  KVTRAFNTSVEVRLDVWA--QNIPSGTRIKSNEAYYTFVALDEDSH 121


>gi|21221491|ref|NP_627270.1| acyl-CoA hydrolase [Streptomyces coelicolor A3(2)]
 gi|289771217|ref|ZP_06530595.1| acyl-CoA hydrolase [Streptomyces lividans TK24]
 gi|14970935|emb|CAC44514.1| putative acyl-CoA hydrolase [Streptomyces coelicolor A3(2)]
 gi|289701416|gb|EFD68845.1| acyl-CoA hydrolase [Streptomyces lividans TK24]
          Length = 197

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 57/108 (52%), Gaps = 1/108 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D NL G V GG IM  +D A G  A +      VT ++ E+ F +P++V DLVH+  Q+
Sbjct: 46  SDTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMAFLEPVRVGDLVHVKAQV 105

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              G++S+ +   V     N S+   Q    A +V  AVD  G P+++
Sbjct: 106 NWTGRSSMEVGVRVLAERWNESTPATQ-VGSAYLVFAAVDADGKPRTV 152


>gi|328882836|emb|CCA56075.1| putative acyl-CoA hydrolase [Streptomyces venezuelae ATCC 10712]
          Length = 177

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +D A G  A +      VT ++ E+ F +P++V DL+H+  Q+ 
Sbjct: 27  DTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMAFLEPVRVGDLLHVKAQVN 86

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G++S+ +   V     N S+   Q    A +V  AVD  G P+S+
Sbjct: 87  WTGRSSMEVGVRVMAERWNESTPATQ-VGSAYLVFAAVDADGKPRSV 132


>gi|328950375|ref|YP_004367710.1| thioesterase superfamily protein [Marinithermus hydrothermalis DSM
           14884]
 gi|328450699|gb|AEB11600.1| thioesterase superfamily protein [Marinithermus hydrothermalis DSM
           14884]
          Length = 134

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  G +FGG  M+ +D A  I A++  + +VVT   + + F+ P+    +V +  
Sbjct: 18  FPGDTNHYGTLFGGQAMAWMDQAAFITATRWARRKVVTVHSSAIDFKHPVPQGSIVELVA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            I++ G+TS+T+  ++W  P     D  +       V+VA+DE+G P  +
Sbjct: 78  WIQRTGRTSMTVEVEMWVEP--MQKDERRLASRGAFVLVALDEEGRPTPV 125


>gi|269102972|ref|ZP_06155669.1| putative acyl-CoA hydrolase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268162870|gb|EEZ41366.1| putative acyl-CoA hydrolase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 98

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 60/97 (61%), Gaps = 3/97 (3%)

Query: 56  MSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDV 115
           MSQ+D+A  I A ++   RVVT +V  + F+ P+ V D+V  Y + ++IG TS+++  +V
Sbjct: 1   MSQLDLAGAILAKEISGGRVVTVSVESIEFKAPVGVGDVVCCYGECKRIGNTSMSVALEV 60

Query: 116 WTCPRNASSDVLQ--KTCEATVVMVAVDEKGNPKSIR 150
           W  P  A  +V +  + C+AT   VA++ +G P+ I+
Sbjct: 61  WVKP-VAQEEVGERYRVCQATFNYVAINSEGRPRPIK 96


>gi|302551872|ref|ZP_07304214.1| acyl-CoA hydrolase [Streptomyces viridochromogenes DSM 40736]
 gi|302469490|gb|EFL32583.1| acyl-CoA hydrolase [Streptomyces viridochromogenes DSM 40736]
          Length = 185

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +D A G  A +      VT ++ E+ F +P++V DLVH+  Q+ 
Sbjct: 35  DTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMAFLEPVRVGDLVHVKAQVN 94

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G+TS+ +   V     N S+   Q    A +V  AVD  G P+ +
Sbjct: 95  WTGRTSMEVGVRVLAERWNESAPPTQ-VGSAYLVFAAVDADGKPRRV 140


>gi|146298748|ref|YP_001193339.1| thioesterase superfamily protein [Flavobacterium johnsoniae UW101]
 gi|146153166|gb|ABQ04020.1| thioesterase superfamily protein [Flavobacterium johnsoniae UW101]
          Length = 169

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 28  HSSGVLT-LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           H S  LT L    +P++ N   N+FGG +++++D A  I A +  +  VVT +V  + F 
Sbjct: 5   HPSESLTILTDLVLPSETNPLNNLFGGELLARMDRAASIAARRHSRRIVVTASVNHVAFN 64

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           + I +  +V +  ++ +  K+S+ ++ DVW   R + +    K  EA    VAVD+ G P
Sbjct: 65  RAISLGSVVTVEAKVSRSFKSSMEVFIDVWVEDRESGNRT--KANEAIYTFVAVDDTGRP 122


>gi|302534821|ref|ZP_07287163.1| acyl-CoA hydrolase [Streptomyces sp. C]
 gi|302443716|gb|EFL15532.1| acyl-CoA hydrolase [Streptomyces sp. C]
          Length = 178

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +D A G  A +      VT ++ E+ F  P++V DLVH+  Q+ 
Sbjct: 28  DTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMAFLAPVRVGDLVHVRAQVN 87

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G+TS+ +   V     N S    Q    A +V  AVD  G P+ +
Sbjct: 88  WTGRTSMEVGVRVLAERWNESGPATQ-VGSAYLVFTAVDSDGKPRRV 133


>gi|294629722|ref|ZP_06708282.1| acyl-CoA hydrolase [Streptomyces sp. e14]
 gi|292833055|gb|EFF91404.1| acyl-CoA hydrolase [Streptomyces sp. e14]
          Length = 194

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +D A G  A +      VT ++ E++F +P++V DLVH+  Q+ 
Sbjct: 44  DTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRVGDLVHVKAQVN 103

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
             G+TS+ +   V     N S+   Q    A +V  AVD  G P+
Sbjct: 104 WTGRTSMEVGVRVLAERWNESTPPTQ-VGSAYLVFAAVDADGRPR 147


>gi|161525384|ref|YP_001580396.1| thioesterase superfamily protein [Burkholderia multivorans ATCC
           17616]
 gi|189349879|ref|YP_001945507.1| acyl-CoA hydrolase [Burkholderia multivorans ATCC 17616]
 gi|221201305|ref|ZP_03574345.1| thioesterase family protein [Burkholderia multivorans CGD2M]
 gi|221206241|ref|ZP_03579254.1| thioesterase family protein [Burkholderia multivorans CGD2]
 gi|221213520|ref|ZP_03586494.1| thioesterase family protein [Burkholderia multivorans CGD1]
 gi|160342813|gb|ABX15899.1| thioesterase superfamily protein [Burkholderia multivorans ATCC
           17616]
 gi|189333901|dbj|BAG42971.1| acyl-CoA hydrolase [Burkholderia multivorans ATCC 17616]
 gi|221166309|gb|EED98781.1| thioesterase family protein [Burkholderia multivorans CGD1]
 gi|221173550|gb|EEE05984.1| thioesterase family protein [Burkholderia multivorans CGD2]
 gi|221179155|gb|EEE11562.1| thioesterase family protein [Burkholderia multivorans CGD2M]
          Length = 170

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 64/121 (52%), Gaps = 10/121 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    P+ VN  G V GG +M  ID    AC  + +S+ C    VT +V  + F++PI 
Sbjct: 18  FRFLAEPSSVNFGGKVHGGALMKWIDEVAYACAAVWSSRYC----VTVSVGNIRFQRPIL 73

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GNP  + 
Sbjct: 74  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGNPLPVP 131

Query: 151 T 151
           T
Sbjct: 132 T 132


>gi|327438236|dbj|BAK14601.1| acyl-CoA hydrolase [Solibacillus silvestris StLB046]
          Length = 162

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 61/120 (50%), Gaps = 5/120 (4%)

Query: 33  LTLKIQT---MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
            +  IQT   +P D N   ++FGG +++ ID    I A + C+  VVT +   + F    
Sbjct: 9   FSKSIQTRLVLPPDTNHHQSIFGGKVLAYIDEIAAIAAMKHCQGEVVTASFDSVDFVSSA 68

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              D++ +   +   G+TS+ +Y  V +  RN  +   + T E+ V MVA+DE G PK +
Sbjct: 69  YAGDMIELEAVVSGTGRTSMEVYVRVVS--RNIKTGAKKLTTESFVTMVAIDENGKPKEV 126


>gi|269836124|ref|YP_003318352.1| thioesterase superfamily protein [Sphaerobacter thermophilus DSM
           20745]
 gi|269785387|gb|ACZ37530.1| thioesterase superfamily protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 163

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 60/108 (55%), Gaps = 2/108 (1%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           TD N  GNV GG IM  +D A GI A++  + RVVT  +  + F  P+ V DLV ++ ++
Sbjct: 32  TDANPAGNVHGGTIMKLVDTAGGIAAARHAQRRVVTVMMDSMTFLHPVYVGDLVMLHARL 91

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              G+TS+ +   V     +  +  + +T  A +V VA+D++G P  +
Sbjct: 92  TWTGRTSMEVEVVVEAE--HVPTGRITRTSTAYLVYVALDDEGRPTPV 137


>gi|332291880|ref|YP_004430489.1| thioesterase superfamily protein [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169966|gb|AEE19221.1| thioesterase superfamily protein [Krokinobacter diaphorus 4H-3-7-5]
          Length = 169

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 62/113 (54%), Gaps = 2/113 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           TL    +P++ N  GN+FGG +++++D A  I A +  +  VVT +V  + F + + +  
Sbjct: 12  TLTDLVLPSETNPLGNLFGGELLARMDRAASIAARRHSRRIVVTASVNHVAFNRMVPLGS 71

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +V +  +I +  +TS+ I  DVW   R   S +  +  EA    VAVDE+G P
Sbjct: 72  VVTVEAKISRAFRTSMEIVIDVWIEDRE--SGLKSQANEAIYTFVAVDEQGIP 122


>gi|325519650|gb|EGC98988.1| acyl-CoA hydrolase [Burkholderia sp. TJI49]
          Length = 170

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 64/121 (52%), Gaps = 10/121 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    P+ VN  G V GG +M  ID    AC  + +S+ C    VT +V  + F++PI 
Sbjct: 18  FRFLAEPSSVNFGGKVHGGALMKWIDEVAYACAAVWSSRYC----VTVSVGNIRFQRPIL 73

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GNP  + 
Sbjct: 74  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGNPLPVP 131

Query: 151 T 151
           T
Sbjct: 132 T 132


>gi|325286332|ref|YP_004262122.1| thioesterase superfamily protein [Cellulophaga lytica DSM 7489]
 gi|324321786|gb|ADY29251.1| thioesterase superfamily protein [Cellulophaga lytica DSM 7489]
          Length = 169

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P++ N   N+FGG +++++D A  I A +  +  VVT +V  + F + + V  +V +  
Sbjct: 16  LPSETNPLNNLFGGELLARMDRAASIAARRHSRRIVVTASVNHVAFNRSVPVGSVVTVEA 75

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            + +  KTS+ I+ DVW   R +      K  EA    VAVD+ G P  +
Sbjct: 76  AVSRAFKTSMEIFIDVWIEDRFSGEKT--KANEAIYTFVAVDDTGKPTEV 123


>gi|167586583|ref|ZP_02378971.1| thioesterase superfamily protein [Burkholderia ubonensis Bu]
          Length = 170

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 62/116 (53%), Gaps = 10/116 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    P+ VN  G V GG +M  ID    AC  + +S+ C    VT +V  + F++PI 
Sbjct: 18  FRFLAEPSSVNFGGKVHGGALMKWIDEVAYACAAVWSSRYC----VTVSVGNIRFQRPIM 73

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GNP
Sbjct: 74  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGNP 127


>gi|262368820|ref|ZP_06062149.1| thioesterase superfamily protein [Acinetobacter johnsonii SH046]
 gi|262316498|gb|EEY97536.1| thioesterase superfamily protein [Acinetobacter johnsonii SH046]
          Length = 173

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V 
Sbjct: 17  LTMSVLMTPDMANFSGNVHGGTILKLLDQVAYACASRFSGSYVVTLSVDKVNFKEPIHVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +  +G+TS+ I   V    +N     ++ T      MVAVDE G PK I
Sbjct: 77  ELVTFLASVNHVGRTSMEIGIRVEA--QNIQKRTVRHTNSCYFTMVAVDENGKPKQI 131


>gi|119775112|ref|YP_927852.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Shewanella amazonensis SB2B]
 gi|119767612|gb|ABM00183.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Shewanella amazonensis SB2B]
          Length = 159

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LTL+    P DVN  G V GG +M  ID+A    A+       +T     + F KPI V 
Sbjct: 8   LTLRFLAEPADVNFGGKVHGGAVMKWIDLAAYACAAGWSGKYCITAYAGGIRFVKPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++V +  ++   G +S+ I  DV       S   L   C   V+MVAVD+ GNP  +
Sbjct: 68  NIVEVSAKVIYTGNSSMHIGIDVRAGDPKVSERQLTTHC--IVIMVAVDDAGNPTPV 122


>gi|239996389|ref|ZP_04716913.1| acyl-CoA thioester hydrolase protein [Alteromonas macleodii ATCC
           27126]
          Length = 158

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 57/113 (50%), Gaps = 2/113 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           T +    PTDVN  GNV GG +M  ID A    A+Q  KC  VT +   + F KPI+V  
Sbjct: 7   TFRFLAEPTDVNFGGNVHGGIVMKWIDQAAYACAAQWSKCYCVTVSANGIRFIKPIKVGQ 66

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           LV I   +   G +S+ IY  V +     ++  +   C   +  +AVD +G+P
Sbjct: 67  LVEITASLVHTGASSMHIYVVVKSGDATENTKSVANRC--FITFMAVDCEGSP 117


>gi|149369264|ref|ZP_01889116.1| possible acyl-CoA thioester hydrolase [unidentified eubacterium
           SCB49]
 gi|149356691|gb|EDM45246.1| possible acyl-CoA thioester hydrolase [unidentified eubacterium
           SCB49]
          Length = 169

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 2/106 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P++ N  GN+FGG +++++D A  I A +  +  VVT +V  + F K I +  +V +  
Sbjct: 18  LPSETNPIGNLFGGELLARMDRAASIAARRHSRRIVVTASVNHVAFNKMIPLGSVVTVEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
            + +   +S+ +Y DVW   R   S V  K  E     VAVDE G+
Sbjct: 78  NVSRAFTSSMEVYMDVWIEDRE--SGVKSKANEGIYTFVAVDEMGS 121


>gi|239627585|ref|ZP_04670616.1| thioesterase superfamily protein [Clostridiales bacterium
           1_7_47_FAA]
 gi|239517731|gb|EEQ57597.1| thioesterase superfamily protein [Clostridiales bacterium
           1_7_47FAA]
          Length = 134

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 56/118 (47%), Gaps = 5/118 (4%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP+  N  G +FGG +M  +D   GI A +     V T AV  + F +PI V   + +  
Sbjct: 13  MPSMTNFRGVLFGGMLMEWMDEVAGIAAKRFAGPEVTTAAVEGMKFLRPIPVGAFIEVAG 72

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQK-----TCEATVVMVAVDEKGNPKSIRTE 152
            +  +G TS+ +  DV    ++      +K       EA  V VA+DE G P++I  E
Sbjct: 73  AVTAVGNTSLRVKIDVSMDSQHRGVRGDEKVDKVLVAEALFVYVALDEMGKPRTIEKE 130


>gi|126662791|ref|ZP_01733790.1| possible acyl-CoA thioester hydrolase [Flavobacteria bacterium
           BAL38]
 gi|126626170|gb|EAZ96859.1| possible acyl-CoA thioester hydrolase [Flavobacteria bacterium
           BAL38]
          Length = 185

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (50%), Gaps = 2/122 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  +  S  V TL    +P + N   N+FGG +++++D A  I A +  +   VT +V  
Sbjct: 16  MQPKFPSESVTTLTDLVLPGETNPLNNLFGGELLARMDRAASITARRHSRRICVTASVNH 75

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + F + I +  +V + +++ +   +S+ IY DVW   R   S +  K  EA    VAVDE
Sbjct: 76  VAFNRAIPLGSVVTVESKVSRTFNSSMEIYIDVWIEDR--ESGIKNKANEAIYTFVAVDE 133

Query: 143 KG 144
            G
Sbjct: 134 TG 135


>gi|295131959|ref|YP_003582635.1| acyl-CoA thioester hydrolase [Zunongwangia profunda SM-A87]
 gi|294979974|gb|ADF50439.1| acyl-CoA thioester hydrolase [Zunongwangia profunda SM-A87]
          Length = 170

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 2/111 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           TL    +P++ N   N+FGG +++++D A  I A +  +  VVT +V  + F K I +  
Sbjct: 12  TLTDLVLPSETNPLNNLFGGELLARMDRAASIAARRHSRRIVVTASVNHVAFNKAIPLGS 71

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           +V +   + +  K+S+ I+ DVW   R   S +  K  EA    VAVDE G
Sbjct: 72  VVTVEAVVSRAFKSSMEIFIDVWVEDR--ESGLRSKANEAIYTFVAVDETG 120


>gi|77920109|ref|YP_357924.1| putative acyl-CoA hydrolase [Pelobacter carbinolicus DSM 2380]
 gi|77546192|gb|ABA89754.1| putative acyl-CoA hydrolase [Pelobacter carbinolicus DSM 2380]
          Length = 158

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  GNV GG IM  ID A G+ A +  +  VVT ++  L F  P+ V +L+ +  
Sbjct: 20  MPGDANPAGNVHGGTIMKLIDNAAGVVAMRHTRRNVVTASIDRLDFHYPVFVGNLIILKA 79

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            + ++GKTS+ +   V     N  +  ++ T  A +  VA+D  G P ++
Sbjct: 80  CLNRVGKTSMEVGVRVEA--ENVMTGEIRHTASAYLTFVALDADGYPTNV 127


>gi|313207060|ref|YP_004046237.1| thioesterase superfamily protein [Riemerella anatipestifer DSM
           15868]
 gi|312446376|gb|ADQ82731.1| thioesterase superfamily protein [Riemerella anatipestifer DSM
           15868]
 gi|315022546|gb|EFT35573.1| acyl-CoA thioester hydrolase [Riemerella anatipestifer RA-YM]
 gi|325335503|gb|ADZ11777.1| Acyl-CoA hydrolase [Riemerella anatipestifer RA-GD]
          Length = 169

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 57/113 (50%), Gaps = 8/113 (7%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P + N  GN+FGG ++S++D    I AS+ C  RVVT +V  + F  PI    +V + +
Sbjct: 18  LPNETNHLGNLFGGELLSKMDRCASISASRHCGRRVVTASVNHVSFNHPIPEGGVVVLES 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQK---TCEATVVMVAVDEKGNPKSI 149
           ++ +   TS+ +Y DVW         + QK   T E     VAVD    P  I
Sbjct: 78  KVTRAFSTSMEVYVDVWM-----DDPITQKKVHTNEGIYTFVAVDAFNKPVPI 125


>gi|86131169|ref|ZP_01049768.1| acyl-CoA thioester hydrolase [Dokdonia donghaensis MED134]
 gi|85818580|gb|EAQ39740.1| acyl-CoA thioester hydrolase [Dokdonia donghaensis MED134]
          Length = 169

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 59/105 (56%), Gaps = 2/105 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P++ N  GN+FGG +++++D A  I A +  +  VVT +V  + F + I +  +V +  
Sbjct: 18  LPSETNPLGNLFGGELLARMDRAASIAARRHSRRIVVTASVNHVAFNRMIALGSVVTVEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           +I +  KTS+ +  DVW   R   S +  +  EA    VAVDE+G
Sbjct: 78  KISRAFKTSMEVIIDVWIEDRE--SGLKTQANEAIYTFVAVDEQG 120


>gi|294141311|ref|YP_003557289.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Shewanella violacea DSS12]
 gi|293327780|dbj|BAJ02511.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Shewanella violacea DSS12]
          Length = 159

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 59/118 (50%), Gaps = 4/118 (3%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F KPIQV 
Sbjct: 8   ITLRFLAEPADVNFGGKVHGGAVMKWIDLAAYACAAGWSGKYCITAYAGGIRFVKPIQVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++V    ++   G++S+ +  DV    P+N    +   T    V+MVAVD+ GNP  +
Sbjct: 68  NIVETSAKVIYTGRSSMHLGIDVRAGDPKNPERHL---TTHCIVIMVAVDDSGNPTEV 122


>gi|328951490|ref|YP_004368825.1| thioesterase superfamily protein [Marinithermus hydrothermalis DSM
           14884]
 gi|328451814|gb|AEB12715.1| thioesterase superfamily protein [Marinithermus hydrothermalis DSM
           14884]
          Length = 127

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 54/110 (49%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  G  FGG+++  +D      A++  +  VVT AV  + F+ PI+  DL+ I  
Sbjct: 11  FPEHTNPLGAAFGGFVLGLMDKVGSYAAARHAENPVVTVAVGRVEFKVPIRSGDLLEIVA 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ ++G+TS+T+  DV+                  +V VAVDE G P  +
Sbjct: 71  RVTRVGRTSITVAVDVYKERFGGGERTRTLATTGELVYVAVDENGRPTPV 120


>gi|55978390|ref|YP_145446.1| hypothetical protein TTHB207 [Thermus thermophilus HB8]
 gi|55773563|dbj|BAD72003.1| conserved hypothetical protein [Thermus thermophilus HB8]
          Length = 133

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 60/110 (54%), Gaps = 1/110 (0%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P + N  G +FGG +++ +D A  + A++  + +VVT     + F++P+ +  +V +  
Sbjct: 11  FPGETNHYGTLFGGTVLAWMDQAAFVAATRHARKKVVTVHADAVDFKRPVPLGAIVELVA 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +++++G+TS+ +  ++W  P     +          V+VAVDE+G P  +
Sbjct: 71  RLKEVGRTSMRVEVEMWVEPVKEGEEAYL-AARGGFVLVAVDERGRPSPV 119


>gi|297622359|ref|YP_003703793.1| thioesterase superfamily protein [Truepera radiovictrix DSM 17093]
 gi|297163539|gb|ADI13250.1| thioesterase superfamily protein [Truepera radiovictrix DSM 17093]
          Length = 183

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P+D N    +FGG  M+ +D A  I A++ C+ RVVT   ++L F +P+    +V +  
Sbjct: 67  FPSDTNHYHTLFGGQAMAWMDQAAFICATRYCRRRVVTVHSSDLSFRRPVPEGSIVELVA 126

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           Q+ + G+TS+ +  ++W  P       L   C     +VA+ + G P
Sbjct: 127 QVARTGRTSLEVAVEMWIEPMEREGREL--ACRGAFTLVALGDDGKP 171


>gi|255657680|ref|ZP_05403089.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Mitsuokella multacida DSM 20544]
 gi|260849867|gb|EEX69874.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Mitsuokella multacida DSM 20544]
          Length = 173

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 54/112 (48%), Gaps = 5/112 (4%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP   N  GN++GG IM  +D A      +  +C VVT  V EL F  PI V DLV    
Sbjct: 13  MPNQTNPSGNIYGGDIMKMMDSAAYAVTRKYARCNVVTARVDELEFHLPILVGDLVTCTA 72

Query: 100 QIRKIGKTS--VTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +I  +G +S  VT+  DV    +       Q+   A   MVA+D    PK++
Sbjct: 73  EIVFVGHSSMEVTVNVDVEDLDQEGKP---QRALTAYFTMVALDRNSRPKAV 121


>gi|24374310|ref|NP_718353.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Shewanella oneidensis MR-1]
 gi|24348854|gb|AAN55797.1|AE015716_7 cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Shewanella oneidensis MR-1]
          Length = 159

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+  + P DVN  G V GG +M  ID+A    A+       +T     + F +PI V 
Sbjct: 8   ITLRFLSEPADVNFGGKVHGGAVMKWIDLAAYACAAGWSGKYCITAYAGGIRFVQPILVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++V +  ++   GKTS+ I  DV       S   L   C   V+MVAVDE+G P  +
Sbjct: 68  NIVEVSAKVIYTGKTSMHIGIDVRAGDPKVSERHLTTHC--IVIMVAVDEQGQPTPV 122


>gi|262376704|ref|ZP_06069932.1| thioesterase superfamily protein [Acinetobacter lwoffii SH145]
 gi|262308414|gb|EEY89549.1| thioesterase superfamily protein [Acinetobacter lwoffii SH145]
          Length = 173

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V 
Sbjct: 17  LTMSVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYSGSYVVTLSVDKVNFKEPIHVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +  +G+TS+ I   V    +N     ++ T      MVAVDE G PK I
Sbjct: 77  ELVTFLASVNHVGRTSMEIGIRVEA--QNIQKRTVRHTNSCYFTMVAVDENGKPKQI 131


>gi|309811857|ref|ZP_07705630.1| thioesterase family protein [Dermacoccus sp. Ellin185]
 gi|308434146|gb|EFP58005.1| thioesterase family protein [Dermacoccus sp. Ellin185]
          Length = 168

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 1/107 (0%)

Query: 45  NLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKI 104
           NL G V GG IM  +D A G  +++  +   VT A+ E+LF  P++V D++ + TQ+   
Sbjct: 21  NLLGTVHGGNIMKFVDDAAGAVSARFAQGPAVTAAMDEMLFLAPVRVGDVLTVKTQVNWA 80

Query: 105 GKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           G++S+ +   V T   +  +  +     A +VMV VDE G P+ + T
Sbjct: 81  GRSSMEVGARVETTRWDDRTPPVH-VATAFLVMVGVDESGRPRQVPT 126


>gi|320101625|ref|YP_004177216.1| thioesterase superfamily protein [Isosphaera pallida ATCC 43644]
 gi|319748907|gb|ADV60667.1| thioesterase superfamily protein [Isosphaera pallida ATCC 43644]
          Length = 125

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 6/108 (5%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIY 98
           +P D+N    +FGG ++  ID  CGI A  ++   RVVTK ++++ F+ P    D++ I 
Sbjct: 10  LPKDLNSSQKLFGGRLLEWIDEECGIHAMLEMKTPRVVTKVISQIDFKAPAVRGDVIEIG 69

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
               + G+TS+T+  +V+    N +S V   T +   VMV+VDE G P
Sbjct: 70  IDTIRYGRTSITLRIEVF----NRTSGVTMLTIDQ-FVMVSVDEHGQP 112


>gi|113970727|ref|YP_734520.1| thioesterase superfamily protein [Shewanella sp. MR-4]
 gi|114047954|ref|YP_738504.1| thioesterase superfamily protein [Shewanella sp. MR-7]
 gi|113885411|gb|ABI39463.1| thioesterase superfamily protein [Shewanella sp. MR-4]
 gi|113889396|gb|ABI43447.1| thioesterase superfamily protein [Shewanella sp. MR-7]
          Length = 159

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 57/117 (48%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+  + P DVN  G V GG +M  ID+A    A+       +T     + F +PI V 
Sbjct: 8   ITLRFLSEPADVNFGGKVHGGAVMKWIDLAAYACAAGWSGKYCITAYAGGIRFVQPILVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++V +  ++   GKTS+ I  DV       S   L   C   V+MVAVDE G P  +
Sbjct: 68  NIVEVSAKVIYTGKTSMHIGIDVRAGDPKVSERHLTTHC--IVIMVAVDENGQPTPV 122


>gi|319791059|ref|YP_004152699.1| thioesterase [Variovorax paradoxus EPS]
 gi|315593522|gb|ADU34588.1| thioesterase superfamily protein [Variovorax paradoxus EPS]
          Length = 149

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P  VN  G V GG +M  ID A    A+   K   VT  +  + F +PI + 
Sbjct: 4   ITLRFLAEPNTVNFGGKVHGGTVMKWIDEAGYACATSWAKRYCVTAFIGSIRFHRPIMIG 63

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           DLV +  ++   G TS+ I  +V +   +    +++KT E  +V V+VD  G P
Sbjct: 64  DLVEVEARLAYTGTTSMNISVEVRSG--DMKGGMMEKTTECLIVFVSVDSHGRP 115


>gi|297567586|ref|YP_003686557.1| hypothetical protein Mesil_3231 [Meiothermus silvanus DSM 9946]
 gi|297567765|ref|YP_003686736.1| major facilitator transporter [Meiothermus silvanus DSM 9946]
 gi|296852035|gb|ADH65049.1| hypothetical protein Mesil_3231 [Meiothermus silvanus DSM 9946]
 gi|296852214|gb|ADH65228.1| major facilitator transporter [Meiothermus silvanus DSM 9946]
          Length = 120

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  G++FGG  M+ +D A  + A++  + +VVT     + F  P+    +V +  
Sbjct: 9   LPGDCNHYGSLFGGTAMAWMDEAAFVAATRHARAKVVTVHTDAVDFHHPVPQGSIVELLA 68

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            ++ +G +S+ +  ++W  P + +   L   C A  VMVA+D  G P  +
Sbjct: 69  WVQAVGNSSMRVEVEMWVEPMDKAERSL--ACRAGFVMVALDAHGRPTRV 116


>gi|163752567|ref|ZP_02159750.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Shewanella benthica KT99]
 gi|161327540|gb|EDP98741.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Shewanella benthica KT99]
          Length = 159

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F KPIQV 
Sbjct: 8   ITLRFLAEPADVNFGGKVHGGAVMKWIDLAAYACAAGWSGKYCITVYAGGIRFVKPIQVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++V I  ++   G++S+ +  DV       S   L   C   V+MVAVD++G P  +
Sbjct: 68  NIVEIRAKVIYTGRSSMHLGIDVRAGDPKYSERHLTTHC--IVIMVAVDDEGKPTEV 122


>gi|239930861|ref|ZP_04687814.1| acyl-CoA hydrolase [Streptomyces ghanaensis ATCC 14672]
          Length = 185

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +D A G  A +      VT ++ E+ F +P++V DLVH+  Q+ 
Sbjct: 35  DTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMAFFEPVRVGDLVHVKAQVN 94

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G+TS+ +   V     N S+        A +V  AVD  G P+ +
Sbjct: 95  WTGRTSMEVGVRVLAERWNESTPPTH-VGSAYLVFTAVDADGRPRRV 140


>gi|167623711|ref|YP_001674005.1| thioesterase superfamily protein [Shewanella halifaxensis HAW-EB4]
 gi|167353733|gb|ABZ76346.1| thioesterase superfamily protein [Shewanella halifaxensis HAW-EB4]
          Length = 163

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 57/117 (48%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LTL+    P DVN  G V GG +M  ID+A    A+       +T     + F KPI V 
Sbjct: 8   LTLRFLAEPADVNFGGKVHGGAVMKWIDLAGYGCAAGWSGKYCITAYAGGIRFVKPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++V +  +I   G+TS+ +  DV       +   L   C   +VMVAVD++G P  +
Sbjct: 68  NIVEVSAKIIYTGRTSMHLAIDVRAGDPKVAERALTTHC--VLVMVAVDDEGQPTEV 122


>gi|291439233|ref|ZP_06578623.1| acyl-CoA hydrolase [Streptomyces ghanaensis ATCC 14672]
 gi|291342128|gb|EFE69084.1| acyl-CoA hydrolase [Streptomyces ghanaensis ATCC 14672]
          Length = 200

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +D A G  A +      VT ++ E+ F +P++V DLVH+  Q+ 
Sbjct: 50  DTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMAFFEPVRVGDLVHVKAQVN 109

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G+TS+ +   V     N S+        A +V  AVD  G P+ +
Sbjct: 110 WTGRTSMEVGVRVLAERWNESTPPTH-VGSAYLVFTAVDADGRPRRV 155


>gi|315182538|gb|ADT89451.1| acyl-CoA thioester hydrolase-like protein [Vibrio furnissii NCTC
           11218]
          Length = 163

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    ++       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACSAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   GKTS+ I  DV         + L   C   V+MVAVDE G P ++
Sbjct: 68  NLVEVSAKVIYTGKTSMHIAIDVQASDPKELKNRLTTHC--IVIMVAVDESGKPTAV 122


>gi|239981849|ref|ZP_04704373.1| acyl-CoA hydrolase [Streptomyces albus J1074]
          Length = 157

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +D A G  A +  +   VT ++ E+ F  P++V DL+H+  Q+ 
Sbjct: 5   DTNLLGTVHGGVIMKLVDDAAGAVAGRHSEGPAVTASMDEMAFLMPVRVGDLLHVRAQVN 64

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G++S+ +   V    R   S   Q+   A +V  AVD  G P+ +
Sbjct: 65  WTGRSSMEVGVRV-VAERWNDSTPAQQVGTAYLVFTAVDADGKPRQV 110


>gi|126173952|ref|YP_001050101.1| thioesterase superfamily protein [Shewanella baltica OS155]
 gi|153000245|ref|YP_001365926.1| thioesterase superfamily protein [Shewanella baltica OS185]
 gi|160874878|ref|YP_001554194.1| thioesterase superfamily protein [Shewanella baltica OS195]
 gi|217973732|ref|YP_002358483.1| thioesterase superfamily protein [Shewanella baltica OS223]
 gi|125997157|gb|ABN61232.1| thioesterase superfamily protein [Shewanella baltica OS155]
 gi|151364863|gb|ABS07863.1| thioesterase superfamily protein [Shewanella baltica OS185]
 gi|160860400|gb|ABX48934.1| thioesterase superfamily protein [Shewanella baltica OS195]
 gi|217498867|gb|ACK47060.1| thioesterase superfamily protein [Shewanella baltica OS223]
 gi|315267114|gb|ADT93967.1| thioesterase superfamily protein [Shewanella baltica OS678]
          Length = 159

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 56/116 (48%), Gaps = 2/116 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           TL+  + P DVN  G V GG +M  ID+A    A+       +T     + F +PI V +
Sbjct: 9   TLRFLSEPADVNFGGKVHGGAVMKWIDLAAYACAAGWSGKYCITAYAGGIRFVQPILVGN 68

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +V +  ++   GKTS+ I  DV       S   L   C   V+MVAVDE G P  +
Sbjct: 69  IVEVSAKVIYTGKTSMHIGIDVRAGDPKVSERHLTTHC--IVIMVAVDEHGQPTPV 122


>gi|120599240|ref|YP_963814.1| thioesterase superfamily protein [Shewanella sp. W3-18-1]
 gi|146292686|ref|YP_001183110.1| thioesterase superfamily protein [Shewanella putrefaciens CN-32]
 gi|120559333|gb|ABM25260.1| thioesterase superfamily protein [Shewanella sp. W3-18-1]
 gi|145564376|gb|ABP75311.1| thioesterase superfamily protein [Shewanella putrefaciens CN-32]
 gi|319425990|gb|ADV54064.1| thioesterase superfamily protein [Shewanella putrefaciens 200]
          Length = 159

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 56/116 (48%), Gaps = 2/116 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           TL+  + P DVN  G V GG +M  ID+A    A+       +T     + F +PI V +
Sbjct: 9   TLRFLSEPADVNFGGKVHGGAVMKWIDLAAYACAAGWSGKYCITAYAGGIRFVQPILVGN 68

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +V +  ++   GKTS+ I  DV       S   L   C   V+MVAVDE G P  +
Sbjct: 69  IVEVSAKVIYTGKTSMHIGIDVRAGDPKVSERHLTTHC--IVIMVAVDENGQPTPV 122


>gi|325284668|ref|YP_004264131.1| thioesterase superfamily protein [Deinococcus proteolyticus MRP]
 gi|324316157|gb|ADY27271.1| thioesterase superfamily protein [Deinococcus proteolyticus MRP]
          Length = 136

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  G +FGG ++S +D A  I A++ C+ +VVT+ +    F +PI    +V +  
Sbjct: 23  FPGTTNHHGTLFGGEVLSMMDSAAFIAATRHCRMKVVTRLMETTEFARPIPAGSIVELLA 82

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +  +G+TS+ +  +V+T   +         C    V+VA+D +G P
Sbjct: 83  WVTAVGRTSMRVRVEVFT--EDMYLPARSLACSGEFVLVALDAQGQP 127


>gi|291453705|ref|ZP_06593095.1| acyl-CoA hydrolase [Streptomyces albus J1074]
 gi|291356654|gb|EFE83556.1| acyl-CoA hydrolase [Streptomyces albus J1074]
          Length = 191

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +D A G  A +  +   VT ++ E+ F  P++V DL+H+  Q+ 
Sbjct: 39  DTNLLGTVHGGVIMKLVDDAAGAVAGRHSEGPAVTASMDEMAFLMPVRVGDLLHVRAQVN 98

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G++S+ +   V    R   S   Q+   A +V  AVD  G P+ +
Sbjct: 99  WTGRSSMEVGVRV-VAERWNDSTPAQQVGTAYLVFTAVDADGKPRQV 144


>gi|304409823|ref|ZP_07391443.1| thioesterase superfamily protein [Shewanella baltica OS183]
 gi|307304179|ref|ZP_07583932.1| thioesterase superfamily protein [Shewanella baltica BA175]
 gi|304352341|gb|EFM16739.1| thioesterase superfamily protein [Shewanella baltica OS183]
 gi|306913077|gb|EFN43500.1| thioesterase superfamily protein [Shewanella baltica BA175]
          Length = 159

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 56/116 (48%), Gaps = 2/116 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           TL+  + P DVN  G V GG +M  ID+A    A+       +T     + F +PI V +
Sbjct: 9   TLRFLSEPADVNFGGKVHGGAVMKWIDLAAYACAAGWSGKYCITAYAGGIRFVQPILVGN 68

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +V +  ++   GKTS+ I  DV       S   L   C   V+MVAVDE G P  +
Sbjct: 69  IVEVSAKVIYTGKTSMHIGIDVRAGDPKVSERHLTTHC--IVIMVAVDEHGQPTPV 122


>gi|255320162|ref|ZP_05361348.1| thioesterase family protein [Acinetobacter radioresistens SK82]
 gi|262379238|ref|ZP_06072394.1| acyl-CoA hydrolase [Acinetobacter radioresistens SH164]
 gi|255302780|gb|EET82011.1| thioesterase family protein [Acinetobacter radioresistens SK82]
 gi|262298695|gb|EEY86608.1| acyl-CoA hydrolase [Acinetobacter radioresistens SH164]
          Length = 174

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 59/117 (50%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V 
Sbjct: 17  LTMSVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYSGSYVVTLSVDKVNFKEPIHVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +  +G+TS+ I   V    +N     ++ T      MVAVDE+G P+ +
Sbjct: 77  ELVTFLASVNHVGRTSMEIGIRVEA--QNIQKRTVRHTNSCYFTMVAVDEQGKPRQV 131


>gi|117920996|ref|YP_870188.1| thioesterase superfamily protein [Shewanella sp. ANA-3]
 gi|117613328|gb|ABK48782.1| thioesterase superfamily protein [Shewanella sp. ANA-3]
          Length = 159

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 57/117 (48%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+  + P DVN  G V GG +M  ID+A    A+       +T     + F +PI V 
Sbjct: 8   ITLRFLSEPADVNFGGKVHGGAVMKWIDLAAYACAAGWSGKYCITAYAGGIRFVQPILVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++V +  ++   GKTS+ I  DV       S   L   C   V+MVAVDE G P  +
Sbjct: 68  NIVEVSAKVIYTGKTSMHIGIDVRAGDPKISERHLTTHC--IVIMVAVDENGQPTPV 122


>gi|59711776|ref|YP_204552.1| acyl-CoA hydrolase [Vibrio fischeri ES114]
 gi|59479877|gb|AAW85664.1| acyl-CoA hydrolase [Vibrio fischeri ES114]
          Length = 161

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 57/117 (48%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F +PI V 
Sbjct: 8   VTLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYASAAGWSGKYCITAYAGGIRFVEPIFVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   GK+S+ I  DV        ++ L   C   V+MVAVD  G P S+
Sbjct: 68  NLVEVTGKVIYTGKSSMHIAIDVQASDPKEQNNRLTTHC--IVIMVAVDGNGKPTSV 122


>gi|53720076|ref|YP_109062.1| long-chain acyl-CoA thioester hydrolase [Burkholderia pseudomallei
           K96243]
 gi|53725245|ref|YP_102294.1| thioesterase family protein [Burkholderia mallei ATCC 23344]
 gi|67640952|ref|ZP_00439742.1| thioesterase family protein [Burkholderia mallei GB8 horse 4]
 gi|76812231|ref|YP_334321.1| long-chain acyl-CoA thioester hydrolase [Burkholderia pseudomallei
           1710b]
 gi|121599450|ref|YP_993818.1| thioesterase family protein [Burkholderia mallei SAVP1]
 gi|124383586|ref|YP_001026880.1| thioesterase family protein [Burkholderia mallei NCTC 10229]
 gi|126440475|ref|YP_001059846.1| thioesterase family protein [Burkholderia pseudomallei 668]
 gi|126450923|ref|YP_001079833.1| thioesterase family protein [Burkholderia mallei NCTC 10247]
 gi|126451488|ref|YP_001067133.1| thioesterase family protein [Burkholderia pseudomallei 1106a]
 gi|134277714|ref|ZP_01764429.1| thioesterase family protein [Burkholderia pseudomallei 305]
 gi|167002763|ref|ZP_02268553.1| thioesterase family protein [Burkholderia mallei PRL-20]
 gi|167846705|ref|ZP_02472213.1| thioesterase family protein [Burkholderia pseudomallei B7210]
 gi|217420775|ref|ZP_03452280.1| thioesterase family protein [Burkholderia pseudomallei 576]
 gi|226197949|ref|ZP_03793523.1| thioesterase family protein [Burkholderia pseudomallei Pakistan 9]
 gi|237813241|ref|YP_002897692.1| thioesterase family protein [Burkholderia pseudomallei MSHR346]
 gi|242315779|ref|ZP_04814795.1| thioesterase family protein [Burkholderia pseudomallei 1106b]
 gi|254177136|ref|ZP_04883793.1| thioesterase family protein [Burkholderia mallei ATCC 10399]
 gi|254181141|ref|ZP_04887739.1| thioesterase family protein [Burkholderia pseudomallei 1655]
 gi|254191982|ref|ZP_04898482.1| thioesterase family protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254195627|ref|ZP_04902054.1| thioesterase family protein [Burkholderia pseudomallei S13]
 gi|254203989|ref|ZP_04910349.1| thioesterase family protein [Burkholderia mallei FMH]
 gi|254208970|ref|ZP_04915318.1| thioesterase family protein [Burkholderia mallei JHU]
 gi|254258238|ref|ZP_04949292.1| thioesterase family protein [Burkholderia pseudomallei 1710a]
 gi|254295671|ref|ZP_04963129.1| thioesterase family protein [Burkholderia pseudomallei 406e]
 gi|254359984|ref|ZP_04976254.1| thioesterase family protein [Burkholderia mallei 2002721280]
 gi|52210490|emb|CAH36473.1| long-chain acyl-CoA thioester hydrolase [Burkholderia pseudomallei
           K96243]
 gi|52428668|gb|AAU49261.1| thioesterase family protein [Burkholderia mallei ATCC 23344]
 gi|76581684|gb|ABA51159.1| long-chain acyl-CoA thioester hydrolase [Burkholderia pseudomallei
           1710b]
 gi|121228260|gb|ABM50778.1| thioesterase family protein [Burkholderia mallei SAVP1]
 gi|124291606|gb|ABN00875.1| thioesterase family protein [Burkholderia mallei NCTC 10229]
 gi|126219968|gb|ABN83474.1| thioesterase family protein [Burkholderia pseudomallei 668]
 gi|126225130|gb|ABN88670.1| thioesterase family protein [Burkholderia pseudomallei 1106a]
 gi|126243793|gb|ABO06886.1| thioesterase family protein [Burkholderia mallei NCTC 10247]
 gi|134251364|gb|EBA51443.1| thioesterase family protein [Burkholderia pseudomallei 305]
 gi|147745501|gb|EDK52581.1| thioesterase family protein [Burkholderia mallei FMH]
 gi|147750846|gb|EDK57915.1| thioesterase family protein [Burkholderia mallei JHU]
 gi|148029224|gb|EDK87129.1| thioesterase family protein [Burkholderia mallei 2002721280]
 gi|157805519|gb|EDO82689.1| thioesterase family protein [Burkholderia pseudomallei 406e]
 gi|157987804|gb|EDO95569.1| thioesterase family protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|160698177|gb|EDP88147.1| thioesterase family protein [Burkholderia mallei ATCC 10399]
 gi|169652373|gb|EDS85066.1| thioesterase family protein [Burkholderia pseudomallei S13]
 gi|184211680|gb|EDU08723.1| thioesterase family protein [Burkholderia pseudomallei 1655]
 gi|217396187|gb|EEC36204.1| thioesterase family protein [Burkholderia pseudomallei 576]
 gi|225930137|gb|EEH26150.1| thioesterase family protein [Burkholderia pseudomallei Pakistan 9]
 gi|237503854|gb|ACQ96172.1| thioesterase family protein [Burkholderia pseudomallei MSHR346]
 gi|238521779|gb|EEP85228.1| thioesterase family protein [Burkholderia mallei GB8 horse 4]
 gi|242139018|gb|EES25420.1| thioesterase family protein [Burkholderia pseudomallei 1106b]
 gi|243061585|gb|EES43771.1| thioesterase family protein [Burkholderia mallei PRL-20]
 gi|254216927|gb|EET06311.1| thioesterase family protein [Burkholderia pseudomallei 1710a]
          Length = 168

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    PT VN  G V GG +M  ID    AC  I +S+ C    VT +V  + F++PI 
Sbjct: 16  FRFLAEPTSVNFGGKVHGGALMKWIDETAYACAAIWSSRYC----VTVSVGNIRFQRPIL 71

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 72  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 124


>gi|84498648|ref|ZP_00997405.1| putative acyl-CoA hydrolase [Janibacter sp. HTCC2649]
 gi|84381045|gb|EAP96931.1| putative acyl-CoA hydrolase [Janibacter sp. HTCC2649]
          Length = 165

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 9/111 (8%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG +M  +D   G+ A++      VT A+ E+ F  P++V D++H   Q+ 
Sbjct: 19  DANLLGTVHGGNLMKAVDSTAGVVANRYAGGPAVTAALDEMSFLTPVRVGDVLHTSAQLN 78

Query: 103 KIGKTS----VTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G++S    V +  D W    +A ++ +     A +V VAVD +G PK+I
Sbjct: 79  WAGRSSMEVGVRVEVDRW----DAVTERVH-VASAYLVFVAVDAEGKPKTI 124


>gi|167837396|ref|ZP_02464279.1| thioesterase family protein [Burkholderia thailandensis MSMB43]
          Length = 168

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    PT VN  G V GG +M  ID    AC  I +S+ C    VT +V  + F++PI 
Sbjct: 16  FRFLAEPTSVNFGGKVHGGALMKWIDETAYACAAIWSSRYC----VTVSVGNIRFQRPIL 71

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 72  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 124


>gi|83718474|ref|YP_442221.1| thioesterase family protein [Burkholderia thailandensis E264]
 gi|83652299|gb|ABC36362.1| thioesterase family protein [Burkholderia thailandensis E264]
          Length = 187

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    PT VN  G V GG +M  ID    AC  I +S+ C    VT +V  + F++PI 
Sbjct: 35  FRFLAEPTSVNFGGKVHGGALMKWIDETAYACAAIWSSRYC----VTVSVGNIRFQRPIL 90

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 91  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 143


>gi|94313670|ref|YP_586879.1| Thioesterase superfamily [Cupriavidus metallidurans CH34]
 gi|93357522|gb|ABF11610.1| Thioesterase superfamily [Cupriavidus metallidurans CH34]
          Length = 169

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 60/120 (50%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ +   P   N  GNV GG I+  +D+     AS+     VVT +V +++F +PI
Sbjct: 13  SHQLSMTVLMTPDMANFSGNVHGGTILKYLDMVAYACASRYAGRYVVTLSVDQVMFRQPI 72

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G++S+ I   V T   N  S V++ T      MVAVD+ G P  +
Sbjct: 73  HVGELVTFLAAVNFTGRSSMEIGIKVVT--ENIRSKVVRHTNSCYFTMVAVDDNGAPAEV 130


>gi|257138413|ref|ZP_05586675.1| thioesterase family protein [Burkholderia thailandensis E264]
          Length = 168

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    PT VN  G V GG +M  ID    AC  I +S+ C    VT +V  + F++PI 
Sbjct: 16  FRFLAEPTSVNFGGKVHGGALMKWIDETAYACAAIWSSRYC----VTVSVGNIRFQRPIL 71

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 72  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 124


>gi|167563576|ref|ZP_02356492.1| thioesterase family protein [Burkholderia oklahomensis EO147]
          Length = 168

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    PT VN  G V GG +M  ID    AC  I +S+ C    VT +V  + F++PI 
Sbjct: 16  FRFLAEPTSVNFGGKVHGGALMKWIDETAYACAAIWSSRYC----VTVSVGNIRFQRPIL 71

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 72  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 124


>gi|260770014|ref|ZP_05878947.1| acyl-CoA hydrolase [Vibrio furnissii CIP 102972]
 gi|260615352|gb|EEX40538.1| acyl-CoA hydrolase [Vibrio furnissii CIP 102972]
          Length = 163

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    ++       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACSAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   GKTS+ +  DV         + L   C   V+MVAVDE G P ++
Sbjct: 68  NLVEVSAKVIYTGKTSMHVAIDVQASDPKELKNRLTTHC--IVIMVAVDESGKPTAV 122


>gi|50084225|ref|YP_045735.1| putative acyl-CoA thioester hydrolase [Acinetobacter sp. ADP1]
 gi|49530201|emb|CAG67913.1| putative acyl-CoA thioester hydrolase [Acinetobacter sp. ADP1]
          Length = 173

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 59/117 (50%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V 
Sbjct: 17  LTMSVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYSGSYVVTLSVDKVTFKEPIYVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +  +G+TS+ I   V    +N  S  ++ T      MVAVDE G P+ +
Sbjct: 77  ELVTFLASVNHVGRTSMEIGIRVEA--QNIRSRTVRHTNSCYFTMVAVDETGKPQKV 131


>gi|300693184|ref|YP_003749157.1| acyl-CoA thioester hydrolase [Ralstonia solanacearum PSI07]
 gi|299075221|emb|CBJ34510.1| putative acyl-coA thioester hydrolase [Ralstonia solanacearum
           PSI07]
          Length = 164

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 59/120 (49%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ +   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI
Sbjct: 5   SHQLSMTVLMTPDMANFSGNVHGGHILKLLDQVAYACASRYAGRYVVTLSVDQVVFRQPI 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G+TS+ I   V T   N  S V++ T      MVAVD+ G P  +
Sbjct: 65  HVGELVTFLASVNYTGRTSMEIGIKVVT--ENIRSKVVRHTNSCYFTMVAVDDDGKPADV 122


>gi|194291894|ref|YP_002007801.1| acyl-CoA thioester hydrolase [Cupriavidus taiwanensis LMG 19424]
 gi|193225798|emb|CAQ71744.1| putative acyl-coA thioester hydrolase [Cupriavidus taiwanensis LMG
           19424]
          Length = 161

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 60/120 (50%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ +   P   N  GNV GG I+  +D+     AS+     VVT +V +++F +PI
Sbjct: 5   SHQLSMTVLMTPDMANFSGNVHGGTILKYLDMVAYACASRYAGRYVVTLSVDQVVFRQPI 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G++S+ I   V T   N  S +++ T      MVAVD+ G P  +
Sbjct: 65  HVGELVTFLASVNYTGRSSMEIGIKVVT--ENIRSKLVRHTNSCYFTMVAVDDNGTPAEV 122


>gi|318060823|ref|ZP_07979546.1| putative acyl-CoA hydrolase [Streptomyces sp. SA3_actG]
          Length = 182

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 55/103 (53%), Gaps = 1/103 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           TD NL G   GG IM  +D A G  A +      VT ++ E++F +P+++ DLVH++ Q 
Sbjct: 31  TDTNLYGTGHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRIGDLVHVHAQC 90

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
              G+TS+ I   V     N S+   Q+   A +V  AVD +G
Sbjct: 91  NWTGRTSMEIGVRVMAERWNESTPA-QQVGTAYLVFAAVDAQG 132


>gi|238026577|ref|YP_002910808.1| thioesterase family protein [Burkholderia glumae BGR1]
 gi|237875771|gb|ACR28104.1| Thioesterase family protein [Burkholderia glumae BGR1]
          Length = 169

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    PT VN  G V GG +M  ID    AC  I +S+ C    VT +V  + F++PI 
Sbjct: 17  FRFLAEPTSVNFGGKVHGGALMKWIDETAYACAAIWSSRYC----VTVSVGNIRFQRPIL 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 73  VGNLVELKARVVATGRTSMHIHVSVQAG--DPKGGVLRQTTDCLVVFVAVDENGN 125


>gi|46255231|ref|YP_006143.1| hypothetical protein TT_P0160 [Thermus thermophilus HB27]
 gi|46198080|gb|AAS82490.1| hypothetical conserved protein [Thermus thermophilus HB27]
          Length = 133

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 59/110 (53%), Gaps = 1/110 (0%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P + N  G +FGG +++ +D A  + A++  + +VVT     + F++P+ +  +V +  
Sbjct: 11  FPGETNHYGTLFGGTVLAWMDQAAFVAATRHARKKVVTVHADAVDFKRPVPLGAIVELVA 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +++++G+TS+ +  ++W  P     +          V+VAVDE G P  +
Sbjct: 71  RLKEVGRTSMRVEVEMWVEPVKEGEEAYL-AARGGFVLVAVDEGGRPSPV 119


>gi|120435870|ref|YP_861556.1| acyl-CoA thioester hydrolase [Gramella forsetii KT0803]
 gi|117578020|emb|CAL66489.1| acyl-CoA thioester hydrolase [Gramella forsetii KT0803]
          Length = 128

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 58/108 (53%), Gaps = 6/108 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID  C + +  QL   + VTK ++E+ F       D++ I  
Sbjct: 11  PEDLNPNGTLFGGRLLEWIDEECALYSIVQLENPKTVTKYMSEIDFRSSAHQGDIIEIGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           ++ K G  S+T+ C+V       S   + K     +VMVA+DE+G PK
Sbjct: 71  EVEKFGTASLTLKCEVRNKMTRESIIAVDK-----IVMVALDEEGKPK 113


>gi|149187141|ref|ZP_01865439.1| acyl-CoA thioester hydrolase-related protein [Vibrio shilonii AK1]
 gi|148838677|gb|EDL55616.1| acyl-CoA thioester hydrolase-related protein [Vibrio shilonii AK1]
          Length = 161

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 57/117 (48%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    ++       +T     + F +PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACSAAWSGKYCITAYAGGIRFVQPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G++S+ I  DV         + L   C   V+MVAVDE G P S+
Sbjct: 68  NLVEVSAKVIYTGRSSMHIAIDVQASDPKELKNRLTTHC--IVIMVAVDEDGKPTSV 122


>gi|302865446|ref|YP_003834083.1| thioesterase superfamily protein [Micromonospora aurantiaca ATCC
           27029]
 gi|315501994|ref|YP_004080881.1| thioesterase superfamily protein [Micromonospora sp. L5]
 gi|302568305|gb|ADL44507.1| thioesterase superfamily protein [Micromonospora aurantiaca ATCC
           27029]
 gi|315408613|gb|ADU06730.1| thioesterase superfamily protein [Micromonospora sp. L5]
          Length = 171

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (54%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           DVNL G V GG +M  +D   G  A++      VT ++ E++F +P++V DLVH + QI 
Sbjct: 28  DVNLYGTVHGGVLMKFVDDVAGAAAARHSGGTAVTASIDEIVFSEPVRVGDLVHAHAQIN 87

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
             G+TS+ +   V     +++ +   +   A +V V VD  G P+ +R
Sbjct: 88  WTGQTSMEVGVKVVAERWDSAEEEPVRVATAYLVFVGVDVGGTPRPVR 135


>gi|302521382|ref|ZP_07273724.1| acyl-CoA hydrolase [Streptomyces sp. SPB78]
 gi|333024968|ref|ZP_08453032.1| putative acyl-CoA hydrolase [Streptomyces sp. Tu6071]
 gi|302430277|gb|EFL02093.1| acyl-CoA hydrolase [Streptomyces sp. SPB78]
 gi|332744820|gb|EGJ75261.1| putative acyl-CoA hydrolase [Streptomyces sp. Tu6071]
          Length = 185

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 55/103 (53%), Gaps = 1/103 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           TD NL G   GG IM  +D A G  A +      VT ++ E++F +P+++ DLVH++ Q 
Sbjct: 34  TDTNLYGTGHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRIGDLVHVHAQC 93

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
              G+TS+ I   V     N S+   Q+   A +V  AVD +G
Sbjct: 94  NWTGRTSMEIGVRVMAERWNESTPA-QQVGTAYLVFAAVDAQG 135


>gi|207722324|ref|YP_002252760.1| acyl-coa hydrolase or thioesterase ; protein [Ralstonia
           solanacearum MolK2]
 gi|207739621|ref|YP_002258014.1| acyl-coa hydrolase or thioesterase ; protein [Ralstonia
           solanacearum IPO1609]
 gi|300696745|ref|YP_003747406.1| acyl-coA thioester hydrolase [Ralstonia solanacearum CFBP2957]
 gi|206587501|emb|CAQ18083.1| acyl-coa hydrolase or thioesterase ; protein [Ralstonia
           solanacearum MolK2]
 gi|206593001|emb|CAQ59907.1| acyl-coa hydrolase or thioesterase ; protein [Ralstonia
           solanacearum IPO1609]
 gi|299073469|emb|CBJ52985.1| putative acyl-coA thioester hydrolase [Ralstonia solanacearum
           CFBP2957]
          Length = 164

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 59/120 (49%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ +   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI
Sbjct: 5   SHQLSMTVLMTPDMANFSGNVHGGHILKLLDQVAYACASRYAGRYVVTLSVDQVVFRQPI 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G+TS+ I   V T   N  S V++ T      MVAVD+ G P  +
Sbjct: 65  HVGELVTFLASVNYTGRTSMEIGIKVVT--ENIRSKVVRHTNSCYFTMVAVDDDGKPADV 122


>gi|29831572|ref|NP_826206.1| acyl-CoA hydrolase [Streptomyces avermitilis MA-4680]
 gi|29608688|dbj|BAC72741.1| putative acyl-CoA hydrolase [Streptomyces avermitilis MA-4680]
          Length = 207

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +  A G  A +      VT ++ E++F +P++V DLVH+  Q+ 
Sbjct: 57  DTNLLGTVHGGVIMKLVVDAAGAVAGRHSGGPAVTASMDEMVFLEPVRVGDLVHVKAQVN 116

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G+TS+ +   V     N S+   Q    A +V  AVD  G P+ +
Sbjct: 117 WTGRTSMEVGVRVLAERWNESAPATQ-VGSAYLVFAAVDADGKPRRV 162


>gi|254384915|ref|ZP_05000251.1| acyl-CoA hydrolase [Streptomyces sp. Mg1]
 gi|194343796|gb|EDX24762.1| acyl-CoA hydrolase [Streptomyces sp. Mg1]
          Length = 178

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +D A G  A +      VT ++ E+ F  P++V DLVH+  Q  
Sbjct: 28  DTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMAFLAPVRVGDLVHVRAQCN 87

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G++S+ I   V     N S+   Q    A +V  AVD  G P+++
Sbjct: 88  WTGRSSMEIGVRVLAERWNESTPPTQ-VGSAYLVFTAVDSDGKPRTV 133


>gi|329941085|ref|ZP_08290364.1| acyl-CoA hydrolase [Streptomyces griseoaurantiacus M045]
 gi|329299616|gb|EGG43515.1| acyl-CoA hydrolase [Streptomyces griseoaurantiacus M045]
          Length = 186

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (51%), Gaps = 1/102 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G V GG IM  +D A G  A + C    VT ++ E++F +P++V DLVH+  Q+ 
Sbjct: 36  DTNLLGTVHGGVIMKLVDDAAGAVAGRHCGGPAVTASMDEMVFLEPVRVGDLVHVKAQVN 95

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
             G++S+ +   V     N S+        A +V  AVD  G
Sbjct: 96  WTGRSSMEVGVRVLAERWNESAPATH-VGSAYLVFAAVDADG 136


>gi|255534322|ref|YP_003094693.1| acyl-CoA thioester hydrolase [Flavobacteriaceae bacterium 3519-10]
 gi|255340518|gb|ACU06631.1| acyl-CoA thioester hydrolase [Flavobacteriaceae bacterium 3519-10]
          Length = 172

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 57/108 (52%), Gaps = 4/108 (3%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P + N   N+FGG +++++D    I A++ C+ RVVT +V  + F  PI    +V + +
Sbjct: 19  LPNETNSLRNLFGGELLAKMDRCASISAARHCERRVVTASVNHVSFNFPIPEGGIVVLES 78

Query: 100 QIRKIGKTSVTIYCDVW-TCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ +   TS+ IY DVW   P N +      T E     VAVDE   P
Sbjct: 79  KVSRAFSTSMEIYVDVWLDDPINQTK---THTNEGIYTFVAVDEFNRP 123


>gi|305665737|ref|YP_003862024.1| thioesterase domain-containing protein [Maribacter sp. HTCC2170]
 gi|88710499|gb|EAR02731.1| thioesterase domain protein [Maribacter sp. HTCC2170]
          Length = 171

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P++ N   N+FGG +++++D A  I A +  +   VT +V  + F   + +  +V +  
Sbjct: 18  LPSETNPLNNLFGGELLARMDRAASIAARRHSRRITVTASVNHVAFNHAVPLGSVVTVEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ +   TS+ +Y DVW   R   +    K  EA    VAVDE G P  +
Sbjct: 78  KVSRAFNTSMEVYIDVWMEDR--YNGKRSKANEAIYTFVAVDETGKPTEV 125


>gi|308445913|ref|XP_003087048.1| hypothetical protein CRE_23874 [Caenorhabditis remanei]
 gi|308264487|gb|EFP08440.1| hypothetical protein CRE_23874 [Caenorhabditis remanei]
          Length = 173

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V 
Sbjct: 17  LTMSVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYSGSYVVTLSVDKVNFKEPIHVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++V     +  +G+TS+ I   V    +N     ++ T      MVAVDE G P+ I
Sbjct: 77  EMVSFLASVNHVGRTSMEIGIRVEA--QNIQKRTVRHTNSCYFTMVAVDENGKPQQI 131


>gi|330815942|ref|YP_004359647.1| Thioesterase family protein [Burkholderia gladioli BSR3]
 gi|327368335|gb|AEA59691.1| Thioesterase family protein [Burkholderia gladioli BSR3]
          Length = 169

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    PT VN  G V GG +M  ID    AC  I +S+ C    VT +V  + F++PI 
Sbjct: 17  FRFLAEPTSVNFGGKVHGGALMKWIDETAYACAAIWSSRYC----VTVSVGNIRFKRPIL 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 73  VGNLVELKARVVATGRTSMHIHVTVHAG--DPKGGVLRQTTDCMVVFVAVDENGN 125


>gi|291337040|gb|ADD96561.1| acetyl CoA hydrolase [uncultured organism MedDCM-OCT-S11-C346]
          Length = 144

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P D N  G+ FGG IM  +DIA  I A + C+  VVT AV +L F + I++ D+V I  Q
Sbjct: 4   PPDTNHHGSAFGGMIMQWMDIAAAISAMRHCREPVVTVAVDDLHFARSIRLGDVVVINAQ 63

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +   GKTS+ +   V     N  +   +         VAVD    P
Sbjct: 64  VNHTGKTSMEVGVRVER--ENQKTREREHCLTGYFTFVAVDSDNRP 107


>gi|209694865|ref|YP_002262793.1| putative thioesterase [Aliivibrio salmonicida LFI1238]
 gi|208008816|emb|CAQ79019.1| putative thioesterase [Aliivibrio salmonicida LFI1238]
          Length = 161

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 57/117 (48%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P+DVN  G V GG +M  +D+A    ++       +T     + F +PI V 
Sbjct: 8   VTLRFLAEPSDVNFGGKVHGGAVMKWVDLAAYACSAGWSGKYCITAYAGGIRFVQPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   GK+S+ I  DV         + L   C   V+MVAVDE G P  +
Sbjct: 68  NLVEVTGKVIYTGKSSMHIAIDVQASDPKELENRLTTHC--IVIMVAVDEHGKPTEV 122


>gi|262274379|ref|ZP_06052190.1| acyl-CoA hydrolase [Grimontia hollisae CIP 101886]
 gi|262220942|gb|EEY72256.1| acyl-CoA hydrolase [Grimontia hollisae CIP 101886]
          Length = 161

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F +PI V 
Sbjct: 8   MTLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYANAAAWSGKYCITAYAGGIRFVQPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G TS+ I  DV         + L   C   V+MVAVDE G P SI
Sbjct: 68  NLVEVSAKVIYTGNTSMHIAIDVQASDPKEMKNRLTTHC--IVIMVAVDETGKPTSI 122


>gi|239813370|ref|YP_002942280.1| thioesterase superfamily protein [Variovorax paradoxus S110]
 gi|239799947|gb|ACS17014.1| thioesterase superfamily protein [Variovorax paradoxus S110]
          Length = 147

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 55/114 (48%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P+ VN  G V GG +M  ID A    A+   K   VT  +  + F  PI + 
Sbjct: 4   ITLRFLAEPSTVNFGGKVHGGTVMKWIDEAGYACATSWAKRYCVTAFIGSIRFHHPIMIG 63

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           DLV +  ++   G TS+ I  +V +   +     + KT E  +V V+VD  G P
Sbjct: 64  DLVEVEARLAYTGTTSMNISVEVRSG--DMKGGTMDKTTECLIVFVSVDSHGRP 115


>gi|78221989|ref|YP_383736.1| thioesterase superfamily protein [Geobacter metallireducens GS-15]
 gi|78193244|gb|ABB31011.1| Thioesterase superfamily [Geobacter metallireducens GS-15]
          Length = 147

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 57/114 (50%), Gaps = 10/114 (8%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  GN+FGG +MS +D A  I A +  +C +VT    E+ F +P+ V ++V +  
Sbjct: 12  LPQDTNSAGNIFGGVLMSLMDKAAAITAWRYARCDMVTAGAEEIAFIRPVHVGEVVKVEA 71

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVL----QKTCEATVVMVAVDEKGNPKSI 149
           ++   G+TS+ +   V       + DV      +       MVA+D+ G P  +
Sbjct: 72  RVVCTGRTSIDMAVMV------EAEDVFTGQSYEAARGYFTMVALDKGGKPTEV 119


>gi|73537873|ref|YP_298240.1| thioesterase superfamily protein [Ralstonia eutropha JMP134]
 gi|72121210|gb|AAZ63396.1| Thioesterase superfamily [Ralstonia eutropha JMP134]
          Length = 161

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 60/120 (50%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ +   P   N  GNV GG I+  +D+     AS+     VVT +V +++F +PI
Sbjct: 5   SHQLSMTVLMTPDMANFSGNVHGGTILKYLDMVAYACASRYAGRYVVTLSVDQVVFRQPI 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G++S+ I   V T   N  S +++ T      MVAVD+ G P  +
Sbjct: 65  HVGELVTFLAAVNYTGRSSMEIGIKVVT--ENIRSKLVRHTNSCYFTMVAVDDNGAPAEV 122


>gi|307824023|ref|ZP_07654250.1| thioesterase superfamily protein [Methylobacter tundripaludum SV96]
 gi|307734807|gb|EFO05657.1| thioesterase superfamily protein [Methylobacter tundripaludum SV96]
          Length = 165

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 2/113 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG ++  +D      A++ CK  VVT A+ ++ F++ + V 
Sbjct: 8   LTMTVLMTPDMANFSGNVHGGSLLKLLDQVAYACAAKYCKKYVVTAALDQVFFKQQVNVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           +LV  Y  +  +G +S+ I   V+    +  +D  + T      MVA+DE G 
Sbjct: 68  ELVTFYAHVNYVGHSSMEIGVKVF--AEDLRTDQKRHTTSCYFTMVAMDEHGQ 118


>gi|145593494|ref|YP_001157791.1| thioesterase superfamily protein [Salinispora tropica CNB-440]
 gi|145302831|gb|ABP53413.1| thioesterase superfamily protein [Salinispora tropica CNB-440]
          Length = 172

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 58/107 (54%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           DVNL G V GG +M  +D   G  A++      VT A+ E++F + ++V DLVH Y Q+ 
Sbjct: 29  DVNLYGTVHGGVLMKFVDDVAGAAAARHSGGTAVTAAIDEIVFSEAVRVGDLVHAYAQVN 88

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             G+TS+ +   V     +++     +   A +V V VD  G+P+S+
Sbjct: 89  WAGQTSMEVGVRVTAERWDSAEGEPVRVATAYLVFVGVDAGGSPRSV 135


>gi|313125002|ref|YP_004035266.1| acyl-CoA hydrolase [Halogeometricum borinquense DSM 11551]
 gi|312291367|gb|ADQ65827.1| acyl-CoA hydrolase [Halogeometricum borinquense DSM 11551]
          Length = 167

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  G   GG ++  +DI   I A +  K +VVT ++  + F+ PI++ D+V +  
Sbjct: 25  MPNDTNNLGRALGGTVLHWMDICGAISARRFSKRQVVTASMDHVDFKAPIELGDVVTVTG 84

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +   G+TS+ ++ DV  C    S    ++T  +    VA+DE   P  +
Sbjct: 85  YVFDTGRTSMDVHVDV--CAERPSEGEKRETASSFFSFVALDENETPAPV 132


>gi|254229097|ref|ZP_04922517.1| thioesterase family protein [Vibrio sp. Ex25]
 gi|262396627|ref|YP_003288480.1| acyl-CoA hydrolase [Vibrio sp. Ex25]
 gi|151938388|gb|EDN57226.1| thioesterase family protein [Vibrio sp. Ex25]
 gi|262340221|gb|ACY54015.1| acyl-CoA hydrolase [Vibrio sp. Ex25]
          Length = 161

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P+DVN  G V GG +M  ID+A    ++       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPSDVNFGGKVHGGAVMKWIDLAAYACSAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G++S+ I  DV         + L   C   V+MVAVDE G P  +
Sbjct: 68  NLVEVSAKVIYTGRSSMHIAIDVQASDPKQMKNRLTTHC--IVIMVAVDENGKPTDV 122


>gi|256823811|ref|YP_003147774.1| thioesterase superfamily protein [Kangiella koreensis DSM 16069]
 gi|256797350|gb|ACV28006.1| thioesterase superfamily protein [Kangiella koreensis DSM 16069]
          Length = 165

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  GN+FGG +++ +D    + A +  +  V T +V  ++F+KPI V D +    
Sbjct: 19  FPNQSNPYGNMFGGELLAIMDTTAAMAAIRYAEKTVSTASVERVIFKKPIFVGDRIKTVA 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++  +G+TS+ +  DV+     A  DVL  T   T  +VA DE+  P  +
Sbjct: 79  KVVLVGRTSMMVRTDVFVDKGGAEGDVLSTTAHFT--LVAFDEERVPSEV 126


>gi|212635819|ref|YP_002312344.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Shewanella piezotolerans WP3]
 gi|212557303|gb|ACJ29757.1| Cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Shewanella piezotolerans WP3]
          Length = 159

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 58/118 (49%), Gaps = 2/118 (1%)

Query: 32  VLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
           +LTL+    P DVN  G V GG +M  ID+A    A+       +T     + F KPI V
Sbjct: 7   LLTLRFLAEPADVNFGGKVHGGAVMKWIDLAGYACAAGWSGKYCITAYAGGIRFVKPIYV 66

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            ++V +  ++   G++S+ +  DV       S   L   C   ++MVAVD++G P  +
Sbjct: 67  GNIVEVTAKVIYTGRSSMHLGIDVKAGDPKGSDRHLTTHC--VLIMVAVDDEGKPTQV 122


>gi|116695180|ref|YP_840756.1| Acyl-CoA hydrolase [Ralstonia eutropha H16]
 gi|113529679|emb|CAJ96026.1| Acyl-CoA hydrolase [Ralstonia eutropha H16]
          Length = 180

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 60/120 (50%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ +   P   N  GNV GG I+  +D+     AS+     VVT +V +++F +PI
Sbjct: 24  SHQLSMTVLMTPDMANFSGNVHGGTILKYLDMVAYACASRYAGRYVVTLSVDQVVFRQPI 83

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G++S+ I   V T   N  S +++ T      MVAVD+ G P  +
Sbjct: 84  HVGELVTFLASVNFTGRSSMEIGIKVVT--ENIRSKLVRHTNSCYFTMVAVDDNGTPAEV 141


>gi|284028914|ref|YP_003378845.1| thioesterase superfamily protein [Kribbella flavida DSM 17836]
 gi|283808207|gb|ADB30046.1| thioesterase superfamily protein [Kribbella flavida DSM 17836]
          Length = 169

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 1/121 (0%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
           S+  L+L   T   + NL G V GG IM+ +D   G+ A++      VT ++ E++F  P
Sbjct: 11  SAARLSLSHITAQHETNLLGTVHGGVIMTLVDSVAGVVAARHSGGPAVTASMDEMVFLVP 70

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           ++V D+VH   Q+   G++S+ I   + T  R  S         A +V VAVD  G P+ 
Sbjct: 71  VRVGDVVHFTAQVNWTGRSSMEIGVRI-TADRWDSVGPQVHVATAYLVFVAVDADGQPRQ 129

Query: 149 I 149
           +
Sbjct: 130 V 130


>gi|91223350|ref|ZP_01258616.1| acyl-CoA thioester hydrolase-related protein [Vibrio alginolyticus
           12G01]
 gi|269966062|ref|ZP_06180152.1| Acyl-CoA hydrolase [Vibrio alginolyticus 40B]
 gi|91192163|gb|EAS78426.1| acyl-CoA thioester hydrolase-related protein [Vibrio alginolyticus
           12G01]
 gi|269829209|gb|EEZ83453.1| Acyl-CoA hydrolase [Vibrio alginolyticus 40B]
          Length = 161

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P+DVN  G V GG +M  ID+A    ++       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPSDVNFGGKVHGGAVMKWIDLAAYACSAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G++S+ I  DV         + L   C   V+MVAVDE G P  +
Sbjct: 68  NLVEVSAKVIYTGRSSMHIAIDVQASDPKQMKNRLTTHC--IVIMVAVDENGKPTDV 122


>gi|169796871|ref|YP_001714664.1| putative acyl-CoA thioester hydrolase [Acinetobacter baumannii AYE]
 gi|184157214|ref|YP_001845553.1| acyl-CoA hydrolase [Acinetobacter baumannii ACICU]
 gi|213156738|ref|YP_002318399.1| thioesterase superfamily protein [Acinetobacter baumannii AB0057]
 gi|215484347|ref|YP_002326576.1| Thioesterase superfamily protein [Acinetobacter baumannii
           AB307-0294]
 gi|239503125|ref|ZP_04662435.1| Thioesterase superfamily protein [Acinetobacter baumannii AB900]
 gi|260555863|ref|ZP_05828083.1| thioesterase superfamily protein [Acinetobacter baumannii ATCC
           19606]
 gi|301348336|ref|ZP_07229077.1| Thioesterase superfamily protein [Acinetobacter baumannii AB056]
 gi|301513096|ref|ZP_07238333.1| Thioesterase superfamily protein [Acinetobacter baumannii AB058]
 gi|301596568|ref|ZP_07241576.1| Thioesterase superfamily protein [Acinetobacter baumannii AB059]
 gi|332854502|ref|ZP_08435409.1| thioesterase family protein [Acinetobacter baumannii 6013150]
 gi|332870938|ref|ZP_08439570.1| thioesterase family protein [Acinetobacter baumannii 6013113]
 gi|332872930|ref|ZP_08440894.1| thioesterase family protein [Acinetobacter baumannii 6014059]
 gi|169149798|emb|CAM87689.1| putative acyl-CoA thioester hydrolase [Acinetobacter baumannii AYE]
 gi|183208808|gb|ACC56206.1| Acyl-CoA hydrolase [Acinetobacter baumannii ACICU]
 gi|193076669|gb|ABO11365.2| putative acyl-CoA thioester hydrolase [Acinetobacter baumannii ATCC
           17978]
 gi|213055898|gb|ACJ40800.1| thioesterase superfamily protein [Acinetobacter baumannii AB0057]
 gi|213988162|gb|ACJ58461.1| Thioesterase superfamily protein [Acinetobacter baumannii
           AB307-0294]
 gi|260410774|gb|EEX04072.1| thioesterase superfamily protein [Acinetobacter baumannii ATCC
           19606]
 gi|322507099|gb|ADX02553.1| acyl-CoA thioester hydrolase [Acinetobacter baumannii 1656-2]
 gi|323517078|gb|ADX91459.1| Acyl-CoA hydrolase [Acinetobacter baumannii TCDC-AB0715]
 gi|332727990|gb|EGJ59383.1| thioesterase family protein [Acinetobacter baumannii 6013150]
 gi|332731901|gb|EGJ63180.1| thioesterase family protein [Acinetobacter baumannii 6013113]
 gi|332738941|gb|EGJ69804.1| thioesterase family protein [Acinetobacter baumannii 6014059]
          Length = 171

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V 
Sbjct: 17  LTMSVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYSGSYVVTLSVDKVNFKEPIYVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +  +G+TS+ +   V    +N     ++ T      MVAVDE G P+ +
Sbjct: 77  ELVTFLASVNHVGRTSMEVGIRVEA--QNIQKRTVRHTNSCYFTMVAVDEHGKPREV 131


>gi|92115055|ref|YP_574983.1| thioesterase superfamily protein [Chromohalobacter salexigens DSM
           3043]
 gi|91798145|gb|ABE60284.1| thioesterase superfamily [Chromohalobacter salexigens DSM 3043]
          Length = 171

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 60/117 (51%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  G V GG I+ ++D      AS+     VVT +V ++LF++PI V 
Sbjct: 12  LTMTVLMTPDMANFSGKVHGGAILKKLDEVAYACASRYAGSYVVTLSVDQVLFKQPIHVG 71

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +  +G++S+ I   V     +    V++ T    + MVAVD +G P S+
Sbjct: 72  ELVTFLASVNYVGRSSMEIGIKVVA--ESIQDRVIRHTNSCYLTMVAVDSEGRPNSV 126


>gi|292669169|ref|ZP_06602595.1| thioesterase [Selenomonas noxia ATCC 43541]
 gi|292649221|gb|EFF67193.1| thioesterase [Selenomonas noxia ATCC 43541]
          Length = 173

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 56/110 (50%), Gaps = 1/110 (0%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP+  N +GNV GG IM  +D A    A +  +  VVT  V EL F  PI++ DLV +  
Sbjct: 13  MPSQANPNGNVHGGEIMKLMDSAAYTAARRYARSNVVTARVDELEFHLPIRIGDLVVVTA 72

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            I  +G +S+ I  +V     +  SD  Q    A   MVA+D    PKS+
Sbjct: 73  DIVYVGHSSMEIAVNVIVEDLDEDSDP-QLALSAYFTMVALDRNARPKSV 121


>gi|187926097|ref|YP_001892442.1| thioesterase superfamily protein [Ralstonia pickettii 12J]
 gi|241665585|ref|YP_002983944.1| thioesterase superfamily protein [Ralstonia pickettii 12D]
 gi|187727851|gb|ACD29015.1| thioesterase superfamily protein [Ralstonia pickettii 12J]
 gi|240867612|gb|ACS65272.1| thioesterase superfamily protein [Ralstonia pickettii 12D]
          Length = 167

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 61/127 (48%), Gaps = 5/127 (3%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  Q H    L++ +   P   N  GNV GG I+  +D      AS+     VVT +V +
Sbjct: 1   MNTQSHQ---LSMTVLMTPDMANFSGNVHGGHILKLLDQVAYACASRYAGRYVVTLSVDQ 57

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           ++F +PI V +LV     +   G+TS+ I   V T   N  + V++ T      MVAVD+
Sbjct: 58  VVFRQPIHVGELVTFLASVNYTGRTSMEIGIKVVT--ENIRNQVVRHTNSCYFTMVAVDD 115

Query: 143 KGNPKSI 149
            G P  +
Sbjct: 116 DGKPADV 122


>gi|323493558|ref|ZP_08098680.1| acyl-CoA thioester hydrolase-like protein [Vibrio brasiliensis LMG
           20546]
 gi|323312381|gb|EGA65523.1| acyl-CoA thioester hydrolase-like protein [Vibrio brasiliensis LMG
           20546]
          Length = 161

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F +PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYANAAAWSGKYCITAYAGGIRFVQPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G++S+ I  DV         + L   C   V+MVAVDE+G P S+
Sbjct: 68  NLVEVSAKVIYTGRSSMHIAIDVQASDPKELKNRLTTHC--IVIMVAVDEEGKPTSV 122


>gi|169633938|ref|YP_001707674.1| putative acyl-CoA thioester hydrolase [Acinetobacter baumannii SDF]
 gi|169152730|emb|CAP01745.1| putative acyl-CoA thioester hydrolase [Acinetobacter baumannii]
          Length = 171

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V 
Sbjct: 17  LTMSVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYSGSYVVTLSVDKVNFKEPIYVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +  +G+TS+ +   V    +N     ++ T      MVAVDE G P+ +
Sbjct: 77  ELVTFLASVNHVGRTSMEVGIRVEA--QNIQKRTVRHTNSCYFTMVAVDEHGKPRKV 131


>gi|309779108|ref|ZP_07673875.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Ralstonia sp. 5_7_47FAA]
 gi|308922173|gb|EFP67803.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Ralstonia sp. 5_7_47FAA]
          Length = 167

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 61/127 (48%), Gaps = 5/127 (3%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  Q H    L++ +   P   N  GNV GG I+  +D      AS+     VVT +V +
Sbjct: 1   MNTQSHQ---LSMTVLMTPDMANFSGNVHGGHILKFLDQVAYACASRYAGRYVVTLSVDQ 57

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           ++F +PI V +LV     +   G+TS+ I   V T   N  + V++ T      MVAVD+
Sbjct: 58  VVFRQPIHVGELVTFLASVNYTGRTSMEIGIKVVT--ENIRNQVVRHTNSCYFTMVAVDD 115

Query: 143 KGNPKSI 149
            G P  +
Sbjct: 116 DGKPADV 122


>gi|229542998|ref|ZP_04432058.1| thioesterase superfamily protein [Bacillus coagulans 36D1]
 gi|229327418|gb|EEN93093.1| thioesterase superfamily protein [Bacillus coagulans 36D1]
          Length = 171

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  G +FGG +M+ ID    I A++L +C VVT +   + F  PI+V ++V +  
Sbjct: 21  FPPDTNHLGTLFGGKLMAYIDDTASIAAAKLARCTVVTASTDSVDFIAPIRVGNVVTVEA 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            + + G+TS+ ++  V     +  ++  +    + +  VA+DE G P  +
Sbjct: 81  MVSRTGRTSMEVFVKV--SAEDLKTEETKIAAISFLTFVALDEDGKPTPV 128


>gi|218676006|ref|YP_002394825.1| putative hydrolase [Vibrio splendidus LGP32]
 gi|218324274|emb|CAV25575.1| putative hydrolase [Vibrio splendidus LGP32]
          Length = 167

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  +D+A    ++       +T     + F  PI V 
Sbjct: 14  VTLRFLAEPGDVNFGGKVHGGAVMKWVDLAAYACSAGWSGKYCITAYAGGIRFVAPIHVG 73

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G +S+ I  DV        ++ L   C   V+MVAVDE GNP  +
Sbjct: 74  NLVEVSAKVIYTGSSSMHIAIDVQASDPKELNNRLTTHC--IVIMVAVDENGNPTKV 128


>gi|295677225|ref|YP_003605749.1| thioesterase superfamily protein [Burkholderia sp. CCGE1002]
 gi|295437068|gb|ADG16238.1| thioesterase superfamily protein [Burkholderia sp. CCGE1002]
          Length = 168

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 10/117 (8%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPI 89
           T +    PT VN  G V GG +M  ID    AC  + + + C    VT +V  + F +PI
Sbjct: 15  TFRFLAEPTSVNFGGKVHGGALMKWIDETAYACAAVWSGRYC----VTVSVGNIRFRRPI 70

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            V +LV +  ++   G+TS+ I+  V     +     L++T +  VVMVAV+E G+P
Sbjct: 71  LVGNLVELRARVVATGRTSMHIHVSVHAG--DPKGGELRQTTDCLVVMVAVNENGHP 125


>gi|86144565|ref|ZP_01062897.1| putative acyl-CoA thioester hydrolase [Vibrio sp. MED222]
 gi|85837464|gb|EAQ55576.1| putative acyl-CoA thioester hydrolase [Vibrio sp. MED222]
          Length = 167

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  +D+A    ++       +T     + F  PI V 
Sbjct: 14  VTLRFLAEPGDVNFGGKVHGGAVMKWVDLAAYACSAGWSGKYCITAYAGGIRFVAPIHVG 73

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G +S+ I  DV        ++ L   C   V+MVAVDE GNP  +
Sbjct: 74  NLVEVSAKVIYTGSSSMHIAIDVQASDPKELNNRLTTHC--IVIMVAVDENGNPTKV 128


>gi|134295120|ref|YP_001118855.1| thioesterase superfamily protein [Burkholderia vietnamiensis G4]
 gi|134138277|gb|ABO54020.1| thioesterase superfamily protein [Burkholderia vietnamiensis G4]
          Length = 170

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    P+ VN  G V GG +M  ID    AC  + +S+ C    VT +V  + F++PI 
Sbjct: 18  FRFLAEPSSVNFGGKVHGGALMKWIDEVAYACAAVWSSRYC----VTVSVGNIRFQRPIL 73

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 74  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 126


>gi|17548424|ref|NP_521764.1| acyl-CoA thioester hydrolase-related protein [Ralstonia
           solanacearum GMI1000]
 gi|17430671|emb|CAD17354.1| putative acyl-coa hydrolase or thioesterase ; protein [Ralstonia
           solanacearum GMI1000]
          Length = 164

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 59/120 (49%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ +   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI
Sbjct: 5   SHQLSMTVLMTPDMANFSGNVHGGHILKLLDQVAYACASRYAGRYVVTLSVDQVVFRQPI 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G+TS+ I   V T   N  + V++ T      MVAVD+ G P  +
Sbjct: 65  HVGELVTFLASVNYTGRTSMEIGIKVVT--ENIRNKVVRHTNSCYFTMVAVDDDGKPADV 122


>gi|28901252|ref|NP_800907.1| acyl-CoA thioester hydrolase-like protein [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|260362809|ref|ZP_05775678.1| acyl-CoA hydrolase [Vibrio parahaemolyticus K5030]
 gi|260880097|ref|ZP_05892452.1| acyl-CoA hydrolase [Vibrio parahaemolyticus AN-5034]
 gi|260895214|ref|ZP_05903710.1| acyl-CoA hydrolase [Vibrio parahaemolyticus Peru-466]
 gi|28809765|dbj|BAC62740.1| acyl-CoA thioester hydrolase-related protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308085636|gb|EFO35331.1| acyl-CoA hydrolase [Vibrio parahaemolyticus Peru-466]
 gi|308092624|gb|EFO42319.1| acyl-CoA hydrolase [Vibrio parahaemolyticus AN-5034]
 gi|308112251|gb|EFO49791.1| acyl-CoA hydrolase [Vibrio parahaemolyticus K5030]
          Length = 161

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    ++       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACSAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G++S+ I  DV         + L   C   V+MVAVDE G P  I
Sbjct: 68  NLVEVSAKVIYTGRSSMHIAIDVQASDPKQMKNRLTTHC--IVIMVAVDESGKPTDI 122


>gi|332668274|ref|YP_004451062.1| thioesterase superfamily protein [Haliscomenobacter hydrossis DSM
           1100]
 gi|332337088|gb|AEE54189.1| thioesterase superfamily protein [Haliscomenobacter hydrossis DSM
           1100]
          Length = 178

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 61/111 (54%), Gaps = 3/111 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  GN+ GG ++  +DIA  I A + C+  VVT +V  + F++PI+V D+V +  
Sbjct: 21  MPNDANPMGNLMGGNLLRWMDIASAICAGKHCERHVVTASVDHVSFQRPIKVGDVVTLEA 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE-KGNPKSI 149
            + +   +S+ +Y +V+    +      ++   A    VA+D+  G+P SI
Sbjct: 81  TVTRAFNSSLEVYVEVFAA--DIKGQNARRCNHAYYSFVALDDANGSPISI 129


>gi|225010378|ref|ZP_03700850.1| thioesterase superfamily protein [Flavobacteria bacterium MS024-3C]
 gi|225005857|gb|EEG43807.1| thioesterase superfamily protein [Flavobacteria bacterium MS024-3C]
          Length = 173

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P++ N   N+FGG +++++D A  I A +  +   VT +V  + F + + V  +V +  
Sbjct: 18  LPSETNPLNNLFGGELLARMDRAASIAARRHSRRITVTASVNHVAFNRSVPVGSVVTVEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            + +   TS+ ++ DVW   R +      K  EA    VAVD+ G P  +
Sbjct: 78  HVSRAFNTSMEVFIDVWMEDRFSGEKT--KANEAIYTFVAVDDTGKPTEV 125


>gi|115351019|ref|YP_772858.1| thioesterase superfamily protein [Burkholderia ambifaria AMMD]
 gi|115281007|gb|ABI86524.1| thioesterase superfamily protein [Burkholderia ambifaria AMMD]
          Length = 170

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    P+ VN  G V GG +M  ID    AC  + +S+ C    VT +V  + F++PI 
Sbjct: 18  FRFLAEPSSVNFGGKVHGGALMKWIDEVAYACAAVWSSRYC----VTVSVGNIRFQRPIL 73

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 74  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 126


>gi|107022166|ref|YP_620493.1| thioesterase [Burkholderia cenocepacia AU 1054]
 gi|116689112|ref|YP_834735.1| thioesterase superfamily protein [Burkholderia cenocepacia HI2424]
 gi|105892355|gb|ABF75520.1| thioesterase superfamily [Burkholderia cenocepacia AU 1054]
 gi|116647201|gb|ABK07842.1| thioesterase superfamily protein [Burkholderia cenocepacia HI2424]
          Length = 170

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    P+ VN  G V GG +M  ID    AC  + +S+ C    VT +V  + F++PI 
Sbjct: 18  FRFLAEPSSVNFGGKVHGGALMKWIDEVAYACAAVWSSRYC----VTVSVGNIRFQRPIL 73

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 74  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 126


>gi|304438129|ref|ZP_07398072.1| thioesterase [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304368902|gb|EFM22584.1| thioesterase [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 192

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 2/125 (1%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
           C+M  S ++  ++  MP+  N +GNV GG IM  +D A    A +  +  VVT  V EL 
Sbjct: 11  CKMKDSRIVISEV-MMPSQANPNGNVHGGEIMKLMDSAAYAAARRYARSNVVTARVDELE 69

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           F  PI++ DLV +   I  +G +S+ I  +V     +  SD  Q    A   MVA+D   
Sbjct: 70  FHLPIRIGDLVVVTADIVYVGHSSMEISVNVIVEDLDEGSDP-QLGLSAYFTMVALDRNA 128

Query: 145 NPKSI 149
            PK++
Sbjct: 129 RPKAV 133


>gi|299068600|emb|CBJ39830.1| putative acyl-coA thioester hydrolase [Ralstonia solanacearum
           CMR15]
          Length = 164

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 59/120 (49%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ +   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI
Sbjct: 5   SHQLSMTVLMTPDMANFSGNVHGGHILKLLDQVAYACASRYAGRYVVTLSVDQVVFRQPI 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G+TS+ I   V T   N  + V++ T      MVAVD+ G P  +
Sbjct: 65  HVGELVTFLASVNYTGRTSMEIGIKVVT--ENIRNKVVRHTNSCYFTMVAVDDDGKPADV 122


>gi|114562678|ref|YP_750191.1| thioesterase superfamily protein [Shewanella frigidimarina NCIMB
           400]
 gi|114333971|gb|ABI71353.1| thioesterase superfamily protein [Shewanella frigidimarina NCIMB
           400]
          Length = 162

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LTL+    P DVN  G V GG +M  ID+A    A+       +T     + F KPI V 
Sbjct: 8   LTLRFLAEPADVNFGGKVHGGAVMKWIDLAAYAAAAGWSGKYCITVYAGGIRFVKPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++V +  ++   G TS+ I  DV       S   L   C   V+MVAVD++G+P S+
Sbjct: 68  NIVEVTGKVIYTGTTSMHIAIDVKAGDPKESERHLTTHC--IVIMVAVDDEGHPTSV 122


>gi|258511343|ref|YP_003184777.1| thioesterase superfamily protein [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257478069|gb|ACV58388.1| thioesterase superfamily protein [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 164

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 53/107 (49%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  G +FGG +M+ ID    I A +  + RVVT +   L F  PI+V   +H+  
Sbjct: 18  LPPDTNQFGTIFGGKVMAYIDKIAAISAMRHARQRVVTASSDSLDFLAPIRVGQAIHLEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +    KTS+ ++  V          VL  T  + +  VA+DE+G P
Sbjct: 78  FVTYAHKTSMEVFVKVLAENLLTGETVL--TARSYLTFVAIDEEGRP 122


>gi|218288265|ref|ZP_03492564.1| thioesterase superfamily protein [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218241624|gb|EED08797.1| thioesterase superfamily protein [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 164

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 53/107 (49%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  G +FGG +M+ ID    I A +  + RVVT +   L F  PI+V   +H+  
Sbjct: 18  LPPDTNQFGTIFGGKVMAYIDKIAAISAMRHARQRVVTASSDSLDFLAPIRVGQAIHLEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +    KTS+ ++  V          VL  T  + +  VA+DE+G P
Sbjct: 78  FVTYTHKTSMEVFVKVLAENLLTGETVL--TARSYLTFVAIDEQGRP 122


>gi|171317128|ref|ZP_02906330.1| thioesterase superfamily protein [Burkholderia ambifaria MEX-5]
 gi|171097695|gb|EDT42525.1| thioesterase superfamily protein [Burkholderia ambifaria MEX-5]
          Length = 170

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    P+ VN  G V GG +M  ID    AC  + +S+ C    VT +V  + F++PI 
Sbjct: 18  FRFLAEPSSVNFGGKVHGGALMKWIDEVAYACAAVWSSRYC----VTVSVGNIRFQRPIL 73

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 74  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 126


>gi|170732400|ref|YP_001764347.1| thioesterase superfamily protein [Burkholderia cenocepacia MC0-3]
 gi|169815642|gb|ACA90225.1| thioesterase superfamily protein [Burkholderia cenocepacia MC0-3]
          Length = 170

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    P+ VN  G V GG +M  ID    AC  + +S+ C    VT +V  + F++PI 
Sbjct: 18  FRFLAEPSSVNFGGKVHGGALMKWIDEVAYACAAVWSSRYC----VTVSVGNIRFQRPIL 73

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 74  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 126


>gi|170700872|ref|ZP_02891860.1| thioesterase superfamily protein [Burkholderia ambifaria IOP40-10]
 gi|172060024|ref|YP_001807676.1| thioesterase superfamily protein [Burkholderia ambifaria MC40-6]
 gi|170134235|gb|EDT02575.1| thioesterase superfamily protein [Burkholderia ambifaria IOP40-10]
 gi|171992541|gb|ACB63460.1| thioesterase superfamily protein [Burkholderia ambifaria MC40-6]
          Length = 170

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    P+ VN  G V GG +M  ID    AC  + +S+ C    VT +V  + F++PI 
Sbjct: 18  FRFLAEPSSVNFGGKVHGGALMKWIDEVAYACAAVWSSRYC----VTVSVGNIRFQRPIL 73

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 74  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 126


>gi|319953070|ref|YP_004164337.1| thioesterase superfamily protein [Cellulophaga algicola DSM 14237]
 gi|319421730|gb|ADV48839.1| thioesterase superfamily protein [Cellulophaga algicola DSM 14237]
          Length = 175

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P++ N   N+FGG +++++D A  I A +  +   VT +V  + F + + V  +V +  
Sbjct: 18  LPSETNPLNNLFGGELLARMDRAASIAARRHSRRITVTASVNHVAFNQSVPVGSVVTVEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            + +  +TS+ +Y DVW   R   +    K  +A    VAVD+ G P  +
Sbjct: 78  AVSRAFRTSMEVYIDVWMEDR--FTGARSKANDAIYTFVAVDDAGKPTEV 125


>gi|124003055|ref|ZP_01687906.1| acyl-CoA thioester hydrolase 2 [Microscilla marina ATCC 23134]
 gi|123991705|gb|EAY31113.1| acyl-CoA thioester hydrolase  2 [Microscilla marina ATCC 23134]
          Length = 175

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 63/118 (53%), Gaps = 4/118 (3%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCR-VVTKAVTELLFEK 87
           S  + T+    +P D N   N+ GG +M  +DI CG  A+Q    R VVT +V  + F++
Sbjct: 9   SESLTTMTELVLPNDTNTLNNLMGGHLMYLMDI-CGAIAAQKHSNRIVVTASVDNISFKE 67

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           PI + D+V I   + +   +S+ +Y +V     N     +++T +A +  VAVD+ GN
Sbjct: 68  PIALGDVVTIKAHVSRAFNSSMEVYLEVTAG--NIPQGTMRETNKAFLTFVAVDQSGN 123


>gi|206561244|ref|YP_002232009.1| long-chain acyl-CoA thioester hydrolase [Burkholderia cenocepacia
           J2315]
 gi|198037286|emb|CAR53208.1| long-chain acyl-CoA thioester hydrolase [Burkholderia cenocepacia
           J2315]
          Length = 164

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    P+ VN  G V GG +M  ID    AC  + +S+ C    VT +V  + F++PI 
Sbjct: 12  FRFLAEPSSVNFGGKVHGGALMKWIDEVAYACAAVWSSRYC----VTVSVGNIRFQRPIL 67

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 68  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 120


>gi|153004055|ref|YP_001378380.1| thioesterase superfamily protein [Anaeromyxobacter sp. Fw109-5]
 gi|152027628|gb|ABS25396.1| thioesterase superfamily protein [Anaeromyxobacter sp. Fw109-5]
          Length = 159

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 4/108 (3%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  G  FGG +M   D+A G+ A +  +  VVT ++ +L F  P+++  +  +  
Sbjct: 18  MPGDANSLGTAFGGMVMQWTDLAAGMAAMRHARLPVVTASLDQLSFLAPVRIGHMAILVA 77

Query: 100 QIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +  +  TS+ +  +V T  PR       ++ C+A +  VA+D+ G P
Sbjct: 78  HVTAVFATSMEVNVEVSTEDPRTGER---RRCCDAYLTFVALDDAGRP 122


>gi|299541890|ref|ZP_07052213.1| putative acyl-CoA thioester hydrolase ykhA [Lysinibacillus
           fusiformis ZC1]
 gi|298725628|gb|EFI66269.1| putative acyl-CoA thioester hydrolase ykhA [Lysinibacillus
           fusiformis ZC1]
          Length = 159

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 58/107 (54%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N   ++FGG +++ ID    I A +  K  VVT ++  + F     V D++ I +
Sbjct: 20  LPPDTNNHNSIFGGRVLAYIDEIAAITAMKHAKGLVVTASIDSVDFLSAAHVGDILEIES 79

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +   G++S+ +Y  V +  RN  +   + T E+ V MVAV+E+G P
Sbjct: 80  IVSSTGRSSMEVYVRVVS--RNIETGEEKLTTESFVTMVAVNEEGKP 124


>gi|254252887|ref|ZP_04946205.1| Thioesterase superfamily [Burkholderia dolosa AUO158]
 gi|124895496|gb|EAY69376.1| Thioesterase superfamily [Burkholderia dolosa AUO158]
          Length = 184

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    P+ VN  G V GG +M  ID    AC  + +S+ C    VT +V  + F++PI 
Sbjct: 32  FRFLAEPSSVNFGGKVHGGALMKWIDEVAYACAAVWSSRYC----VTVSVGNIRFQRPIL 87

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 88  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 140


>gi|238926425|ref|ZP_04658185.1| possible acyl-CoA thioester hydrolase [Selenomonas flueggei ATCC
           43531]
 gi|238885829|gb|EEQ49467.1| possible acyl-CoA thioester hydrolase [Selenomonas flueggei ATCC
           43531]
          Length = 194

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 2/125 (1%)

Query: 25  CQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELL 84
           C+M  S ++  ++  MP+  N +GNV GG IM  +D A    A +  +  VVT  V EL 
Sbjct: 11  CKMKDSRIVISEV-MMPSQANPNGNVHGGEIMKLMDSAAYAAARRYARSNVVTARVDELE 69

Query: 85  FEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           F  PI++ DLV +   I  +G +S+ I  +V     +  SD  Q    A   MVA+D   
Sbjct: 70  FHLPIRIGDLVVVTADIVYVGHSSMEISVNVIVEDLDEGSDP-QLGLSAYFTMVALDRNA 128

Query: 145 NPKSI 149
            PK++
Sbjct: 129 RPKTV 133


>gi|127512536|ref|YP_001093733.1| thioesterase superfamily protein [Shewanella loihica PV-4]
 gi|126637831|gb|ABO23474.1| thioesterase superfamily protein [Shewanella loihica PV-4]
          Length = 162

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F KPI V 
Sbjct: 11  ITLRFLAEPADVNFGGKVHGGAVMKWIDLAAYACAAGWSGKYCITAYAGGIRFVKPIHVG 70

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++V +  ++   G+TS+ +  DV           L   C   V+MVAVD+ G P  +
Sbjct: 71  NIVEVGAKVIYTGRTSMHLGIDVKAGDPKHPERHLTTHC--IVIMVAVDDSGQPSPV 125


>gi|317154770|ref|YP_004122818.1| thioesterase superfamily protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316945021|gb|ADU64072.1| thioesterase superfamily protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 163

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  GN+ GG I+  ID   G+ A +  +  VVT ++  + F++P  + +L+    
Sbjct: 18  LPQDANPAGNLHGGVILRHIDTTAGVVAKRHTRGNVVTVSIDRMAFKQPAYMGELLTFKA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +  +G++S+ I   V     N  +  ++ T  A +  VA+D+ G P  +
Sbjct: 78  SLNHVGRSSMEIGVRVEA--ENLRTGEVRHTNSAYLTFVALDDNGKPTPV 125


>gi|197335317|ref|YP_002155965.1| acyl-CoA hydrolase [Vibrio fischeri MJ11]
 gi|197316807|gb|ACH66254.1| acyl-CoA hydrolase [Vibrio fischeri MJ11]
          Length = 161

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F +PI V 
Sbjct: 8   VTLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYASAAGWSGKYCITAYAGGIRFVEPIFVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G +S+ I  DV        ++ L   C   V+MVAVD  G P S+
Sbjct: 68  NLVEVTGKVIYTGTSSMHIAIDVQASDPKEQNNRLTTHC--IVIMVAVDGNGKPTSV 122


>gi|27367934|ref|NP_763461.1| acyl-CoA hydrolase [Vibrio vulnificus CMCP6]
 gi|37676061|ref|NP_936457.1| acyl-CoA hydrolase [Vibrio vulnificus YJ016]
 gi|320158205|ref|YP_004190583.1| acyl-CoA hydrolase [Vibrio vulnificus MO6-24/O]
 gi|27359507|gb|AAO08451.1|AE016813_203 Acyl-CoA hydrolase [Vibrio vulnificus CMCP6]
 gi|37200601|dbj|BAC96427.1| acyl-CoA hydrolase [Vibrio vulnificus YJ016]
 gi|319933517|gb|ADV88380.1| acyl-CoA hydrolase [Vibrio vulnificus MO6-24/O]
          Length = 161

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 55/118 (46%), Gaps = 2/118 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    ++       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACSAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           +LV +  ++   G TS+ I  DV         + L   C   V+MVAVDE G P  I+
Sbjct: 68  NLVEVSAKVIYTGTTSMHIAIDVQASDPKDLKNRLTTHC--IVIMVAVDENGQPTPIQ 123


>gi|78065674|ref|YP_368443.1| thioesterase superfamily protein [Burkholderia sp. 383]
 gi|77966419|gb|ABB07799.1| Thioesterase superfamily [Burkholderia sp. 383]
          Length = 170

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    P+ VN  G V GG +M  ID    AC  + +S+ C    VT +V  + F++PI 
Sbjct: 18  FRFLAEPSSVNFGGKVHGGALMKWIDEVAYACAAVWSSRYC----VTVSVGNIRFQRPIM 73

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           V +LV +  ++   G+TS+ I+  V     +    +L++T +  VV VAVDE GN
Sbjct: 74  VGNLVELKARVVATGRTSMHIHVSVHAG--DPKGGMLRQTTDCLVVFVAVDENGN 126


>gi|317121325|ref|YP_004101328.1| thioesterase superfamily protein [Thermaerobacter marianensis DSM
           12885]
 gi|315591305|gb|ADU50601.1| thioesterase superfamily protein [Thermaerobacter marianensis DSM
           12885]
          Length = 261

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  GN+ GG +M  +DIA  + A++  +   VT +V  + F  PI+V + + +  
Sbjct: 76  LPNDANPLGNILGGKVMHLMDIAGALAAARHSRRVCVTASVDRIDFLHPIRVGEAILVEA 135

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           Q+   G+TS+ +  +V++   N  +   + T  A    VA+DE G P  +
Sbjct: 136 QVTDAGRTSMEVRVNVYS--ENLRTGQRRHTATAFFTFVALDEHGRPTPV 183


>gi|297194023|ref|ZP_06911421.1| acyl-CoA hydrolase [Streptomyces pristinaespiralis ATCC 25486]
 gi|197722828|gb|EDY66736.1| acyl-CoA hydrolase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 205

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 54/103 (52%), Gaps = 1/103 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D NL G V GG IM  +D A G  A +      VT ++ E++F +P++V DLVH+  Q+
Sbjct: 54  SDTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRVGDLVHVKAQV 113

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
              G++S+ +   V     N S+   Q    A +V  AVD  G
Sbjct: 114 NWTGRSSMEVGVRVLAERWNESTPATQ-VGSAYLVFAAVDADG 155


>gi|311103538|ref|YP_003976391.1| thioesterase superfamily protein 1 [Achromobacter xylosoxidans A8]
 gi|310758227|gb|ADP13676.1| thioesterase superfamily protein 1 [Achromobacter xylosoxidans A8]
          Length = 167

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 60/120 (50%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ I   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI
Sbjct: 6   SHQLSMTILMTPDMANFSGNVHGGTILKYLDQVAYACASRYAGQYVVTLSVDQVVFREPI 65

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G+TS+ I   V T   +    +++ T      MVAVDE+G P ++
Sbjct: 66  HVGELVTFLAAVNYTGRTSMEIGIKVVT--EDIRKKLVRHTNSCYFTMVAVDEQGAPTAV 123


>gi|148974021|ref|ZP_01811554.1| putative acyl-CoA thioester hydrolase [Vibrionales bacterium
           SWAT-3]
 gi|145965718|gb|EDK30966.1| putative acyl-CoA thioester hydrolase [Vibrionales bacterium
           SWAT-3]
          Length = 167

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG  M  ID+A    ++       +T     + F  PI V 
Sbjct: 14  VTLRFLAEPGDVNFGGKVHGGAAMKWIDLAAYACSAGWSGKYCITAYAGGIRFVAPIHVG 73

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G +S+ I  DV        ++ L   C   V+MVAVDE GNP  +
Sbjct: 74  NLVEVSAKVIYTGSSSMHIAIDVQASDPKELNNRLTTHC--IVIMVAVDENGNPTKV 128


>gi|318078349|ref|ZP_07985681.1| putative acyl-CoA hydrolase [Streptomyces sp. SA3_actF]
          Length = 209

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 54/103 (52%), Gaps = 1/103 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           TD NL G   GG IM  +D A G  A +      VT ++ E++F +P+++ DLVH++ Q 
Sbjct: 31  TDTNLYGTGHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRIGDLVHVHAQC 90

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
              G+TS+ I   V     N S+   Q+   A +V  AVD  G
Sbjct: 91  NWTGRTSMEIGVRVMAERWNESTPA-QQVGTAYLVFAAVDAHG 132


>gi|84385358|ref|ZP_00988390.1| putative acyl-CoA thioester hydrolase [Vibrio splendidus 12B01]
 gi|84379955|gb|EAP96806.1| putative acyl-CoA thioester hydrolase [Vibrio splendidus 12B01]
          Length = 167

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG  M  ID+A    ++       +T     + F  PI V 
Sbjct: 14  VTLRFLAEPGDVNFGGKVHGGAAMKWIDLAAYACSAGWSGKYCITAYAGGIRFVAPIHVG 73

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G +S+ I  DV        ++ L   C   V+MVAVDE GNP  +
Sbjct: 74  NLVEVSAKVIYTGSSSMHIAIDVQASDPKELNNRLTTHC--IVIMVAVDENGNPTKV 128


>gi|260061227|ref|YP_003194307.1| thioesterase domain-containing protein [Robiginitalea biformata
           HTCC2501]
 gi|88785359|gb|EAR16528.1| thioesterase domain protein [Robiginitalea biformata HTCC2501]
          Length = 159

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P++ N   N+FGG +++++D A  I A +  +   VT +V  + F + I +  +V +  
Sbjct: 6   LPSETNPLNNLFGGELLARMDRAASIAARRHSRRITVTASVNHVAFNRSIPLGSVVTVEA 65

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            I +  +TS+ ++ DVW   R   S    K  EA    VAVD+ G P  +
Sbjct: 66  AISRTFRTSMEVFIDVWIEDR--FSGERDKANEAIYTFVAVDDTGIPTEV 113


>gi|221271516|dbj|BAH15068.1| acyl-CoA thioester hydrolase-related protein [Vibrio
           parahaemolyticus]
 gi|328469190|gb|EGF40136.1| acyl-CoA thioester hydrolase-like protein [Vibrio parahaemolyticus
           10329]
          Length = 161

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    ++       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACSAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G++S+ I  DV         + L   C   V+MVAVDE G P  +
Sbjct: 68  NLVEVSAKVIYTGRSSMHIAIDVQASDPKQMKNRLTTHC--IVIMVAVDESGKPTDV 122


>gi|15601694|ref|NP_233325.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae O1
           biovar eltor str. N16961]
 gi|121586669|ref|ZP_01676453.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae
           2740-80]
 gi|121726413|ref|ZP_01679687.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae V52]
 gi|147671854|ref|YP_001215139.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae O395]
 gi|153217129|ref|ZP_01950893.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae 1587]
 gi|153801407|ref|ZP_01955993.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae
           MZO-3]
 gi|153818305|ref|ZP_01970972.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae NCTC
           8457]
 gi|153821047|ref|ZP_01973714.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae B33]
 gi|153824770|ref|ZP_01977437.1| thioesterase family protein [Vibrio cholerae MZO-2]
 gi|153828017|ref|ZP_01980684.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae
           623-39]
 gi|227812507|ref|YP_002812517.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae
           M66-2]
 gi|254224753|ref|ZP_04918369.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae V51]
 gi|254284567|ref|ZP_04959534.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae
           AM-19226]
 gi|254850106|ref|ZP_05239456.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae MO10]
 gi|255746317|ref|ZP_05420264.1| acyl-CoA hydrolase [Vibrio cholera CIRS 101]
 gi|262158198|ref|ZP_06029316.1| acyl-CoA hydrolase [Vibrio cholerae INDRE 91/1]
 gi|262169203|ref|ZP_06036896.1| acyl-CoA hydrolase [Vibrio cholerae RC27]
 gi|297580009|ref|ZP_06941936.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298499716|ref|ZP_07009522.1| thioesterase [Vibrio cholerae MAK 757]
 gi|9658378|gb|AAF96837.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121549097|gb|EAX59132.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae
           2740-80]
 gi|121631161|gb|EAX63536.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae V52]
 gi|124113849|gb|EAY32669.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae 1587]
 gi|124123073|gb|EAY41816.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae
           MZO-3]
 gi|125622816|gb|EAZ51134.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae V51]
 gi|126511118|gb|EAZ73712.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae NCTC
           8457]
 gi|126521421|gb|EAZ78644.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae B33]
 gi|146314237|gb|ABQ18777.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae O395]
 gi|148876426|gb|EDL74561.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae
           623-39]
 gi|149741726|gb|EDM55755.1| thioesterase family protein [Vibrio cholerae MZO-2]
 gi|150425352|gb|EDN17128.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae
           AM-19226]
 gi|227011649|gb|ACP07860.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae
           M66-2]
 gi|227015588|gb|ACP11797.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae O395]
 gi|254845811|gb|EET24225.1| acyl-CoA thioester hydrolase-related protein [Vibrio cholerae MO10]
 gi|255736071|gb|EET91469.1| acyl-CoA hydrolase [Vibrio cholera CIRS 101]
 gi|262022484|gb|EEY41192.1| acyl-CoA hydrolase [Vibrio cholerae RC27]
 gi|262030076|gb|EEY48722.1| acyl-CoA hydrolase [Vibrio cholerae INDRE 91/1]
 gi|297535655|gb|EFH74489.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297541697|gb|EFH77748.1| thioesterase [Vibrio cholerae MAK 757]
 gi|327485917|gb|AEA80323.1| Acyl-CoA hydrolase [Vibrio cholerae LMA3894-4]
          Length = 162

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACAAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   GKTS+ I  DV         + L   C   V+MVAVDE G P  +
Sbjct: 68  NLVEVNAKVIYTGKTSMHIAIDVQASDPKFLKNHLTTHC--IVIMVAVDEAGKPSPV 122


>gi|295836972|ref|ZP_06823905.1| acyl-CoA hydrolase [Streptomyces sp. SPB74]
 gi|295826309|gb|EDY44364.2| acyl-CoA hydrolase [Streptomyces sp. SPB74]
          Length = 196

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 54/103 (52%), Gaps = 1/103 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           TD NL G   GG IM  +D A G  A +      VT ++ E++F +P+++ DLVH++ Q 
Sbjct: 45  TDTNLYGTGHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRIGDLVHVHAQC 104

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
              G+TS+ I   V    R   S   Q+   A +V  AVD +G
Sbjct: 105 NWTGRTSMEIGVRV-MAERWNESVPGQRVGTAYLVFTAVDAQG 146


>gi|258622538|ref|ZP_05717560.1| Acyl-CoA hydrolase [Vibrio mimicus VM573]
 gi|258625531|ref|ZP_05720420.1| Acyl-CoA hydrolase [Vibrio mimicus VM603]
 gi|262173402|ref|ZP_06041079.1| acyl-CoA hydrolase [Vibrio mimicus MB-451]
 gi|258582175|gb|EEW07035.1| Acyl-CoA hydrolase [Vibrio mimicus VM603]
 gi|258585238|gb|EEW09965.1| Acyl-CoA hydrolase [Vibrio mimicus VM573]
 gi|261890760|gb|EEY36747.1| acyl-CoA hydrolase [Vibrio mimicus MB-451]
          Length = 162

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACAAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   GKTS+ I  DV         + L   C   V+MVAVDE G P  +
Sbjct: 68  NLVEVNAKVIYTGKTSMHIAIDVQASDPKFLKNHLTTHC--IVIMVAVDEAGKPSPV 122


>gi|157375755|ref|YP_001474355.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Shewanella sediminis HAW-EB3]
 gi|157318129|gb|ABV37227.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Shewanella sediminis HAW-EB3]
          Length = 160

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 59/119 (49%), Gaps = 4/119 (3%)

Query: 32  VLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
            +TL+    P DVN  G V GG +M  ID+A    ++       +T     + F KPI V
Sbjct: 7   AITLRFLAEPADVNFGGKVHGGAVMKWIDLAAYACSAGWSGKYCITAYAGGIRFVKPIHV 66

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            ++V    ++   G++S+ +  DV    P+N+   +   T    V+MVAVD+ G+P  +
Sbjct: 67  GNIVETTAKVIYTGRSSMHLGIDVRAGDPKNSERHL---TTHCVVIMVAVDDAGHPTEV 122


>gi|91793642|ref|YP_563293.1| thioesterase superfamily protein [Shewanella denitrificans OS217]
 gi|91715644|gb|ABE55570.1| thioesterase superfamily [Shewanella denitrificans OS217]
          Length = 161

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 55/118 (46%), Gaps = 2/118 (1%)

Query: 32  VLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
            LTL+    P DVN  G V GG +M  ID+A    A+       +T     + F +PI V
Sbjct: 7   ALTLRFLAEPADVNFGGKVHGGAVMKWIDLAAYACAAGWSGKYCITVYAGGIRFVQPIHV 66

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            ++V +  ++   G TS+ +  DV       S   L   C   V+MVAVD+ G P  +
Sbjct: 67  GNIVEVNAKVIYTGTTSMHVALDVRAGDPKDSERHLTTHC--IVIMVAVDDGGKPSEV 122


>gi|218294714|ref|ZP_03495568.1| thioesterase superfamily protein [Thermus aquaticus Y51MC23]
 gi|151337009|gb|ABS00945.1| acyl-CoA thioesterase [Thermus aquaticus]
 gi|218244622|gb|EED11146.1| thioesterase superfamily protein [Thermus aquaticus Y51MC23]
          Length = 124

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  G  FGG+++  +D      A++  K  VVT AV  + F+ PI+  DL+ +  
Sbjct: 10  FPEHTNPLGAAFGGFVLGLMDKVGSYAAARRAKKPVVTVAVGSVEFKVPIRTGDLLEVVA 69

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ ++G+TS+T+  +V+      +  VL       +  VAV+E+G P
Sbjct: 70  KVVRVGRTSLTVEVEVYKERFGENGRVL--ATRGILTYVAVNERGEP 114


>gi|126665896|ref|ZP_01736877.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Marinobacter sp. ELB17]
 gi|126629830|gb|EBA00447.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Marinobacter sp. ELB17]
          Length = 161

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 56/116 (48%), Gaps = 2/116 (1%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
            S  LT+ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P
Sbjct: 4   GSATLTMTVLMTPDVANFSGNVHGGTLLKHLDEVAYACASRYAGAYVVTLSVDQVMFLQP 63

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           + V +LV     +   G+TS+ +   V T   N    +++ T      MVAVDE G
Sbjct: 64  VHVGELVTFLASVNYTGRTSMEVGIKVIT--ENIREKLVRHTNSCFFTMVAVDENG 117


>gi|330467225|ref|YP_004404968.1| thioesterase superfamily protein [Verrucosispora maris AB-18-032]
 gi|328810196|gb|AEB44368.1| thioesterase superfamily protein [Verrucosispora maris AB-18-032]
          Length = 170

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 60/111 (54%), Gaps = 13/111 (11%)

Query: 45  NLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKI 104
           NL G V GG I++ ID   G+ A++      VT A+ E  F + ++V D+VH+  +I   
Sbjct: 29  NLMGTVHGGRILNLIDSVAGVVAARHSDGPAVTAAIDETAFLRAVRVGDVVHVDARITWA 88

Query: 105 GKTS----VTIYCDVW--TCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           G++S    V +  D W    P    +DV      A +VMVA+D+ G+P+++
Sbjct: 89  GRSSMEVAVKVTADRWDRAVP---PTDV----ATAHLVMVAIDDDGHPRAV 132


>gi|157962311|ref|YP_001502345.1| thioesterase superfamily protein [Shewanella pealeana ATCC 700345]
 gi|157847311|gb|ABV87810.1| thioesterase superfamily protein [Shewanella pealeana ATCC 700345]
          Length = 166

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LTL+    P DVN  G V GG +M  ID+A    A+       +T     + F KPI V 
Sbjct: 8   LTLRFLAEPADVNFGGKVHGGAVMKWIDLAGYACAAGWSGKYCITAYAGGIRFVKPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++V +  ++   G+TS+ +  DV           L   C   +VMVAVD+ G P  +
Sbjct: 68  NIVEVTAKVIYTGRTSMHLGVDVKAGDPKFQDRHLTTHC--VLVMVAVDDDGQPTEV 122


>gi|269962844|ref|ZP_06177184.1| Acyl-CoA hydrolase [Vibrio harveyi 1DA3]
 gi|269832398|gb|EEZ86517.1| Acyl-CoA hydrolase [Vibrio harveyi 1DA3]
          Length = 161

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    ++       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACSAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G++S+ I  DV         + L   C   V+MVAVDE G P  +
Sbjct: 68  NLVEVSAKVIYTGRSSMHIAIDVQASDPKELKNRLTTHC--IVIMVAVDEDGKPTDV 122


>gi|262371980|ref|ZP_06065259.1| thioesterase superfamily protein [Acinetobacter junii SH205]
 gi|262312005|gb|EEY93090.1| thioesterase superfamily protein [Acinetobacter junii SH205]
          Length = 173

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 59/117 (50%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V 
Sbjct: 17  LTMSVLMTPDMANFSGNVHGGAILKLLDQVAYACASRYSGSYVVTLSVDKVNFKEPIYVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +  +G+TS+ I   V    +N     ++ T      MVAVDE+  PK++
Sbjct: 77  ELVTFLASVNHVGRTSMEIGIRVEA--QNIQKRTIRHTNTCYFTMVAVDEQRQPKAV 131


>gi|229505919|ref|ZP_04395428.1| acyl-CoA hydrolase [Vibrio cholerae BX 330286]
 gi|229510227|ref|ZP_04399707.1| acyl-CoA hydrolase [Vibrio cholerae B33]
 gi|229514354|ref|ZP_04403815.1| acyl-CoA hydrolase [Vibrio cholerae TMA 21]
 gi|229517643|ref|ZP_04407088.1| acyl-CoA hydrolase [Vibrio cholerae RC9]
 gi|229522466|ref|ZP_04411882.1| acyl-CoA hydrolase [Vibrio cholerae TM 11079-80]
 gi|229526508|ref|ZP_04415912.1| acyl-CoA hydrolase [Vibrio cholerae bv. albensis VL426]
 gi|229528159|ref|ZP_04417550.1| acyl-CoA hydrolase [Vibrio cholerae 12129(1)]
 gi|229605451|ref|YP_002876155.1| acyl-CoA hydrolase [Vibrio cholerae MJ-1236]
 gi|229334521|gb|EEO00007.1| acyl-CoA hydrolase [Vibrio cholerae 12129(1)]
 gi|229336666|gb|EEO01684.1| acyl-CoA hydrolase [Vibrio cholerae bv. albensis VL426]
 gi|229340451|gb|EEO05457.1| acyl-CoA hydrolase [Vibrio cholerae TM 11079-80]
 gi|229345679|gb|EEO10652.1| acyl-CoA hydrolase [Vibrio cholerae RC9]
 gi|229348334|gb|EEO13292.1| acyl-CoA hydrolase [Vibrio cholerae TMA 21]
 gi|229352672|gb|EEO17612.1| acyl-CoA hydrolase [Vibrio cholerae B33]
 gi|229356270|gb|EEO21188.1| acyl-CoA hydrolase [Vibrio cholerae BX 330286]
 gi|229371937|gb|ACQ62359.1| acyl-CoA hydrolase [Vibrio cholerae MJ-1236]
          Length = 167

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F  PI V 
Sbjct: 13  ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACAAAWSGKYCITAYAGGIRFVAPIHVG 72

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   GKTS+ I  DV         + L   C   V+MVAVDE G P  +
Sbjct: 73  NLVEVNAKVIYTGKTSMHIAIDVQASDPKFLKNHLTTHC--IVIMVAVDEAGKPSPV 127


>gi|261250817|ref|ZP_05943391.1| acyl-CoA hydrolase [Vibrio orientalis CIP 102891]
 gi|260937690|gb|EEX93678.1| acyl-CoA hydrolase [Vibrio orientalis CIP 102891]
          Length = 161

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F +PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYANAAAWSGKYCITAYAGGIRFVQPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   GK+S+ I  DV         + L   C   V+MVAVDE G P  +
Sbjct: 68  NLVEVSAKVIYTGKSSMHIAIDVQASDPKELKNRLTTHC--IVIMVAVDENGKPTEV 122


>gi|330465860|ref|YP_004403603.1| thioesterase superfamily protein [Verrucosispora maris AB-18-032]
 gi|328808831|gb|AEB43003.1| thioesterase superfamily protein [Verrucosispora maris AB-18-032]
          Length = 171

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 57/108 (52%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           DVNL G V GG +M  +D   G  A++      VT A+ E++F + ++V DLVH Y Q+ 
Sbjct: 28  DVNLYGTVHGGVLMKFVDDVAGAAAARHSGGTAVTAAIDEIVFSEAVRVGDLVHAYAQVN 87

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
             G+TS+ I   V     +++     +   A +V V V+  G P+ +R
Sbjct: 88  WTGQTSMEIGVRVMAERWDSAEQEPVRVATAYLVFVGVEVGGAPRPVR 135


>gi|260551158|ref|ZP_05825361.1| thioesterase superfamily protein [Acinetobacter sp. RUH2624]
 gi|260405763|gb|EEW99252.1| thioesterase superfamily protein [Acinetobacter sp. RUH2624]
          Length = 165

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V 
Sbjct: 11  LTMSVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYSGSYVVTLSVDKVNFKEPIYVG 70

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +  +G+TS+ +   V    +N     ++ T      MV+VDE G P+ +
Sbjct: 71  ELVTFLASVNHVGRTSMEVGIRVEA--QNIQKRTVRHTNSCYFTMVSVDENGKPREV 125


>gi|262403020|ref|ZP_06079580.1| acyl-CoA hydrolase [Vibrio sp. RC586]
 gi|262350519|gb|EEY99652.1| acyl-CoA hydrolase [Vibrio sp. RC586]
          Length = 162

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACAAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   GKTS+ I  DV         + L   C   V+MVAVDE G P  +
Sbjct: 68  NLVEVNAKVIYTGKTSMHIAIDVQASDPKCLKNHLTTHC--IVIMVAVDEAGKPSPV 122


>gi|332531583|ref|ZP_08407480.1| thioesterase superfamily protein [Hylemonella gracilis ATCC 19624]
 gi|332038946|gb|EGI75375.1| thioesterase superfamily protein [Hylemonella gracilis ATCC 19624]
          Length = 146

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P+ VN  G V GG +M  ID A    A+   K   VT  V  + F +PI + 
Sbjct: 4   ITLRFLAEPSTVNYGGKVHGGTVMKWIDEAGYACATSWAKRYCVTVYVGGIRFHRPIMIG 63

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           DLV +  ++   G TS+ I  +V +      +  L+ T E  +V V+VD  G P
Sbjct: 64  DLVEVEAKLAYTGSTSMNISVEVRSGDMKGGN--LETTTECLIVFVSVDSHGKP 115


>gi|311032820|ref|ZP_07710910.1| Thioesterase family protein [Bacillus sp. m3-13]
          Length = 170

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 2/112 (1%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           +  P D+N    +FGG ++S +D+   I A+++C+C  VT ++  + F  PI+ +D V  
Sbjct: 15  RVFPNDINNHDTLFGGKLLSDVDMLASISAARMCRCECVTASMDSVDFLSPIRPTDAVIF 74

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            + +   G +S+ ++  V     N +         A +  VA+DE+G P  +
Sbjct: 75  ESYVTWTGNSSMEVFVKV--TAENLTKGTRTIAATAFLTFVALDEQGKPAPV 124


>gi|261212981|ref|ZP_05927265.1| acyl-CoA hydrolase [Vibrio sp. RC341]
 gi|260838046|gb|EEX64723.1| acyl-CoA hydrolase [Vibrio sp. RC341]
          Length = 167

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 54/114 (47%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F  PI V 
Sbjct: 13  ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACAAAWSGKYCITAYAGGIRFVAPIHVG 72

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +LV +  ++   GKTS+ I  DV         + L   C   V+MVAVDE G P
Sbjct: 73  NLVEVNAKVIYTGKTSMHIAIDVQASDPKFLKNHLTTHC--IVIMVAVDEAGKP 124


>gi|325103822|ref|YP_004273476.1| thioesterase superfamily protein [Pedobacter saltans DSM 12145]
 gi|324972670|gb|ADY51654.1| thioesterase superfamily protein [Pedobacter saltans DSM 12145]
          Length = 170

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 2/105 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N+  N+ GG ++  +DIA GI A + C    VT +V  + F  P+++ D++ I  
Sbjct: 19  LPNDTNMLHNLMGGRLLHWMDIAAGISAQRHCNNIAVTASVDNVSFRNPVKLGDVITIQA 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           ++ +   TS+ +   V+    N  S    K+ EA    VA++E G
Sbjct: 79  KVTRSFNTSMEVRITVYA--ENIPSGSKVKSNEAFYTFVALNENG 121


>gi|209521799|ref|ZP_03270480.1| thioesterase superfamily protein [Burkholderia sp. H160]
 gi|209497769|gb|EDZ97943.1| thioesterase superfamily protein [Burkholderia sp. H160]
          Length = 168

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (51%), Gaps = 10/120 (8%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPI 89
           T +    PT VN  G V GG +M  ID    AC  + + + C    VT +V  + F +PI
Sbjct: 15  TFRFLAEPTSVNFGGKVHGGALMKWIDETAYACAAVWSGRYC----VTVSVGNIRFRRPI 70

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV +  ++   G+TS+ I+  V     +     L +T +  VVMVAV+E G+P ++
Sbjct: 71  LVGNLVELRARVVATGRTSMHIHVSVQAG--DPKGGELLQTTDCLVVMVAVNENGHPVAV 128


>gi|257454840|ref|ZP_05620091.1| thioesterase family protein [Enhydrobacter aerosaccus SK60]
 gi|257447773|gb|EEV22765.1| thioesterase family protein [Enhydrobacter aerosaccus SK60]
          Length = 170

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 66/138 (47%), Gaps = 4/138 (2%)

Query: 12  LINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLC 71
           + N +  ++ L V  + +   LT+ +   P   N  GNV GG ++  +D      AS+  
Sbjct: 1   MANSVELQQNLQVAPLQNE--LTMSVLMTPDLANFTGNVHGGDLLKMLDQVAYACASRYS 58

Query: 72  KCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC 131
              VVT +V +++F +PI V +LV     +  +GKTS+ +   V     N  +  ++ T 
Sbjct: 59  GSYVVTLSVDQVIFREPIHVGELVTFLASVNYVGKTSMEVGIRVQA--ENIQNRTIRHTN 116

Query: 132 EATVVMVAVDEKGNPKSI 149
                MVAVD+ G P  +
Sbjct: 117 SCYFTMVAVDKYGKPTRV 134


>gi|119715633|ref|YP_922598.1| thioesterase superfamily protein [Nocardioides sp. JS614]
 gi|119536294|gb|ABL80911.1| thioesterase superfamily protein [Nocardioides sp. JS614]
          Length = 172

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 54/117 (46%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           ++L I T   + NL GN+ GG I    D   G  A++      VT  + E+ F +P+ V 
Sbjct: 17  VSLAIVTSSAEANLLGNIHGGEIAKLADSTAGAVAARHSGGPAVTAVMDEMAFLEPVHVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           D+V    Q+   G++S+ I   V T P N  S        A  V VA+D  G  + +
Sbjct: 77  DIVRTLAQVNWAGRSSMEIGVRVETQPWNDPSTTSLHVASAYFVFVAIDGAGRARRV 133


>gi|238062801|ref|ZP_04607510.1| thioesterase [Micromonospora sp. ATCC 39149]
 gi|237884612|gb|EEP73440.1| thioesterase [Micromonospora sp. ATCC 39149]
          Length = 180

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 57/108 (52%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           DVNL G V GG +M  +D   G  A++      VT A+ E++F + ++V DLVH + Q+ 
Sbjct: 37  DVNLYGTVHGGVLMKFVDDVAGAAAARHSGGTAVTAAIDEIVFSEAVRVGDLVHAHAQVN 96

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
             G+TS+ +   V     +++ D       A +V V VD  G P+ +R
Sbjct: 97  WTGQTSMEVGVRVVAERWDSAEDEPVPVATAYLVFVGVDVGGAPRPVR 144


>gi|23893326|emb|CAC79957.1| P14 protein [Pantoea agglomerans]
          Length = 74

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (63%)

Query: 31 GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
          G + L+   MP D N +G++FGGW+MSQ+D+   I A ++ + RVVT  V  + F KP
Sbjct: 10 GEMVLRTLAMPADTNANGDIFGGWLMSQMDMGGAILAKEIAEGRVVTVRVDGMSFMKP 67


>gi|327403644|ref|YP_004344482.1| thioesterase superfamily protein [Fluviicola taffensis DSM 16823]
 gi|327319152|gb|AEA43644.1| thioesterase superfamily protein [Fluviicola taffensis DSM 16823]
          Length = 170

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 61/116 (52%), Gaps = 5/116 (4%)

Query: 34  TLKIQT---MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           TL I T   +P D N  GN+FGG +++ +D    + A +  +  VVT +V  + F  PI 
Sbjct: 9   TLAITTKVVLPNDTNTLGNLFGGQLLAWMDEIASVSAHRHSRRVVVTASVNNVSFNSPIN 68

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            + +V + +++ +   +S+ ++ DV+    +  +    K+ EA    VAVD+ G P
Sbjct: 69  HASIVTLESKVSRAFNSSMEVFVDVFV--EDHITGKRSKSNEAIYTFVAVDQNGGP 122


>gi|315426662|dbj|BAJ48288.1| thioesterase superfamily protein [Candidatus Caldiarchaeum
           subterraneum]
          Length = 333

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 58/121 (47%), Gaps = 10/121 (8%)

Query: 36  KIQTMPTDVNLDGNVFGG----WIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
           +   MP D N  G + GG    W++S   + CG+R     K  VV  A+ +L F  P+ V
Sbjct: 13  RFFVMPHDSNAIGRLHGGVLMEWMVSAAAL-CGVR---FSKGEVVLAALDDLFFMNPVSV 68

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
            D+V +   +   G +S+ +    +  PR     +L  T    +V VAVD  G+P+ + T
Sbjct: 69  GDMVVVKAWVEYSGHSSMEVGVSAYAYPRIVGEPMLTTTSH--MVFVAVDRTGSPRPLPT 126

Query: 152 E 152
           +
Sbjct: 127 K 127



 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 46/105 (43%), Gaps = 2/105 (1%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D  + G + GG ++  +D   G  A    +   VT AV    F  PI+   +V +   +
Sbjct: 182 SDATMGGIMSGGKLLHLLDEMAGAVAISYARTVAVTGAVDSTSFHYPIRQGSIVDVELVL 241

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
             +G++S  +   V T   N SS V +        MVAVD  G P
Sbjct: 242 TGVGRSSAEVAAKVIT--ENPSSGVRRHAATTFFTMVAVDSAGKP 284


>gi|327404667|ref|YP_004345505.1| thioesterase superfamily protein [Fluviicola taffensis DSM 16823]
 gi|327320175|gb|AEA44667.1| thioesterase superfamily protein [Fluviicola taffensis DSM 16823]
          Length = 150

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 56/103 (54%), Gaps = 3/103 (2%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKC-RVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           D+ +  N+FGG +MS ID A G  ASQ+C    +VT  V EL+F+K ++   ++ +Y ++
Sbjct: 15  DIGIHNNMFGGKLMSLIDDAAGSFASQICDSPNMVTIKVDELVFKKAVKSGSILKVYGKV 74

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
            + G +S+ +Y ++     N  +          +  V +DE+G
Sbjct: 75  LRFGNSSIEMYMEIR--KHNVYTGNQDLVTHTNMTFVRIDEEG 115


>gi|86141092|ref|ZP_01059651.1| acyl-CoA hydrolase [Leeuwenhoekiella blandensis MED217]
 gi|85833034|gb|EAQ51483.1| acyl-CoA hydrolase [Leeuwenhoekiella blandensis MED217]
          Length = 169

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P + N   N+FGG +++++D    I A +  +  VVT +V  + F K I +  +V +  
Sbjct: 18  LPNETNPLNNMFGGELLARMDRVASITARRHSRRIVVTASVNHVAFNKAIPLGSVVTVEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            I +  KTS+ +  DVW   R   + +  K  +A    VAVDE G P
Sbjct: 78  SISRAFKTSMEVVIDVWVEDR--ENGLKSKANDAIYTFVAVDETGMP 122


>gi|89889647|ref|ZP_01201158.1| cytosolic acyl coenzyme A thioester hydrolase [Flavobacteria
           bacterium BBFL7]
 gi|89517920|gb|EAS20576.1| cytosolic acyl coenzyme A thioester hydrolase [Flavobacteria
           bacterium BBFL7]
          Length = 170

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 62/124 (50%), Gaps = 2/124 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           M  +  S    T+    +P++ N   N+FGG +++++D A  I A +  +  VVT +V  
Sbjct: 1   MEAKTPSQSFTTVTDMVLPSETNPLNNLFGGELLARMDRAASIAARRHSRRIVVTASVNH 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + F + + +  +V I  ++ +   +S+ ++ +VW   R +      +  EA    VAVDE
Sbjct: 61  VAFNRMVPLGSVVTIEAKVTRAFTSSMEVHMNVWIEDRESGEKT--QANEAIYTFVAVDE 118

Query: 143 KGNP 146
            G P
Sbjct: 119 TGRP 122


>gi|315428015|dbj|BAJ49604.1| thioesterase superfamily protein [Candidatus Caldiarchaeum
           subterraneum]
          Length = 333

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 58/121 (47%), Gaps = 10/121 (8%)

Query: 36  KIQTMPTDVNLDGNVFGG----WIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
           +   MP D N  G + GG    W++S   + CG+R     K  VV  A+ +L F  P+ V
Sbjct: 13  RFFVMPHDSNAIGRLHGGVLMEWMVSAAAL-CGVR---FSKGEVVLAALDDLFFMNPVSV 68

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
            D+V +   +   G +S+ +    +  PR     +L  T    +V VAVD  G+P+ + T
Sbjct: 69  GDMVVVKAWVEYSGHSSMEVGVSAYAYPRIVGEPMLTTTSH--MVFVAVDRTGSPRPLPT 126

Query: 152 E 152
           +
Sbjct: 127 K 127



 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 47/106 (44%), Gaps = 2/106 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P+D  + G + GG ++  +D   G  A    +   VT AV    F  PI+   +V +   
Sbjct: 181 PSDATMGGIMSGGKLLHLLDEMAGAVAISYARTVAVTGAVDSTSFHYPIRQGSIVDVELV 240

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +  +G++S  +   V T   N SS V +        MVAVD  G P
Sbjct: 241 LTGVGRSSAEVAAKVIT--ENPSSGVRRHAATTFFTMVAVDSAGKP 284


>gi|226952430|ref|ZP_03822894.1| acyl-CoA thioester hydrolase [Acinetobacter sp. ATCC 27244]
 gi|294649719|ref|ZP_06727127.1| acyl-CoA thioester hydrolase [Acinetobacter haemolyticus ATCC
           19194]
 gi|226836882|gb|EEH69265.1| acyl-CoA thioester hydrolase [Acinetobacter sp. ATCC 27244]
 gi|292824398|gb|EFF83193.1| acyl-CoA thioester hydrolase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 171

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V 
Sbjct: 17  LTMSVLMTPDMANFSGNVHGGAILKLLDQVAYACASRYSGSYVVTLSVDKVNFKEPIYVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     I  +G+TS+ +   V    +N     ++ T      MVAVDE+  PK +
Sbjct: 77  ELVTFLASINHVGRTSMEVGIRVEA--QNIQDRTIRHTNTCYFTMVAVDEERKPKQV 131


>gi|209967047|ref|YP_002299962.1| acyl-CoA thioester hydrolase, putative [Rhodospirillum centenum SW]
 gi|209960513|gb|ACJ01150.1| acyl-CoA thioester hydrolase, putative [Rhodospirillum centenum SW]
          Length = 142

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 59/122 (48%), Gaps = 7/122 (5%)

Query: 31  GVLTLKIQT-MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           G  T+ ++T  P   N  G +FGG  +S +  A  + AS+   C VV  A   + F +P+
Sbjct: 18  GRATVLLETVFPDASNHYGTLFGGHALSLMGRAAYMAASRRAGCNVVMAATDAVRFHRPV 77

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCD-VWTCPRNAS-SDVLQKTCEATVVMVAVDEKGNPK 147
            V  L+ +  ++ + G++S+T+  D V   P      DVL    E    MVAVD  G P+
Sbjct: 78  PVGHLLELTARVVRTGRSSLTVQVDGVSEAPAGGPRHDVLSGRFE----MVAVDAHGRPR 133

Query: 148 SI 149
             
Sbjct: 134 PF 135


>gi|293608954|ref|ZP_06691257.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829527|gb|EFF87889.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325121273|gb|ADY80796.1| putative acyl-CoA thioester hydrolase [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 171

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V 
Sbjct: 17  LTMSVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYSGGYVVTLSVDKVNFKEPIYVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +LV     +  +G+TS+ +   V    +N     ++ T      MVAVDE+G P
Sbjct: 77  ELVTFLASVNHVGRTSMEVGIRVEA--QNIQKRTVRHTNSCYFTMVAVDEQGKP 128


>gi|294636577|ref|ZP_06714940.1| long-chain acyl-CoA thioester hydrolase family protein
           [Edwardsiella tarda ATCC 23685]
 gi|291090195|gb|EFE22756.1| long-chain acyl-CoA thioester hydrolase family protein
           [Edwardsiella tarda ATCC 23685]
          Length = 137

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 59/114 (51%), Gaps = 10/114 (8%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            PT +N    +FGG  ++ +D    I A++ C+ R+VT +   + F+ PI    +V +  
Sbjct: 28  FPTTINHHSTLFGGTALAWMDEVAFITATRFCRKRLVTVSTERINFQHPIPSGSIVELVG 87

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATV----VMVAVDEKGNPKSI 149
           ++ ++G+TS+T+   ++        D+  + CE  +      VAVD+ G P+ +
Sbjct: 88  RVTRVGRTSLTVSVTIFL------EDMYHEGCEEVINGQFNFVAVDDDGRPQPL 135


>gi|284035472|ref|YP_003385402.1| thioesterase superfamily protein [Spirosoma linguale DSM 74]
 gi|283814765|gb|ADB36603.1| thioesterase superfamily protein [Spirosoma linguale DSM 74]
          Length = 171

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N   N+ GG ++  +DIA  I A +     VVT +V  + F +PI++ ++V +  
Sbjct: 19  LPNDTNTLNNLMGGRLLHFMDIAAAIAAQKHSNRIVVTASVDNVSFSEPIRLGNIVTMKA 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           Q+ +   +S+ ++ +VW    +  + +   T  A    VAVD+ G P
Sbjct: 79  QVTRAFSSSMEVFIEVWA--EDIPAGIRVSTNSAYYTFVAVDQSGRP 123


>gi|299771173|ref|YP_003733199.1| Thioesterase superfamily protein [Acinetobacter sp. DR1]
 gi|298701261|gb|ADI91826.1| Thioesterase superfamily protein [Acinetobacter sp. DR1]
          Length = 171

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V 
Sbjct: 17  LTMSVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYSGGYVVTLSVDKVNFKEPIYVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +LV     +  +G+TS+ +   V    +N     ++ T      MVAVDE+G P
Sbjct: 77  ELVTFLASVNHVGRTSMEVGIRVEA--QNIQKRTVRHTNSCYFTMVAVDEQGKP 128


>gi|254505811|ref|ZP_05117957.1| acyl-CoA hydrolase [Vibrio parahaemolyticus 16]
 gi|219551464|gb|EED28443.1| acyl-CoA hydrolase [Vibrio parahaemolyticus 16]
          Length = 161

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F +PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYANAAAWSGKYCITAYAGGIRFVQPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G++S+ I  DV         + L   C   V+MVAVDE G P  +
Sbjct: 68  NLVEVSAKVIYTGRSSMHIAIDVQASDPKELKNRLTTHC--IVIMVAVDEHGKPTDV 122


>gi|94970280|ref|YP_592328.1| thioesterase superfamily protein [Candidatus Koribacter versatilis
           Ellin345]
 gi|94552330|gb|ABF42254.1| thioesterase superfamily [Candidatus Koribacter versatilis
           Ellin345]
          Length = 169

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 52/105 (49%), Gaps = 2/105 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  G++ GG +M  IDI+  + A + C+  VVT ++  L F  P+QV DLV   +
Sbjct: 23  LPNDANPLGHLLGGRLMHWIDISGALAAHRHCRNYVVTASIDHLDFLVPVQVGDLVVFQS 82

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
            + +   TS+ I   V     N  +   Q    A +  VAVD  G
Sbjct: 83  SVNRAFNTSMEIGVKVLV--ENYIASTRQHVSSAYLTFVAVDRHG 125


>gi|270160398|ref|ZP_06189044.1| thioesterase family protein [Legionella longbeachae D-4968]
 gi|289163376|ref|YP_003453514.1| thioesterase family protein [Legionella longbeachae NSW150]
 gi|269987086|gb|EEZ93351.1| thioesterase family protein [Legionella longbeachae D-4968]
 gi|288856549|emb|CBJ10346.1| putative thioesterase family protein [Legionella longbeachae
           NSW150]
          Length = 129

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 60/112 (53%), Gaps = 12/112 (10%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P  VN  G +FGG  +  +D+A  I A++  +  VVT A  ++ F+ P++V +L+ +  
Sbjct: 16  FPNQVNHVGTLFGGHALEWMDMAASIAATRFTRSTVVTVASDKIEFKVPVKVGELIDLVA 75

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVL----QKTC-EATVVMVAVDEKGNP 146
            + + GKTS+T+   ++       S++L    +K C E    MVAVD   NP
Sbjct: 76  VVERHGKTSLTVDVKMF-------SEILITGERKLCTEGKFTMVAVDSDMNP 120


>gi|312131723|ref|YP_003999063.1| thioesterase superfamily protein [Leadbetterella byssophila DSM
           17132]
 gi|311908269|gb|ADQ18710.1| thioesterase superfamily protein [Leadbetterella byssophila DSM
           17132]
          Length = 176

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 57/107 (53%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N   N+ GG +M  +DIA  I A +     VVT +V  + F  PI + +++ +  
Sbjct: 19  LPNDTNTLSNLMGGNLMRLVDIAGAICAQKHSNRIVVTASVDHVSFVNPIPLGNVITLEA 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +I +   TS+ +  DV++   N  +   +KT +A +  VAVD+ G P
Sbjct: 79  KITRAFNTSMEVVVDVYS--ENIPAGTKKKTNQAFLTFVAVDQSGRP 123


>gi|300775323|ref|ZP_07085185.1| thioesterase domain protein [Chryseobacterium gleum ATCC 35910]
 gi|300506063|gb|EFK37199.1| thioesterase domain protein [Chryseobacterium gleum ATCC 35910]
          Length = 180

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 8/110 (7%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P + N   N+FGG +++++D    I A++ C+ RVVT +V  + F  PI    +V + +
Sbjct: 19  LPNETNSLRNLFGGELLAKMDRCASISAARHCERRVVTASVNHVSFNHPIPEGGVVVLES 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQK---TCEATVVMVAVDEKGNP 146
           ++ +   TS+ +Y DVW         + QK   T       VAVDE   P
Sbjct: 79  KVSRAFSTSMEVYVDVWL-----DDPINQKKVHTNAGIYTFVAVDEFNRP 123


>gi|116619277|ref|YP_821433.1| thioesterase superfamily protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116222439|gb|ABJ81148.1| thioesterase superfamily protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 158

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 58/106 (54%), Gaps = 2/106 (1%)

Query: 39  TMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIY 98
            +P D N  GNV GG +M  +D+A  +   +  +  VVT +V  L F  P+++ +L+ + 
Sbjct: 17  ALPNDANGFGNVLGGKVMHLVDLAAAMAGMRHARNPVVTASVDSLQFLHPVRIGELIMLR 76

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           + + ++ ++S+ I   V T  +  + + L  TC A +  VA+D +G
Sbjct: 77  SSVNRVFRSSMEIGVKVMT-EKLLTGERLH-TCSAYLTFVAIDREG 120


>gi|226311723|ref|YP_002771617.1| hypothetical protein BBR47_21360 [Brevibacillus brevis NBRC 100599]
 gi|226094671|dbj|BAH43113.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 169

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 2/109 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P+D N  G +FGG +M+ ID    I A +  +  VVT ++  + F  P+++   + +   
Sbjct: 19  PSDTNYHGTIFGGTMMAYIDEVAAIAAMRHSRRPVVTASIDSIDFLAPVKMGHSICLEAF 78

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +   GKTS+ I+  V +        +L  T  + +  VA+DE+GNP  +
Sbjct: 79  VSSTGKTSMEIFVKVVSENLQTGKRIL--TATSFLTFVALDEEGNPTEV 125


>gi|300778777|ref|ZP_07088635.1| thioesterase [Chryseobacterium gleum ATCC 35910]
 gi|300504287|gb|EFK35427.1| thioesterase [Chryseobacterium gleum ATCC 35910]
          Length = 155

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 57/112 (50%), Gaps = 2/112 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +T +  + P+DVN  GNV GG +M  ID A    A+       VT  V  + F  PI++ 
Sbjct: 6   ITFQFISEPSDVNYGGNVHGGSVMKWIDQAGYACATTWSGNYSVTVYVGGIRFYDPIKIG 65

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           ++V +  Q+   G +S+ I  +V++  RN      +K     +V VAVDE G
Sbjct: 66  EVVKVDAQVIYTGTSSMHIAINVFS--RNLKQPNFEKKTHCIIVFVAVDENG 115


>gi|262202801|ref|YP_003274009.1| thioesterase superfamily protein [Gordonia bronchialis DSM 43247]
 gi|262086148|gb|ACY22116.1| thioesterase superfamily protein [Gordonia bronchialis DSM 43247]
          Length = 319

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 57/115 (49%), Gaps = 2/115 (1%)

Query: 36  KIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLV 95
           +    PTDVN  GN  GG +M  +D +  + A++ C  R VT  V  + F  PI + D+V
Sbjct: 172 RFLAAPTDVNWGGNAHGGRVMEWMDESAYLNAARWCGRRCVTAYVGGIRFYAPIHIGDVV 231

Query: 96  HIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
            +  ++   GK ++ I   V     N     ++    + +++ AVD+ G+  ++R
Sbjct: 232 ELDARLIHTGKQTMHISVHVRAG--NPHDGEMRDCAHSLMIVAAVDDNGDATAVR 284



 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (47%), Gaps = 7/120 (5%)

Query: 33  LTLKIQTMPTDVN-LDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
           +TL+    PTD   + G+V GG ++S ID A    A+       VT     + F + I+ 
Sbjct: 9   ITLRFLAAPTDATTIGGDVRGGRLLSWIDKAAYACAATWSGGYSVTAYFGNITFTRGIEP 68

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTCPRNAS--SDVLQKTCEATVVMVAVDEKGNPKSI 149
            D+V +   I   G +S+ I+C V    R+AS  + +     E  V+ VA+ E   P+ +
Sbjct: 69  GDIVEVTATIIHTGTSSMHIHCSV----RSASPHTGLFTVASECLVIFVAMGEDRRPRPV 124


>gi|218296961|ref|ZP_03497647.1| thioesterase superfamily protein [Thermus aquaticus Y51MC23]
 gi|218242664|gb|EED09200.1| thioesterase superfamily protein [Thermus aquaticus Y51MC23]
          Length = 119

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 60/108 (55%), Gaps = 3/108 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P + N  G +FGG +++ +D A  + A++  K +VVT     + F++P+ +  +V +  
Sbjct: 6   FPGETNHYGTLFGGTVLAWMDQAAFVAATRHAKRKVVTVHADAVDFKRPVPLGAIVELVA 65

Query: 100 QIRKIGKTSVTIYCDVWTCP-RNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++  +G+TS+ +  ++W  P +   +  L    +   ++VA+DE+G P
Sbjct: 66  RVVGVGRTSMRVEVEMWVEPIQEGETPYL--AAKGGFILVALDERGRP 111


>gi|33603608|ref|NP_891168.1| putative acyl-CoA thioester hydrolase [Bordetella bronchiseptica
           RB50]
 gi|33577733|emb|CAE34998.1| putative acyl-CoA thioester hydrolase [Bordetella bronchiseptica
           RB50]
          Length = 171

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ I   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI
Sbjct: 6   SHQLSMTILMTPDMANFSGNVHGGTILKYLDQVAYACASRYAGQYVVTLSVDQVVFREPI 65

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G+TS+ I   V T   +    +++ T      MVAVD+ G P ++
Sbjct: 66  HVGELVTFLASVNYTGRTSMEIGIKVVT--EDIRRKLVRHTNSCYFTMVAVDDNGQPTAV 123


>gi|323499275|ref|ZP_08104252.1| acyl-CoA thioester hydrolase-like protein [Vibrio sinaloensis DSM
           21326]
 gi|323315663|gb|EGA68697.1| acyl-CoA thioester hydrolase-like protein [Vibrio sinaloensis DSM
           21326]
          Length = 161

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F +PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYANAAAWSGKYCITAYAGGIRFVQPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G++S+ I  DV         + L   C   V+MVAVDE G P  +
Sbjct: 68  NLVEVSAKVIYTGRSSMHIAIDVQASDPKELKNRLTTHC--IVIMVAVDENGKPTDV 122


>gi|254391666|ref|ZP_05006864.1| acyl-CoA hydrolase [Streptomyces clavuligerus ATCC 27064]
 gi|294812962|ref|ZP_06771605.1| Putative acyl-CoA hydrolase [Streptomyces clavuligerus ATCC 27064]
 gi|326441486|ref|ZP_08216220.1| putative acyl-CoA hydrolase [Streptomyces clavuligerus ATCC 27064]
 gi|197705351|gb|EDY51163.1| acyl-CoA hydrolase [Streptomyces clavuligerus ATCC 27064]
 gi|294325561|gb|EFG07204.1| Putative acyl-CoA hydrolase [Streptomyces clavuligerus ATCC 27064]
          Length = 182

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 55/103 (53%), Gaps = 1/103 (0%)

Query: 42  TDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           +D NL G V GG IM  +D A G  A +      VT ++ E++F +P++V DLV++  Q+
Sbjct: 31  SDTNLLGTVHGGVIMKLVDDAAGAVAGRHSGGPAVTASMDEMVFLEPVRVGDLVYVKAQV 90

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
              G++S+ +   V     N S+   Q+   A +V  AVD  G
Sbjct: 91  NWTGRSSMEVGVRVLAERWNESTPA-QQVGSAYLVFAAVDADG 132


>gi|242277669|ref|YP_002989798.1| thioesterase superfamily protein [Desulfovibrio salexigens DSM
           2638]
 gi|242120563|gb|ACS78259.1| thioesterase superfamily protein [Desulfovibrio salexigens DSM
           2638]
          Length = 167

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 58/112 (51%), Gaps = 2/112 (1%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           + +P D N  GN+ GG ++ Q+D+     A +  +  VVT ++  + F +P  V +L+++
Sbjct: 16  RVLPQDTNPAGNLHGGVLLKQLDLVAATCAMRHARKPVVTASIDRMNFLRPAYVGELINL 75

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  +  +G+TS+ I   V     N  +  ++ T  A +  VA+ E G P  +
Sbjct: 76  HANVNMVGRTSMEIGVRVEA--ENLLTGEIRHTNSAYLTFVAMGENGKPSPV 125


>gi|163854613|ref|YP_001628911.1| putative acyl-CoA thioester hydrolase [Bordetella petrii DSM 12804]
 gi|163258341|emb|CAP40640.1| putative acyl-CoA thioester hydrolase [Bordetella petrii]
          Length = 170

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (48%), Gaps = 2/121 (1%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
           +S  L++ I   P   N  GNV GG I+  +D      AS+     VVT +V +++F +P
Sbjct: 5   ASHQLSMTILMTPDMANFAGNVHGGTILKYLDQVAYACASRYAGHYVVTLSVDQVVFRQP 64

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           I V +LV     +   G+TS+ I   V T   +    V++        MVAVD+ G P +
Sbjct: 65  IHVGELVTFLASVNYTGRTSMEIGIKVIT--EDIRRQVVRHANSCYFTMVAVDDNGQPTA 122

Query: 149 I 149
           +
Sbjct: 123 V 123


>gi|315927536|gb|EFV06869.1| acyl-CoA thioester hydrolase yciA [Campylobacter jejuni subsp.
          jejuni DFVF1099]
          Length = 61

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%)

Query: 31 GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVT 77
          G   LKI  MP+D N  GN+FGGWI+SQID+A  I A +L   RVVT
Sbjct: 2  GEPKLKIVAMPSDTNPAGNIFGGWILSQIDLAGAIAARELSPERVVT 48


>gi|255282382|ref|ZP_05346937.1| thioesterase family protein [Bryantella formatexigens DSM 14469]
 gi|255266966|gb|EET60171.1| thioesterase family protein [Bryantella formatexigens DSM 14469]
          Length = 161

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 3/110 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP  +N  G +FGG +++ ID   GI   +  +  VVT     L+F+    ++D V +  
Sbjct: 23  MPRHINGGGRLFGGQLVAWIDEVAGIVGKRHAESDVVTACFDNLIFKAGAYLNDTVVVRG 82

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +  +G TS+ +  D +    + +  ++ +   A VVMVAVDEKG  + +
Sbjct: 83  HLTYVGNTSMEVRVDTYREALDGTRTMINR---AYVVMVAVDEKGKARPV 129


>gi|170726399|ref|YP_001760425.1| thioesterase superfamily protein [Shewanella woodyi ATCC 51908]
 gi|169811746|gb|ACA86330.1| thioesterase superfamily protein [Shewanella woodyi ATCC 51908]
          Length = 158

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F KPI V 
Sbjct: 8   VTLRFLAEPADVNFGGKVHGGAVMKWIDLAAYACAAAWSGKYCITAYAGGIRFVKPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++V    ++   G+TS+ +  DV           L   C   V+MVAVD+ GNP  +
Sbjct: 68  NIVETSAKVIYTGRTSMHLGIDVRAGDPKHPERHLTTHC--IVIMVAVDDDGNPSEV 122


>gi|119946392|ref|YP_944072.1| thioesterase superfamily protein [Psychromonas ingrahamii 37]
 gi|119864996|gb|ABM04473.1| thioesterase superfamily protein [Psychromonas ingrahamii 37]
          Length = 158

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 54/114 (47%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       VT     + F  PI V 
Sbjct: 8   ITLRFLAEPQDVNFGGKVHGGAVMRWIDLAAYACAAGWSGHYCVTAYAGGIRFVTPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            LV +  ++   GK+S+ I  +V  C   + +  L   C   V+MVAVD   +P
Sbjct: 68  SLVEVEAKVIYTGKSSMHIALEVNACDPKSLNRRLTTHC--IVIMVAVDAHSHP 119


>gi|302867104|ref|YP_003835741.1| thioesterase superfamily protein [Micromonospora aurantiaca ATCC
           27029]
 gi|302569963|gb|ADL46165.1| thioesterase superfamily protein [Micromonospora aurantiaca ATCC
           27029]
          Length = 170

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 57/109 (52%), Gaps = 9/109 (8%)

Query: 45  NLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKI 104
           NL G V GG I++ ID   G+ A++      VT A+ E  F + ++V D+VH+  +I   
Sbjct: 29  NLMGTVHGGRILNLIDSVAGVVAARHSDGPAVTAAIDETAFLRAVRVGDVVHVDARITWA 88

Query: 105 GKTS----VTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           G++S    V +  D W     A   V      A +VMVAVD++G P+ +
Sbjct: 89  GRSSMEVAVKVSADRWD---RAVPPV--DVATAHLVMVAVDDEGQPRPV 132


>gi|126640983|ref|YP_001083967.1| putative acyl-CoA thioester hydrolase [Acinetobacter baumannii ATCC
           17978]
          Length = 153

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (49%), Gaps = 2/109 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V +LV     
Sbjct: 7   PDMANFSGNVHGGTILKLLDQVAYACASRYSGSYVVTLSVDKVNFKEPIYVGELVTFLAS 66

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  +G+TS+ +   V    +N     ++ T      MVAVDE G P+ +
Sbjct: 67  VNHVGRTSMEVGIRVEA--QNIQKRTVRHTNSCYFTMVAVDEHGKPREV 113


>gi|54303530|ref|YP_133523.1| putative acyl-CoA thioester hydrolase [Photobacterium profundum
           SS9]
 gi|46916960|emb|CAG23723.1| putative acyl-CoA thioester hydrolase [Photobacterium profundum
           SS9]
          Length = 161

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 60/119 (50%), Gaps = 6/119 (5%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P+DVN  G V GG +M  ID+A    ++       +T     + F  PIQV 
Sbjct: 8   VTLRFLAEPSDVNFGGKVHGGAVMKWIDLAAYACSAGWSAKYCITAYAGGIRFVAPIQVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQK--TCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G++S+ I  DV    + +   +L++  T    V+MVAVDE G    I
Sbjct: 68  NLVEVSAKVIYTGRSSMHIAIDV----QASDPKLLERRLTTHCIVIMVAVDEDGKSTPI 122


>gi|307546578|ref|YP_003899057.1| acyl-CoA thioester hydrolase [Halomonas elongata DSM 2581]
 gi|307218602|emb|CBV43872.1| putative acyl-CoA thioester hydrolase [Halomonas elongata DSM 2581]
          Length = 169

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 59/117 (50%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  G V GG I+ ++D      AS+     VVT +V ++ F++PI V 
Sbjct: 12  LTMTVLMTPDMANFSGKVHGGAILKKLDEVAYACASRYSGHYVVTLSVDQVRFKQPIHVG 71

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     I  +G++S+ +   V     +  + +++ T    + MVAVDE G P  +
Sbjct: 72  ELVTFLASINHVGRSSMEVGIKV--VAEDIQNKLIRHTNSCYLTMVAVDEAGKPARV 126


>gi|317403984|gb|EFV84445.1| acyl-CoA thioester hydrolase [Achromobacter xylosoxidans C54]
          Length = 165

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ I   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI
Sbjct: 6   SHQLSMTILMTPDMANFSGNVHGGTILKYLDQVAYACASRYAGQYVVTLSVDQVVFREPI 65

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G+TS+ I   V T   +    +++ T      MVAVD+ G P ++
Sbjct: 66  HVGELVTFLAAVNYTGRTSMEIGIKVVT--EDIRRKLVRHTNSCYFTMVAVDDNGAPTAV 123


>gi|312881463|ref|ZP_07741257.1| putative hydrolase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370885|gb|EFP98343.1| putative hydrolase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 161

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P+DVN  G V GG +M  ID+A    A+       +T     + F  PI V 
Sbjct: 8   MTLRFLAEPSDVNFGGKVHGGIVMKWIDLAAYANAAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G TS+ I  DV        ++ L   C   V+MVAVD  GNP  +
Sbjct: 68  NLVEVSAKLIYTGTTSMHIAIDVQASDPKELNNRLTTHC--IVIMVAVDGDGNPTRV 122


>gi|153836032|ref|ZP_01988699.1| thioesterase family protein [Vibrio parahaemolyticus AQ3810]
 gi|149750786|gb|EDM61531.1| thioesterase family protein [Vibrio parahaemolyticus AQ3810]
          Length = 161

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 54/117 (46%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    ++       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACSAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G +S+ I  DV         + L   C   V+MVAVDE G P  +
Sbjct: 68  NLVEVSAKVIYTGLSSMHIAIDVQASDPKQMKNRLTTHC--IVIMVAVDESGKPTDV 122


>gi|308274985|emb|CBX31584.1| Uncharacterized acyl-CoA thioester hydrolase CT_535 [uncultured
           Desulfobacterium sp.]
          Length = 169

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D N  GNV GG +M  ID   GI A++     VVT ++  L F  P+ V DL+ +   + 
Sbjct: 21  DANFAGNVHGGVVMKHIDSTAGIVATRHACSNVVTASIDRLDFYSPVYVGDLLILKAGVN 80

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +GKTS+ +   V    +N  +   + T  A +  VA+D +G P  +
Sbjct: 81  MVGKTSMEV--GVRVEAQNYITGETRTTALAYLTYVALDTEGKPAQV 125


>gi|237751176|ref|ZP_04581656.1| acyl-coA hydrolase [Helicobacter bilis ATCC 43879]
 gi|229373621|gb|EEO24012.1| acyl-coA hydrolase [Helicobacter bilis ATCC 43879]
          Length = 160

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 60/121 (49%), Gaps = 10/121 (8%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + I   P  VN +G + GG ++  +D      A++ C   VVT +V  +LF+ PI++ 
Sbjct: 14  LRMSILATPEHVNFNGVMHGGDLLKMLDGVAYACATRYCGIGVVTLSVDRVLFKSPIKIG 73

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKT---CEAT-VVMVAVDEKGNPKS 148
           +L+H    I   G TSV +   V       + D+ ++T   C ++   MVA+D  G P  
Sbjct: 74  NLIHFLASINYTGTTSVEVGIRV------VAEDIAKRTLTHCNSSYFTMVALDSNGKPTK 127

Query: 149 I 149
           +
Sbjct: 128 V 128


>gi|15613361|ref|NP_241664.1| acyl-CoA hydrolase [Bacillus halodurans C-125]
 gi|10173412|dbj|BAB04517.1| acyl-CoA hydrolase [Bacillus halodurans C-125]
          Length = 157

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 58/116 (50%), Gaps = 5/116 (4%)

Query: 37  IQT---MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           IQT   +P D N  G +FGG +++ ID    + A +     VVT ++  + F+    V D
Sbjct: 13  IQTRLVLPPDTNHLGTIFGGKVLAYIDEIAALTAMKHANSAVVTASIDSVDFKSSATVGD 72

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            + +   +   G+TS+ +Y  V +   N  +     T E+ + MVAVDE G PK +
Sbjct: 73  ALELEGFVTHTGRTSMEVYVRVHSN--NLLTGERTLTTESFLTMVAVDESGKPKPV 126


>gi|326800928|ref|YP_004318747.1| thioesterase superfamily protein [Sphingobacterium sp. 21]
 gi|326551692|gb|ADZ80077.1| thioesterase superfamily protein [Sphingobacterium sp. 21]
          Length = 174

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 2/103 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N   N+ GG ++  +DIA  I A + C   VVT +V  + F  P+++ D++ I  
Sbjct: 18  LPNDTNTLNNLMGGRLLHWMDIAAAISAQKHCNRIVVTASVDNVSFRHPVKLGDVISIEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           ++ +   TSV +   V+   +N  S    K+ EA    VA+D+
Sbjct: 78  KVTRAFNTSVEVQLQVYA--QNIPSGSRIKSNEAFYTFVAIDQ 118


>gi|320450282|ref|YP_004202378.1| acyl-CoA hydrolase [Thermus scotoductus SA-01]
 gi|320150451|gb|ADW21829.1| acyl-CoA hydrolase [Thermus scotoductus SA-01]
          Length = 127

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P + N  G +FGG  M+ +D A  + A++  + +VVT     + F++P+ +  +V +  
Sbjct: 12  FPGETNHYGTLFGGTAMAWMDQAAFVAATRHARRKVVTVHSDAVDFKRPVPLGSIVELVA 71

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ ++G+TS+ +  ++W  P  +  +      +   V+VAVD +G P
Sbjct: 72  RVVEVGRTSMRVEVEMWVEPIESGKEAYL-AAKGGFVLVAVDGEGRP 117


>gi|293603028|ref|ZP_06685464.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292818566|gb|EFF77611.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 166

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 60/120 (50%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ I   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI
Sbjct: 6   SHQLSMTILMTPDMANFSGNVHGGTILKYLDQVAYACASRYAGQYVVTLSVDQVVFREPI 65

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G+TS+ I   V T   +    +++ T      MVAVD++G P ++
Sbjct: 66  HVGELVTFLAAVNFTGRTSMEIGIKVVT--EDIRKKLVRHTNSCYFTMVAVDDQGAPTAV 123


>gi|260777306|ref|ZP_05886200.1| acyl-CoA hydrolase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260606972|gb|EEX33246.1| acyl-CoA hydrolase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 161

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYANAAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   GKTS+ I  DV         + L   C   V+MVAVD +G P  +
Sbjct: 68  NLVEVSAKVIYTGKTSMHIAIDVQASDPKELKNRLTTHC--IVIMVAVDGEGKPSPV 122


>gi|226228105|ref|YP_002762211.1| hypothetical protein GAU_2699 [Gemmatimonas aurantiaca T-27]
 gi|226091296|dbj|BAH39741.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 171

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 52/107 (48%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N+ G+ FGG IM+ +D A  + A +  +   VT ++  + F +PI V DLV    
Sbjct: 26  MPHDANILGHAFGGAIMAMVDKAAAVAAFRHSRTACVTASIDRVDFREPIHVGDLVTCKA 85

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +  +G TS+ +   V      + +     TC  T   VA+D  G P
Sbjct: 86  SVNFVGNTSMEVGVRVEAEDLISGARRHTNTCYLT--FVAIDRNGRP 130


>gi|307730574|ref|YP_003907798.1| thioesterase superfamily protein [Burkholderia sp. CCGE1003]
 gi|307585109|gb|ADN58507.1| thioesterase superfamily protein [Burkholderia sp. CCGE1003]
          Length = 168

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 60/117 (51%), Gaps = 10/117 (8%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPI 89
           T +    P+ VN  G V GG +M  ID    AC  + + + C    VT +V  + F +PI
Sbjct: 15  TFRFLAEPSSVNFGGKVHGGALMKWIDETAYACAAVWSGRYC----VTVSVGNIRFRRPI 70

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            V +LV +  ++   G+TS+ I+  V     +     L +T +  VVMVAV+E G+P
Sbjct: 71  LVGNLVELRARVVATGRTSMHIHVSVQAG--DPKGGELLQTTDCLVVMVAVNENGHP 125


>gi|227820923|ref|YP_002824893.1| putative acyl-CoA thioester hydrolase [Sinorhizobium fredii NGR234]
 gi|227339922|gb|ACP24140.1| putative acyl-CoA thioester hydrolase [Sinorhizobium fredii NGR234]
          Length = 167

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 53/109 (48%), Gaps = 2/109 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P   N  G V GG +++ +D      AS+  K   VT +V +++F +PI V +LVH    
Sbjct: 18  PDMANFSGKVHGGALLNLLDRVAFSCASRYSKQYAVTLSVDQVVFRQPIHVGELVHFRAS 77

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           I   G+TS+ +   V     N  S   + T      MVAVD +G P S+
Sbjct: 78  INFAGRTSMEVGIRVEA--ENIRSGERRHTNSCYFTMVAVDAEGRPTSV 124


>gi|323699370|ref|ZP_08111282.1| thioesterase superfamily protein [Desulfovibrio sp. ND132]
 gi|323459302|gb|EGB15167.1| thioesterase superfamily protein [Desulfovibrio desulfuricans
           ND132]
          Length = 167

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  GN+ GG I+  +D   G+ A +  +   VT ++  + F++P  + +L+    
Sbjct: 18  LPQDANPAGNLHGGVILKHVDTTGGVVAKRHSRSNTVTVSIDRMAFKQPAYMGELLIFKA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +  +G+TS+ I   V     N  +  ++ T  A +  VA+D+ G P  +
Sbjct: 78  SLNHVGRTSMEIGVRVEA--ENLRTGEVRHTNSAYLTYVALDDNGKPAEV 125


>gi|323526907|ref|YP_004229060.1| thioesterase superfamily protein [Burkholderia sp. CCGE1001]
 gi|323383909|gb|ADX56000.1| thioesterase superfamily protein [Burkholderia sp. CCGE1001]
          Length = 168

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 60/117 (51%), Gaps = 10/117 (8%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPI 89
           T +    P+ VN  G V GG +M  ID    AC  + + + C    VT +V  + F +PI
Sbjct: 15  TFRFLAEPSSVNFGGKVHGGALMKWIDETAYACAAVWSGRYC----VTVSVGNIRFRRPI 70

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            V +LV +  ++   G+TS+ I+  V     +     L +T +  VVMVAV+E G+P
Sbjct: 71  LVGNLVELRARVVATGRTSMHIHVSVQAG--DPKGGELLQTTDCLVVMVAVNENGHP 125


>gi|298207290|ref|YP_003715469.1| acyl-CoA thioester hydrolase [Croceibacter atlanticus HTCC2559]
 gi|83849926|gb|EAP87794.1| acyl-CoA thioester hydrolase [Croceibacter atlanticus HTCC2559]
          Length = 170

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 61/110 (55%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P++ N   N+FGG +++++D A  I A +  +  VVT +V  + F + I V  +V +  
Sbjct: 18  LPSETNPLNNLFGGELLARMDRAASISARRHSRRIVVTASVNHVAFNRSIPVGSVVTVEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            + +  +TS+ ++ +V+   R   S +   + EA    VAVD+ G+P +I
Sbjct: 78  IVSRAFRTSMEVFIEVYVEDRE--SGLRSLSNEAIYTFVAVDDLGSPVAI 125


>gi|258650754|ref|YP_003199910.1| thioesterase [Nakamurella multipartita DSM 44233]
 gi|258553979|gb|ACV76921.1| thioesterase superfamily protein [Nakamurella multipartita DSM
           44233]
          Length = 315

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    PTDVN  G   GG +M  ID A    A+  CK   +      + F +PIQ+ 
Sbjct: 168 MTLRFLAAPTDVNWGGKAHGGTVMRWIDEAAYAVAAGWCKGAAIAAYSGGVRFYRPIQIG 227

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +V +  ++ + G++S+ I   V     +  +  +Q T     + VA+DE G  K +
Sbjct: 228 HVVELEARLLRTGRSSMHI--AVLVSSGSPITGEMQLTTHCLTIFVALDEAGKAKPV 282


>gi|330505775|ref|YP_004382644.1| thioesterase superfamily protein [Pseudomonas mendocina NK-01]
 gi|328920062|gb|AEB60893.1| thioesterase superfamily protein [Pseudomonas mendocina NK-01]
          Length = 165

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LTMTVLMTPDMANFSGNVHGGTLLKYMDEVAYACASRYAGRYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++V     +   G+TS+ +   V T   N     ++ T  +   MVA+DE+G P
Sbjct: 68  EMVTFLASVNYCGRTSMEVGIKVIT--ENIRERSVRHTNSSFFTMVAMDEQGRP 119


>gi|308048201|ref|YP_003911767.1| thioesterase superfamily protein [Ferrimonas balearica DSM 9799]
 gi|307630391|gb|ADN74693.1| thioesterase superfamily protein [Ferrimonas balearica DSM 9799]
          Length = 135

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 60/107 (56%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N   ++FGG ++S +D   GI A+ Q+   ++VT+ + ++ F +P +  +++    
Sbjct: 11  PEDLNPGQSLFGGRLLSWLDEEAGIFAACQMGSHQLVTRQIRDITFHRPGRQGEVIEFGL 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +   G+T+VT+ C+V    RN  S  +  T EA +V V +D  G P
Sbjct: 71  ALTHTGRTAVTVRCEV----RNKQSLAVLATVEA-MVFVNLDANGRP 112


>gi|315506486|ref|YP_004085373.1| thioesterase superfamily protein [Micromonospora sp. L5]
 gi|315413105|gb|ADU11222.1| thioesterase superfamily protein [Micromonospora sp. L5]
          Length = 170

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 55/109 (50%), Gaps = 9/109 (8%)

Query: 45  NLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKI 104
           NL G V GG I++ ID   G+ A++      VT A+ E  F + ++V D+VH+  +I   
Sbjct: 29  NLTGTVHGGRILNLIDSVAGVVAARHSDGPAVTAAIDETAFLRAVRVGDVVHVDARITWA 88

Query: 105 GKTS----VTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           G++S    V +  D W     A   V      A +VMVAVD  G P+ +
Sbjct: 89  GRSSMEVAVKVSADRWD---RAVPPV--DVATAHLVMVAVDNDGQPRPV 132


>gi|325954543|ref|YP_004238203.1| thioesterase superfamily protein [Weeksella virosa DSM 16922]
 gi|323437161|gb|ADX67625.1| thioesterase superfamily protein [Weeksella virosa DSM 16922]
          Length = 171

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 58/111 (52%), Gaps = 3/111 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIY 98
           +P+++N   N+FGG +++++D    I A +     +VVT +V  + F++PI +   V + 
Sbjct: 19  LPSEINALNNMFGGELLARMDRISSIAARTHAGSYQVVTASVNHVSFDRPIPLGSTVRLE 78

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            ++ +   TS+ +Y DV+    +  +   +KT       VAVDE   P  +
Sbjct: 79  AKVTRAFSTSMEVYVDVYLY--DYKNSCYEKTNNGIYTFVAVDENNKPTRV 127


>gi|90409578|ref|ZP_01217595.1| putative acyl-CoA thioester hydrolase [Photobacterium profundum
           3TCK]
 gi|90328931|gb|EAS45188.1| putative acyl-CoA thioester hydrolase [Photobacterium profundum
           3TCK]
          Length = 161

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P+DVN  G V GG +M  ID+A    ++       +T     + F  PIQV 
Sbjct: 8   VTLRFLAEPSDVNFGGKVHGGAVMKWIDLAAYACSAGWSAKYCITAYAGGIRFVAPIQVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   G++S+ I  DV           L   C   V+MVAVDE G    I
Sbjct: 68  NLVEVSAKVIYTGRSSMHIAIDVQASDPKQLERRLTTHC--IVIMVAVDEDGKSTPI 122


>gi|323483186|ref|ZP_08088577.1| thioesterase superfamily protein [Clostridium symbiosum WAL-14163]
 gi|323691370|ref|ZP_08105645.1| thioesterase superfamily protein [Clostridium symbiosum WAL-14673]
 gi|323403459|gb|EGA95766.1| thioesterase superfamily protein [Clostridium symbiosum WAL-14163]
 gi|323504710|gb|EGB20497.1| thioesterase superfamily protein [Clostridium symbiosum WAL-14673]
          Length = 159

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%), Gaps = 3/107 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           + + +N  G +FGG +M  IDI  G+ A +   C   T +V  L F++ ++++D + +  
Sbjct: 21  LSSHINGAGRLFGGQLMEWIDIVAGVVARRHSHCNQTTASVDNLQFKEAVRLNDTLILLG 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +I  +G TS+ +  D +    + +  ++     A  VMVA+DEK +P
Sbjct: 81  KITYVGHTSMEVQVDSYVEDLDGTRKLVNT---AFFVMVALDEKDHP 124


>gi|23009017|ref|ZP_00050225.1| COG1607: Acyl-CoA hydrolase [Magnetospirillum magnetotacticum MS-1]
          Length = 92

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 2/79 (2%)

Query: 71  CKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKT 130
            + RVVT AV  +   +P ++ D++ +YT+I K+ +TS+ I+ + W   R   +   +K 
Sbjct: 12  AQGRVVTVAVDAMTVSRPFRLGDVLCVYTRIGKVVRTSMKIHLEAWA--RRFQTQFREKV 69

Query: 131 CEATVVMVAVDEKGNPKSI 149
            EAT   VA+DE G P+ I
Sbjct: 70  TEATFTFVAIDEAGRPRPI 88


>gi|33598656|ref|NP_886299.1| putative acyl-CoA thioester hydrolase [Bordetella parapertussis
           12822]
 gi|33574785|emb|CAE39445.1| putative acyl-CoA thioester hydrolase [Bordetella parapertussis]
          Length = 163

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +++ I   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI V 
Sbjct: 1   MSMTILMTPDMANFSGNVHGGTILKYLDQVAYACASRYAGQYVVTLSVDQVVFREPIHVG 60

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G+TS+ I   V T   +    +++ T      MVAVD+ G P ++
Sbjct: 61  ELVTFLASVNYTGRTSMEIGIKVVT--EDIRRKLVRHTNSCYFTMVAVDDNGQPTAV 115


>gi|170696342|ref|ZP_02887472.1| thioesterase superfamily protein [Burkholderia graminis C4D1M]
 gi|170138748|gb|EDT06946.1| thioesterase superfamily protein [Burkholderia graminis C4D1M]
          Length = 168

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 60/117 (51%), Gaps = 10/117 (8%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPI 89
           T +    P+ VN  G V GG +M  ID    AC  + + + C    VT +V  + F +PI
Sbjct: 15  TFRFLAEPSSVNFGGKVHGGALMKWIDETAYACAAVWSGRYC----VTVSVGNIRFRRPI 70

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            V +LV +  ++   G+TS+ I+  V     +     L +T +  VVMVAV+E G+P
Sbjct: 71  LVGNLVELRARVVATGRTSMHIHVSVQAG--DPKGGELLQTTDCLVVMVAVNENGSP 125


>gi|91784756|ref|YP_559962.1| long-chain acyl-CoA thioester hydrolase [Burkholderia xenovorans
           LB400]
 gi|91688710|gb|ABE31910.1| Long-chain acyl-CoA thioester hydrolase [Burkholderia xenovorans
           LB400]
          Length = 168

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 59/117 (50%), Gaps = 10/117 (8%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQID---IAC-GIRASQLCKCRVVTKAVTELLFEKPI 89
           T +    PT VN  G V GG +M  ID    AC  + + + C    VT +V  + F +PI
Sbjct: 15  TFRFLAEPTSVNFGGKVHGGALMKWIDETAYACSAVWSGRYC----VTVSVGNIRFRRPI 70

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            V +LV +  ++   G+TS+ I+  V     +     L +T +  +VMVAV+E G P
Sbjct: 71  LVGNLVELRARVVATGRTSMHIHVSVQAG--DPKGGELLQTTDCLIVMVAVNENGQP 125


>gi|186475559|ref|YP_001857029.1| thioesterase superfamily protein [Burkholderia phymatum STM815]
 gi|184192018|gb|ACC69983.1| thioesterase superfamily protein [Burkholderia phymatum STM815]
          Length = 168

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQID---IAC-GIRASQLCKCRVVTKAVTELLFEKPI 89
           T +    PT VN  G V GG +M  ID    AC  + + + C    VT +V  + F +PI
Sbjct: 15  TFRFLAEPTSVNFGGKVHGGALMKWIDETAYACSAVWSGRYC----VTVSVGNIRFRRPI 70

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAVDEKGN 145
            V +LV +  ++   G+TS+ I+  V    P+      L +T +  VVMVAV+E G+
Sbjct: 71  HVGNLVELRARVVATGRTSMHIHVSVHAGDPKGGE---LLQTTDCLVVMVAVNENGS 124


>gi|209963663|ref|YP_002296578.1| Acyl-CoA thioester hydrolase, putative [Rhodospirillum centenum SW]
 gi|209957129|gb|ACI97765.1| Acyl-CoA thioester hydrolase, putative [Rhodospirillum centenum SW]
          Length = 248

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 54/111 (48%), Gaps = 2/111 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   + +  +FGG  M+Q+  A  + A++ C+  VV  A   L F  P++V +++ I  
Sbjct: 138 FPDQASHNHILFGGHAMAQMGKAAFVAATRHCRRAVVLAASKRLDFTSPVKVGEIMEIEA 197

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
            +   G +S+ +  D+W    N  +   +K  E   VMVA+D    P  +R
Sbjct: 198 AVTGTGTSSMQVTVDLWG--ENLKTGERRKAAEGVFVMVALDADQRPTPVR 246



 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 40/76 (52%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  G +FGG  ++ +D    I A++      VT +   + F  P Q+ ++V +  
Sbjct: 12  FPGDTNHHGTLFGGAALAHMDKVAFIAATRHAHVDFVTASCERIDFAAPAQLGEIVEVTG 71

Query: 100 QIRKIGKTSVTIYCDV 115
           +I ++G+ S+T+  D+
Sbjct: 72  RIARVGRRSLTVEVDL 87


>gi|328794354|ref|XP_003252047.1| PREDICTED: protein VdlD-like, partial [Apis mellifera]
          Length = 116

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 16/113 (14%)

Query: 41  PTDVNLDGNVFGG---WIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           P   N  GNV GG    ++ Q+  AC   AS+     VVT +V +++F++PI V +LV  
Sbjct: 7   PALANFHGNVHGGDLLKLLDQVAYAC---ASRYSGEYVVTLSVDQVIFKEPIHVGELVTF 63

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEAT----VVMVAVDEKGNP 146
           Y  +  +G+TS+ +        R  + D+  ++   T      MVAVD+ G P
Sbjct: 64  YASVNHVGRTSMEVGI------RVEAQDIQHRSARHTNSCYFSMVAVDKNGKP 110


>gi|71278786|ref|YP_267198.1| thioesterase family protein [Colwellia psychrerythraea 34H]
 gi|71144526|gb|AAZ24999.1| thioesterase family protein [Colwellia psychrerythraea 34H]
          Length = 158

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       VT     + F  PI V 
Sbjct: 8   ITLRFLAEPQDVNFGGKVHGGAVMKWIDLAAYACAAGWSGRYCVTAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            LV +  ++   G +S+ I  +V  C   + +  L   C   V+MVAVD+ G  + +
Sbjct: 68  SLVEVEAKVIYTGNSSIHIALEVNACDPKSLNRRLTTHC--IVIMVAVDQNGQSERV 122


>gi|315126669|ref|YP_004068672.1| acyl-CoA thioester hydrolase protein [Pseudoalteromonas sp. SM9913]
 gi|315015183|gb|ADT68521.1| acyl-CoA thioester hydrolase protein [Pseudoalteromonas sp. SM9913]
          Length = 154

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 3/123 (2%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M SS V+  +    PTDVN  G V GG +M  ID A    A+       VT +V  + F 
Sbjct: 1   MASSNVI-FRFLAEPTDVNFGGKVHGGVVMKWIDQAGYACAAGWSGHYCVTVSVAGVKFS 59

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +PI V  +V +  +I   GKTS+ I+  V  C    + ++++ T    +  VA+DE G P
Sbjct: 60  RPILVGQIVEVEAKIAHTGKTSMQIFIQV-RCGDPKTQNLVE-TNHCVISFVAMDETGYP 117

Query: 147 KSI 149
            ++
Sbjct: 118 VAV 120


>gi|311748017|ref|ZP_07721802.1| thioesterase family protein [Algoriphagus sp. PR1]
 gi|126574997|gb|EAZ79355.1| thioesterase family protein [Algoriphagus sp. PR1]
          Length = 158

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 4/117 (3%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           + +  + P+DVN  G V GG +M  ID A    A    +   VT  V  + F KPI + +
Sbjct: 8   SFQFISEPSDVNFGGKVHGGVVMKWIDQAAYTCARTWSESYCVTVYVGGIRFYKPINIGE 67

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           ++ I   +   G +S+ I  ++++  R  S    +K     ++ VAVDE G  KSI+
Sbjct: 68  VIKIDAAVIYTGNSSIHIMVEIYS--RGFSDQKFEKKTHCIIIFVAVDENG--KSIK 120


>gi|295700642|ref|YP_003608535.1| thioesterase superfamily protein [Burkholderia sp. CCGE1002]
 gi|295439855|gb|ADG19024.1| thioesterase superfamily protein [Burkholderia sp. CCGE1002]
          Length = 174

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 58/107 (54%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A SQL   RVVTK ++E+ F    +  D++ +  
Sbjct: 24  PEDLNPNGTLFGGSLLRWIDEEAAIYAISQLDNQRVVTKFMSEINFVSSARQGDIIELGM 83

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
                G+TS+T+ C+V    RN  +     T E  +V V +DE G+P
Sbjct: 84  TATHFGRTSITLRCEV----RNKITRKSILTVE-KMVFVNLDENGDP 125


>gi|262190579|ref|ZP_06048819.1| acyl-CoA hydrolase [Vibrio cholerae CT 5369-93]
 gi|262033539|gb|EEY52037.1| acyl-CoA hydrolase [Vibrio cholerae CT 5369-93]
          Length = 162

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 54/117 (46%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P DVN  G V GG +M  ID+A    A+       +T     + F  PI V 
Sbjct: 8   ITLRFLAEPGDVNFGGKVHGGAVMKWIDLAAYACAAAWSGKYCITAYAGGIRFVAPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV +  ++   GKTS+ I  DV         + L   C   V+MVAVDE   P  +
Sbjct: 68  NLVEVNAKVIYTGKTSMHIAIDVQASDPKFLKNHLTTHC--IVIMVAVDEASKPSPV 122


>gi|146309542|ref|YP_001190007.1| thioesterase superfamily protein [Pseudomonas mendocina ymp]
 gi|145577743|gb|ABP87275.1| thioesterase superfamily protein [Pseudomonas mendocina ymp]
          Length = 161

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LTMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++V     +   G+TS+ +   V T   N     ++ T      MVA+DE G P  +
Sbjct: 68  EMVTFLASVNYCGRTSMEVGIKVIT--ENIRERSVRHTNSCFFTMVAMDEHGRPAPV 122


>gi|328957661|ref|YP_004375047.1| putative acyl-CoA hydrolase [Carnobacterium sp. 17-4]
 gi|328673985|gb|AEB30031.1| putative acyl-CoA hydrolase [Carnobacterium sp. 17-4]
          Length = 177

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 48/93 (51%), Gaps = 9/93 (9%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           +V Q HS           P  +N  G +FGG +MS +D+A  I  ++  + + VT +   
Sbjct: 14  LVVQTHS---------IFPNQLNNHGTLFGGELMSMLDVAASIAVTRHARTQSVTASTDS 64

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDV 115
           + F  PIQ +D + I   +  +GK+SV ++C V
Sbjct: 65  VDFLHPIQRNDAITIEAYVSGVGKSSVEVFCKV 97


>gi|119470320|ref|ZP_01613079.1| hypothetical protein ATW7_13188 [Alteromonadales bacterium TW-7]
 gi|119446492|gb|EAW27767.1| hypothetical protein ATW7_13188 [Alteromonadales bacterium TW-7]
          Length = 154

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 3/123 (2%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M SS V+  +    PTDVN  G V GG +M  ID A    A+       VT +V  + F 
Sbjct: 1   MPSSNVV-FRFLAEPTDVNFGGKVHGGVVMKWIDQAGYACAAGWSGHYCVTVSVAGVKFR 59

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +PI V  +V +  +I   GKTS+ I+  V  C    + ++++ T    +  VA+DE G P
Sbjct: 60  RPILVGQIVEVEAKIAHTGKTSMQIFIQV-RCGDPKTQNMVE-TNHCVISFVAMDETGYP 117

Query: 147 KSI 149
            ++
Sbjct: 118 VAV 120


>gi|159036534|ref|YP_001535787.1| thioesterase superfamily protein [Salinispora arenicola CNS-205]
 gi|157915369|gb|ABV96796.1| thioesterase superfamily protein [Salinispora arenicola CNS-205]
          Length = 172

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 4/107 (3%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           DVNL G V GG +M  +D      A++      VT A+ E++F + ++V DLVH Y Q+ 
Sbjct: 29  DVNLYGTVHGGVLMKFVDDVAAAAAARHSGGTAVTAAIDEIVFSEAVRVGDLVHAYAQVN 88

Query: 103 KIGKTSVTIYCDVWTCPR--NASSDVLQKTCEATVVMVAVDEKGNPK 147
             G+TS+ +   V T  R  +A  D + +   A +  V VD  G+P+
Sbjct: 89  WAGQTSMEVGVRV-TAERWDSAEGDPV-RVATAYLAFVGVDVGGSPR 133


>gi|161529104|ref|YP_001582930.1| thioesterase superfamily protein [Nitrosopumilus maritimus SCM1]
 gi|160340405|gb|ABX13492.1| thioesterase superfamily protein [Nitrosopumilus maritimus SCM1]
          Length = 161

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 37  IQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVH 96
           ++  P+D N  GNVFGG I+  ID+  GI A +  +   VT  +  + F KP+ V +++ 
Sbjct: 21  VRMFPSDANPAGNVFGGEILKHIDMVAGIVAQRHSQSNAVTVCMDSVNFLKPVFVGNVLS 80

Query: 97  IYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +  +I  +  +S+ I  +V     +  + +   T  A V  VA+D+ G P
Sbjct: 81  LNARINYVHNSSMEI--EVKAEAEDIVTGIRTTTGTAFVTFVALDKNGKP 128


>gi|15597889|ref|NP_251383.1| hypothetical protein PA2693 [Pseudomonas aeruginosa PAO1]
 gi|107102216|ref|ZP_01366134.1| hypothetical protein PaerPA_01003267 [Pseudomonas aeruginosa PACS2]
 gi|116050678|ref|YP_790502.1| hypothetical protein PA14_29290 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218891146|ref|YP_002440012.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           aeruginosa LESB58]
 gi|254235673|ref|ZP_04928996.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254241119|ref|ZP_04934441.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296388841|ref|ZP_06878316.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           aeruginosa PAb1]
 gi|313107748|ref|ZP_07793928.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           aeruginosa 39016]
 gi|9948766|gb|AAG06081.1|AE004697_6 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115585899|gb|ABJ11914.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126167604|gb|EAZ53115.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126194497|gb|EAZ58560.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218771371|emb|CAW27138.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           aeruginosa LESB58]
 gi|310880430|gb|EFQ39024.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           aeruginosa 39016]
          Length = 166

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 59/121 (48%), Gaps = 8/121 (6%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQID---IACGIRASQLCKCRVVTKAVTELLFEKPI 89
           LT+ +   P   N  GNV GG ++  +D    AC   A +     VVT +V +++F +PI
Sbjct: 8   LTMSVLMTPDKANFSGNVHGGALLKLLDEVAFAC---AKRYAGRYVVTLSVDQVIFREPI 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G+TS+ +   V T   N     ++ T      MVA+D++  P ++
Sbjct: 65  HVGELVTFLASVNYTGRTSMEVGVKVMT--ENIHERTVRHTNSCFFTMVAMDDQRRPVAV 122

Query: 150 R 150
           R
Sbjct: 123 R 123


>gi|152987317|ref|YP_001349322.1| hypothetical protein PSPA7_3968 [Pseudomonas aeruginosa PA7]
 gi|150962475|gb|ABR84500.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 166

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 59/121 (48%), Gaps = 8/121 (6%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQID---IACGIRASQLCKCRVVTKAVTELLFEKPI 89
           LT+ +   P   N  GNV GG ++  +D    AC   A +     VVT +V +++F +PI
Sbjct: 8   LTMSVLMTPDKANFSGNVHGGALLKLLDEVAFAC---AKRYAGRYVVTLSVDQVIFREPI 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   G+TS+ +   V T   N     ++ T      MVA+D++  P ++
Sbjct: 65  HVGELVTFLASVNYTGRTSMEVGVKVMT--ENIHERTVRHTNSCFFTMVAMDDQRRPVAV 122

Query: 150 R 150
           R
Sbjct: 123 R 123


>gi|311694326|gb|ADP97199.1| thioesterase superfamily protein [marine bacterium HP15]
          Length = 159

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 59/117 (50%), Gaps = 2/117 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
           ++S  L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +
Sbjct: 3   NNSTSLSMTVLMTPDKANFSGNVHGGTLLKYLDEVAYACASRYAGTYVVTLSVDQVMFLQ 62

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           PIQ+ +LV     +   G+TS+ I   V T   N    +++ +      MVAVD+ G
Sbjct: 63  PIQIGELVTFLASVNYTGRTSMEIGIKVVT--ENIRDKLVRHSNSCFFTMVAVDDNG 117


>gi|255038006|ref|YP_003088627.1| thioesterase superfamily protein [Dyadobacter fermentans DSM 18053]
 gi|254950762|gb|ACT95462.1| thioesterase superfamily protein [Dyadobacter fermentans DSM 18053]
          Length = 172

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
           H S V T+    +P D N   N+ GG ++  +DI   I A +     VVT +V  + F +
Sbjct: 8   HQSEV-TMTEMVLPNDTNTLNNLMGGRLLHWMDICAAISAQKHSNRIVVTASVDNVSFTE 66

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           PI++ ++V +  ++ +   +S+ ++ +VW    +  + V   T  A    VAVD+ G P
Sbjct: 67  PIRLGNIVTMRAKVTRAFNSSMEVFLEVWA--EDIPAGVRVSTNRAFYTFVAVDQNGRP 123


>gi|218887397|ref|YP_002436718.1| thioesterase superfamily protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758351|gb|ACL09250.1| thioesterase superfamily protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 175

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           + +P D N  GNV GG I+  ID+A  + A + C+  VVT ++  + F  P+ V +L+ +
Sbjct: 16  RPLPEDANPAGNVHGGVILKHIDLAGAVAAMRHCRTAVVTASIDRMDFRAPVHVGELMQL 75

Query: 98  YTQIRKIGKTSVTI 111
              +   G TS+ +
Sbjct: 76  KASVNLAGGTSLEV 89


>gi|332520415|ref|ZP_08396877.1| thioesterase superfamily protein [Lacinutrix algicola 5H-3-7-4]
 gi|332043768|gb|EGI79963.1| thioesterase superfamily protein [Lacinutrix algicola 5H-3-7-4]
          Length = 128

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 61/109 (55%), Gaps = 6/109 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG +++ ID    +    QL   ++VTK ++E+ F       D+V I  
Sbjct: 11  PEDLNPNGTLFGGRLLAWIDEEAALYTVVQLDNPKIVTKYMSEISFNSKALEGDIVEIGM 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           +++K G++S+T+ C+V    RN  +     T E  ++MV + + G PK+
Sbjct: 71  EVKKFGRSSITLKCEV----RNMMTRETIITVE-DIIMVNLGKDGKPKA 114


>gi|149278994|ref|ZP_01885128.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Pedobacter sp.
           BAL39]
 gi|149230273|gb|EDM35658.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Pedobacter sp.
           BAL39]
          Length = 132

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 55/107 (51%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL    VVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNANGTLFGGSLLRWIDEEAAIYAIVQLGNHGVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
              + G TS+T+ C+V       S   + K     +V V VDEKGNP
Sbjct: 71  TATEFGHTSLTMRCEVRNKITRKSILTIDK-----IVFVNVDEKGNP 112


>gi|294505970|ref|YP_003570028.1| acyl-CoA thioester hydrolase ykhA [Salinibacter ruber M8]
 gi|294342298|emb|CBH23076.1| Putative acyl-CoA thioester hydrolase ykhA [Salinibacter ruber M8]
          Length = 148

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N    +FGG  +  +D A  I A++ C+ +VVT   +E+ ++ P+    +V +  
Sbjct: 28  FPGDTNHYHTLFGGTALEWMDQAAFICATRWCRTKVVTVRTSEIDYKHPVPEGTIVELIA 87

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +I   G TS+T+  D++  P +     L   C     +VA+D++ NP  +
Sbjct: 88  RIADTGTTSLTVRVDMFIEPMDEHDRTL--ACTGQFTLVALDDQDNPTPV 135


>gi|160897806|ref|YP_001563388.1| thioesterase superfamily protein [Delftia acidovorans SPH-1]
 gi|160363390|gb|ABX35003.1| thioesterase superfamily protein [Delftia acidovorans SPH-1]
          Length = 168

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (47%), Gaps = 2/122 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ +   P   N  GNV GG ++ Q+D      AS+     VVT +V +++F +PI
Sbjct: 6   SHQLSMTVLMSPDMANFSGNVHGGAVLKQLDQVAYACASRYAGRYVVTLSVDQVMFLQPI 65

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   GK+S+ I   V     +  + V++        MVAVDE   P  +
Sbjct: 66  HVGELVTFLASVNHTGKSSMEIGIKV--VAEDIRTQVVRHVNSCFFTMVAVDENKQPAPV 123

Query: 150 RT 151
            T
Sbjct: 124 PT 125


>gi|187924924|ref|YP_001896566.1| thioesterase superfamily protein [Burkholderia phytofirmans PsJN]
 gi|187716118|gb|ACD17342.1| thioesterase superfamily protein [Burkholderia phytofirmans PsJN]
          Length = 168

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 59/117 (50%), Gaps = 10/117 (8%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQID---IAC-GIRASQLCKCRVVTKAVTELLFEKPI 89
           T +    P+ VN  G V GG +M  ID    AC  + + + C    VT +V  + F +PI
Sbjct: 15  TFRFLAEPSSVNFGGKVHGGALMKWIDETAYACSAVWSGRYC----VTVSVGNIRFRRPI 70

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            V +LV +  ++   G+TS+ I+  V     +     L +T +  +VMVAV+E G P
Sbjct: 71  LVGNLVELRARVVATGRTSMHIHVSVQAG--DPKGGELLQTTDCLIVMVAVNENGQP 125


>gi|313902599|ref|ZP_07835999.1| thioesterase superfamily protein [Thermaerobacter subterraneus DSM
           13965]
 gi|313467165|gb|EFR62679.1| thioesterase superfamily protein [Thermaerobacter subterraneus DSM
           13965]
          Length = 283

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  GN+ GG +M  +DIA  + A++  +   VT +V  + F  PI+V + + +  
Sbjct: 89  LPNDANPLGNILGGKVMHLMDIAGALAAARHSRRICVTASVDRIDFLHPIRVGEAILLEA 148

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           Q+   G+TS+ +  +V++   N  +   + T  A    VA+D+ G P  +
Sbjct: 149 QVTDAGRTSMEVRVNVYS--ENLRTGQRRHTATAFFTFVALDDSGRPAPV 196


>gi|317056717|ref|YP_004105184.1| thioesterase superfamily protein [Ruminococcus albus 7]
 gi|315448986|gb|ADU22550.1| thioesterase superfamily protein [Ruminococcus albus 7]
          Length = 162

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D+N +  +FGG +M  ID A G+ A + C    VT  V  L F+    ++D+V +  ++ 
Sbjct: 25  DINGENRLFGGRLMEWIDEAAGVAAMRHCGGNAVTLMVDSLKFKHGAFINDIVVLIAKVT 84

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +G+TS+ +  D +    +  + + +    A +  V VDE G PK I
Sbjct: 85  YVGRTSMEVRVDTYV--EDKGTGIRRAINHAYLTCVHVDENGRPKPI 129


>gi|83816543|ref|YP_444286.1| thioesterase family protein [Salinibacter ruber DSM 13855]
 gi|83757937|gb|ABC46050.1| thioesterase family protein [Salinibacter ruber DSM 13855]
          Length = 148

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N    +FGG  +  +D A  I A++ C+ +VVT   +E+ ++ P+    +V +  
Sbjct: 28  FPGDTNHYHTLFGGTALEWMDQAAFICATRWCRTKVVTVRTSEIDYKHPVPEGTIVELIA 87

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +I   G TS+T+  D++  P +     L   C     +VA+D++ NP  +
Sbjct: 88  RIADTGTTSLTVRVDMFIEPMDEHDRTL--ACTGQFTLVALDDQDNPTPV 135


>gi|77360561|ref|YP_340136.1| acyl-CoA thioester hydrolase protein [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76875472|emb|CAI86693.1| conserved protein of unknown function ; putative acyl-CoA thioester
           hydrolase family protein [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 154

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 62/123 (50%), Gaps = 3/123 (2%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M SS V+  +    PTDVN  G V GG +M  ID A    A+       VT +V  + F 
Sbjct: 1   MPSSKVV-FRFLAEPTDVNFGGKVHGGAVMKWIDQAGYACAAGWSGHYCVTVSVAGVKFR 59

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +PI V  +V +  +I   GKTS+ I+  V  C    + ++++ T    +  +A+DE G P
Sbjct: 60  RPILVGQIVEVEAKIAHTGKTSMQIFIQV-RCGDPKTQNMVE-TNHCVISFIAMDETGYP 117

Query: 147 KSI 149
            ++
Sbjct: 118 VAV 120


>gi|34557869|ref|NP_907684.1| acyl-CoA hydrolase [Wolinella succinogenes DSM 1740]
 gi|34483587|emb|CAE10584.1| ACYL-COA HYDROLASE [Wolinella succinogenes]
          Length = 168

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ I   P   N  G V GG ++  +D      AS+ C   VVT +V  ++F+ PI++ 
Sbjct: 22  LTMSILMTPAMANFRGFVHGGDLLKLLDQVAYACASRYCAKPVVTLSVDRVIFKNPIEIG 81

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G TS+ I   V     +    V+  T      MVA+DE+G P S+
Sbjct: 82  NLVTFLASVNYTGNTSMEIGIKVIA--EDIHKRVVTHTNSCYFTMVAIDEQGRPVSV 136


>gi|163755621|ref|ZP_02162740.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Kordia algicida
           OT-1]
 gi|161324534|gb|EDP95864.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Kordia algicida
           OT-1]
          Length = 130

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 6/106 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG +++ ID    + A  QL   +VVTK ++E+ F+   +  D+V I  
Sbjct: 11  PEDLNPNGTLFGGRLLAWIDEEAALYAIIQLENPKVVTKYMSEIDFKSSAKKGDIVEIGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           ++ K GK+S+ + C+V    RN  +     T +  +VMV +D  GN
Sbjct: 71  EVVKFGKSSIVLKCEV----RNKMTHETILTVD-NIVMVNLDADGN 111


>gi|148508343|gb|ABQ76126.1| acyl-CoA thioester hydrolase [uncultured haloarchaeon]
          Length = 148

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 59/126 (46%), Gaps = 2/126 (1%)

Query: 23  MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTE 82
           MV       V+  + +  P   N  GN  GG ++  +D    I A ++ +   VT  ++E
Sbjct: 1   MVMTSLKESVVNRRERIQPPQTNNYGNAHGGELVKIMDEVAAISAMRVAESPCVTARISE 60

Query: 83  LLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
           + F  P+Q  D+V +   + + G+TS+ +Y  V     +    V ++   A    VAVDE
Sbjct: 61  VNFHTPVQEGDVVGVEAFVYQTGETSLDVYTRVER--EDPVKGVREEATTARFTTVAVDE 118

Query: 143 KGNPKS 148
            GNP S
Sbjct: 119 DGNPVS 124


>gi|262279967|ref|ZP_06057752.1| thioesterase superfamily protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262260318|gb|EEY79051.1| thioesterase superfamily protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 171

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V ++ F++PI V 
Sbjct: 17  LTMSVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYSGGYVVTLSVDKVNFKEPIYVG 76

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +LV     +  +G+TS+ +   V    +N     ++ T      MVAVDE+  P
Sbjct: 77  ELVTFLASVNHVGRTSMEVGIRVEA--QNIQKRTVRHTNSCYFTMVAVDEQSKP 128


>gi|163791005|ref|ZP_02185427.1| hypothetical protein CAT7_00170 [Carnobacterium sp. AT7]
 gi|159873744|gb|EDP67826.1| hypothetical protein CAT7_00170 [Carnobacterium sp. AT7]
          Length = 177

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 47/83 (56%), Gaps = 3/83 (3%)

Query: 34  TLKIQT---MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           +L IQT    P  +N  G +FGG +MS +D+A  I  ++  + + VT +   + F  PIQ
Sbjct: 13  SLVIQTHVIFPNQLNNHGTLFGGELMSMLDVAASIAVTRHARTQSVTASTDSVDFLHPIQ 72

Query: 91  VSDLVHIYTQIRKIGKTSVTIYC 113
            +D + I T +  +G +SV ++C
Sbjct: 73  RNDAITIETYVSGVGSSSVEVFC 95


>gi|148653355|ref|YP_001280448.1| thioesterase superfamily protein [Psychrobacter sp. PRwf-1]
 gi|148572439|gb|ABQ94498.1| thioesterase superfamily protein [Psychrobacter sp. PRwf-1]
          Length = 188

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +PI V 
Sbjct: 19  LYMSVLMTPDMANFIGNVHGGDLLKMLDQVAYACASRYSGSYVVTLSVDQVMFLEPIYVG 78

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     I  +G+TS+ +   V     N     ++ T      MVAVDE G P  +
Sbjct: 79  ELVTFAANINHVGRTSMEVGIRVEA--ENIQQRTVRHTNSCYFTMVAVDENGKPTPV 133


>gi|319785676|ref|YP_004145151.1| thioesterase superfamily protein [Pseudoxanthomonas suwonensis
           11-1]
 gi|317464188|gb|ADV25920.1| thioesterase superfamily protein [Pseudoxanthomonas suwonensis
           11-1]
          Length = 135

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  G +FGG  ++ +D+A  I AS+  +  VVT    ++ F +PI   DLV +  
Sbjct: 21  FPDHTNHLGTLFGGQALAWMDMASFIVASRYARTTVVTARSEQVDFNQPIHKGDLVEVIA 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ K+G++S+ +  +V T   N  +   +       VM+A+D  G P  +
Sbjct: 81  RLVKVGRSSMNVEVEVIT--ENLLTGERKLCTRGRFVMIALDPLGQPTPV 128


>gi|86132302|ref|ZP_01050897.1| acyl-CoA thioester hydrolase [Dokdonia donghaensis MED134]
 gi|85817221|gb|EAQ38404.1| acyl-CoA thioester hydrolase [Dokdonia donghaensis MED134]
          Length = 132

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 57/108 (52%), Gaps = 6/108 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    +    Q+   R VTK ++E+ F    +  D++ I  
Sbjct: 11  PEDLNPNGTLFGGRLLEWIDEEAALYTIIQIENPRSVTKYMSEIDFRASAKKGDIIEIGL 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           +  K G  SVT+ C+V    RN  +     T E  +VMV +DE+G P+
Sbjct: 71  EATKFGTASVTLKCEV----RNKMTRETIITIER-IVMVGLDEEGKPQ 113


>gi|295134448|ref|YP_003585124.1| acyl-CoA thioester hydrolase [Zunongwangia profunda SM-A87]
 gi|294982463|gb|ADF52928.1| acyl-CoA thioester hydrolase [Zunongwangia profunda SM-A87]
          Length = 130

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 58/108 (53%), Gaps = 6/108 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +  +FGG ++  ID  C + +  QL   + VTK ++E+ F    +  D++ I  
Sbjct: 11  PQDLNPNQTLFGGRLLEWIDEECALYSIIQLENPKTVTKYMSEIDFRSSAREGDIIEIGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           ++ K G  S+T+ C+V       +  ++ K     +VMVA+DE G PK
Sbjct: 71  EVVKFGSASLTLKCEVRNKMTRETIIMVDK-----IVMVALDENGKPK 113


>gi|257076470|ref|ZP_05570831.1| acyl-CoA hydrolase [Ferroplasma acidarmanus fer1]
          Length = 172

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 62/121 (51%), Gaps = 2/121 (1%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
           S   +T +I  +P D N+ G+++GG ++  +D    I A +  + +VVT ++  L F  P
Sbjct: 18  SESDVTSEIIVLPGDTNMFGDLYGGRLVEWMDNIGSITAFKHSRKKVVTGSIDNLFFLSP 77

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           I++  +VH+++ +    K+++ I  DV     N  +     T  A    VA+DE G+   
Sbjct: 78  IKLGYIVHLHSFVTYTTKSTMEIEIDV--SSENVITSNSNVTTRAFFTYVALDENGHATE 135

Query: 149 I 149
           I
Sbjct: 136 I 136


>gi|303248338|ref|ZP_07334599.1| thioesterase superfamily protein [Desulfovibrio fructosovorans JJ]
 gi|302490246|gb|EFL50160.1| thioesterase superfamily protein [Desulfovibrio fructosovorans JJ]
          Length = 174

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 64/136 (47%), Gaps = 9/136 (6%)

Query: 14  NIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKC 73
           N +T K V       S+  + +  + +P D N  GNV GG I+  ID A GI A +  + 
Sbjct: 7   NPLTAKPV-------SASRVVMPQRMLPPDANPAGNVHGGVILKYIDTAGGIAAIRHARS 59

Query: 74  RVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEA 133
            VVT ++  + F KP  + ++V     +  +G TS+ +   V  C  N  +   +    A
Sbjct: 60  AVVTASIDRMDFLKPAYIGEVVTFMASVNYVGSTSMEVGVRV-EC-ENPMTGETRHAGSA 117

Query: 134 TVVMVAVDEKGNPKSI 149
            +  VA+D +  P ++
Sbjct: 118 YLTYVALDAERRPHAV 133


>gi|149181151|ref|ZP_01859650.1| hypothetical protein BSG1_11506 [Bacillus sp. SG-1]
 gi|148851050|gb|EDL65201.1| hypothetical protein BSG1_11506 [Bacillus sp. SG-1]
          Length = 167

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 55/113 (48%), Gaps = 14/113 (12%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  G +FGG +MS ID    I A ++ +  VVT +   + F KPI+V D V +  
Sbjct: 19  LPPDTNHHGTLFGGKLMSYIDDVASISAYKMARNPVVTASTDSVDFLKPIKVGDAVTLEA 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVV------MVAVDEKGNP 146
            +   G +S+ +      C +  S ++L  T E  V        VA+D  GNP
Sbjct: 79  MVTYTGSSSMEV------CVKVTSENLL--TGETAVAAISFLTFVALDNNGNP 123


>gi|320168087|gb|EFW44986.1| acyl-CoA thioesterase 11 [Capsaspora owczarzaki ATCC 30864]
          Length = 432

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 56/111 (50%), Gaps = 2/111 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P+  +  G  FGG I+S ID+  GI A +L +   VT +V  + F KP  V D++ +  
Sbjct: 76  LPSHADTRGVCFGGQILSWIDLTAGIAAKKLARGPCVTASVDSVQFLKPSVVGDVIILSA 135

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
            + +   TS+ I   V T   +  S   +  C A +  V++D +G P  +R
Sbjct: 136 MVNRTFNTSMEIGVRVET--ESMRSGERKYCCSAYLTFVSIDAQGRPAPVR 184



 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 58/111 (52%), Gaps = 3/111 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCK-CRVVTKAVTELLFEKPIQVSDLVHIY 98
           +P + N  G  FGG IM+ I+    I AS+LC+   +++ +V  L F  P +V D+V+I 
Sbjct: 261 LPGNANTVGVTFGGDIMAWIERCAYISASRLCRNVHLLSASVDSLHFLNPTRVGDIVYIT 320

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           + +     +S+ +   V+    N  +  ++   +A + +V VDE G P  I
Sbjct: 321 SMVTAAFTSSIEVLISVYG--ENPLTGDIKHCNDAFMTLVTVDESGVPLRI 369


>gi|89092728|ref|ZP_01165681.1| Thioesterase superfamily protein [Oceanospirillum sp. MED92]
 gi|89083240|gb|EAR62459.1| Thioesterase superfamily protein [Oceanospirillum sp. MED92]
          Length = 189

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 58/120 (48%), Gaps = 8/120 (6%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGW---IMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           +T+ +   P   N  G V GG    I+ Q+  AC   AS      VVT +V ++ F+ P+
Sbjct: 15  ITMTMLMTPDMANFSGKVHGGALLKILDQVAYAC---ASHYSGNYVVTLSVDQVYFKAPV 71

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           QV +LV  Y+ I  +G +++ +   V     N  S   + T      MVAVD +GN  ++
Sbjct: 72  QVGELVTFYSSINHVGNSTMEVGVKV--IAENIHSGERRHTISCFFTMVAVDAEGNAAAV 129


>gi|296158282|ref|ZP_06841114.1| thioesterase superfamily protein [Burkholderia sp. Ch1-1]
 gi|295891618|gb|EFG71404.1| thioesterase superfamily protein [Burkholderia sp. Ch1-1]
          Length = 168

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 58/116 (50%), Gaps = 10/116 (8%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQID---IAC-GIRASQLCKCRVVTKAVTELLFEKPIQ 90
            +    PT VN  G V GG +M  ID    AC  + + + C    VT +V  + F +PI 
Sbjct: 16  FRFLAEPTSVNFGGKVHGGALMKWIDETAYACSAVWSGRYC----VTVSVGNIRFRRPIL 71

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           V +LV +  ++   G+TS+ I+  V     +     L +T +  +VMVAV+E G P
Sbjct: 72  VGNLVELRARVVATGRTSMHIHVSVQAG--DPKGGELLQTTDCLIVMVAVNENGQP 125


>gi|153206107|ref|ZP_01945370.1| thioesterase family protein [Coxiella burnetii 'MSU Goat Q177']
 gi|165918276|ref|ZP_02218362.1| thioesterase family protein [Coxiella burnetii RSA 334]
 gi|212217769|ref|YP_002304556.1| acyl-CoA hydrolase [Coxiella burnetii CbuK_Q154]
 gi|120577237|gb|EAX33861.1| thioesterase family protein [Coxiella burnetii 'MSU Goat Q177']
 gi|165918136|gb|EDR36740.1| thioesterase family protein [Coxiella burnetii RSA 334]
 gi|212012031|gb|ACJ19411.1| acyl-CoA hydrolase [Coxiella burnetii CbuK_Q154]
          Length = 146

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 2/109 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P  VN  GN+ GG+I+  ID      A++     VVT +V  +LF++PI + +LV  Y  
Sbjct: 3   PKKVNFAGNIHGGYILKLIDQTAYACAARYSGHYVVTLSVDGVLFKQPIYLGELVTCYAM 62

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           I  +G+TS+ +   +     N  +   + T    V MVAVD    P ++
Sbjct: 63  INYVGRTSMEV--GIKVVAENLITGEKRHTNSCYVTMVAVDSNLKPVAV 109


>gi|228471998|ref|ZP_04056766.1| acyl-coenzyme a thioesterase 11 [Capnocytophaga gingivalis ATCC
           33624]
 gi|228276610|gb|EEK15323.1| acyl-coenzyme a thioesterase 11 [Capnocytophaga gingivalis ATCC
           33624]
          Length = 177

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P + N  GN+FGG +++++D    I A +   C VVT AV  + F K I    +V +  
Sbjct: 21  LPNETNHYGNMFGGELLARMDRVGTIAAVRHSGCVVVTAAVNSVSFNKTIPQGSVVTVEA 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            I +   +S+ +Y DVW    ++ S    K+ EA    VA++ +  P
Sbjct: 81  SISRAFTSSMEVYIDVWV--EDSVSGERIKSNEAIYTFVALNAEDKP 125


>gi|258404822|ref|YP_003197564.1| thioesterase superfamily protein [Desulfohalobium retbaense DSM
           5692]
 gi|257797049|gb|ACV67986.1| thioesterase superfamily protein [Desulfohalobium retbaense DSM
           5692]
          Length = 155

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  G++ GG IM  ID A G+ A +  +   VT ++  L F  P ++ +L+ +  
Sbjct: 18  LPQDANPAGSIHGGVIMKHIDTAGGVAAIRHVRGNAVTASIDRLDFHIPAKIGELLILKA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +  +G+ S+ +   V T   +  +  L+    A +  VA++++G+P  +
Sbjct: 78  SVNGVGRRSLEVGVRVET--EDLFTGDLRHCASAYLTFVALNQEGHPTGV 125


>gi|297570072|ref|YP_003691416.1| thioesterase superfamily protein [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925987|gb|ADH86797.1| thioesterase superfamily protein [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 179

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  G V GG +M  ID A  + A +  +  VVT ++  L F  P+ + +L+ +  
Sbjct: 26  LPQDANPAGIVHGGVVMKHIDDAAYVCARRHTRFNVVTASIDRLDFHNPVFIGNLLTLRA 85

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            I  +G TS+ +  +V +   +  +  +  T  A +  VA+DE  +P+ I
Sbjct: 86  SINLVGTTSMEVGVNVES--EDLQTGRISHTASAYLTFVALDENYHPRPI 133


>gi|302387637|ref|YP_003823459.1| thioesterase superfamily protein [Clostridium saccharolyticum WM1]
 gi|302198265|gb|ADL05836.1| thioesterase superfamily protein [Clostridium saccharolyticum WM1]
          Length = 157

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 56/107 (52%), Gaps = 3/107 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP+ +N  G +FGG ++  ID+   I A +  +C   T A+  L F+    ++D + +  
Sbjct: 19  MPSHINGSGRLFGGQLLEWIDVVGAITAKRHAECNTTTVAIDNLQFKAGAFINDTIVLIG 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++  +G TS+ +  D ++      S + +    A +V VA++E+G P
Sbjct: 79  RLTYVGNTSMEVRVDTYS---EDLSGLRKPINRAYLVYVAINEEGTP 122


>gi|149371328|ref|ZP_01890814.1| long-chain acyl-CoA thioester hydrolase family protein
           [unidentified eubacterium SCB49]
 gi|149355466|gb|EDM44025.1| long-chain acyl-CoA thioester hydrolase family protein
           [unidentified eubacterium SCB49]
          Length = 130

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 60/107 (56%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    + A  QL   R VTK ++E+ F+   +  D++ I  
Sbjct: 11  PEDLNPNGTLFGGRLLEWIDEEAALYAIIQLENQRTVTKYMSEINFKSSAKKGDIIEIGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
             +K G +S+T+ C+V    RN  +  +  T + T++MV++ + G P
Sbjct: 71  APKKFGNSSLTLACEV----RNKMTREVIITVD-TIIMVSLGDNGKP 112


>gi|326382738|ref|ZP_08204428.1| 4-hydroxybenzoyl-CoA thioesterase [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326198328|gb|EGD55512.1| 4-hydroxybenzoyl-CoA thioesterase [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 322

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           + +    PTDVN  GN  GG +M  ID    +  +Q C+   VT  +  + F +PI++  
Sbjct: 169 STRFLAAPTDVNWGGNTHGGRVMGWIDDVAYLCGTQWCRGEAVTVYMGGVRFYEPIRIGQ 228

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWT-CPRNASSDVLQKTCEATVVMVAVDEKGN 145
           +V    ++   G+ ++ +   V+   PR+   D  + T  +  V+ A+DE G+
Sbjct: 229 VVETSARLIHTGRQTMHVSVHVYAYWPRDGRRD-RRLTAHSLTVLAALDEHGD 280



 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 57/120 (47%), Gaps = 5/120 (4%)

Query: 33  LTLKIQTMPTDV-NLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
           +TL+    PTDV  L G V GG I+  +D A    A+       VT  V  + F + I  
Sbjct: 8   ITLRFMAAPTDVATLGGGVRGGRILEWVDKAAYACAAAWSGGYSVTAYVGNISFGRDIAS 67

Query: 92  SDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
            D+V +   +   G++S+ I C V +  PR        +     +V VAVD++G P ++R
Sbjct: 68  GDVVEVTATLVHTGRSSMHIECRVASADPRRGQ---FTEASRCMLVFVAVDDEGRPTAVR 124


>gi|302342827|ref|YP_003807356.1| thioesterase superfamily protein [Desulfarculus baarsii DSM 2075]
 gi|301639440|gb|ADK84762.1| thioesterase superfamily protein [Desulfarculus baarsii DSM 2075]
          Length = 167

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 2/112 (1%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           Q MP D N  GNV GG I+  ID   G+ A +     VVT ++  L F +P  V D++ +
Sbjct: 16  QMMPHDANPYGNVHGGVIVKLIDTTGGVVALRHAGRNVVTASIDRLDFLQPAFVGDILIL 75

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              +  +G +S+ + C V     N  +  ++    A +  VA+D  G P ++
Sbjct: 76  KASLNLVGSSSMEVGCRVEA--ENPITGQVRHAASAYLTYVALDADGRPTAV 125


>gi|326336425|ref|ZP_08202595.1| thioesterase domain protein [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325691298|gb|EGD33267.1| thioesterase domain protein [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 177

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 55/108 (50%), Gaps = 4/108 (3%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P + N  GN+FGG +++++D    I A +     VVT AV  + F K I    +V +  
Sbjct: 21  LPNETNHYGNMFGGELLARMDRVGTIAAVRHSGNVVVTAAVNSVSFNKTIPQGSMVTVEA 80

Query: 100 QIRKIGKTSVTIYCDVW-TCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            + +   +S+ +Y DVW   P N +     K+ EA    VA+++ G P
Sbjct: 81  MVSRAFTSSMEVYIDVWVEDPENGNR---VKSNEAIYTFVALNKAGQP 125


>gi|326202006|ref|ZP_08191876.1| thioesterase superfamily protein [Clostridium papyrosolvens DSM
           2782]
 gi|325987801|gb|EGD48627.1| thioesterase superfamily protein [Clostridium papyrosolvens DSM
           2782]
          Length = 159

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP  +N    +FGG +M  ID+   + A +   C V T ++  L F+ P  V+  + +  
Sbjct: 21  MPEHINGFNRLFGGKLMEWIDVVAAVVARRHSGCNVTTASIDNLQFKAPAYVNSTIFLLG 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           QI  +G TS+ +  D +    N +  ++ +   A +V+VA+D    P
Sbjct: 81  QITYVGNTSMEVRVDTFVEELNGTRRMINR---AYLVLVALDNNDLP 124


>gi|167570738|ref|ZP_02363612.1| thioesterase family protein [Burkholderia oklahomensis C6786]
          Length = 144

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 44  VNLDGNVFGGWIMSQID---IACG-IRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +N  G V GG +M  ID    AC  I +S+ C    VT +V  + F++PI V +LV +  
Sbjct: 1   MNFGGKVHGGALMKWIDETAYACAAIWSSRYC----VTVSVGNIRFQRPILVGNLVELKA 56

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           ++   G+TS+ I+  V     +    VL++T +  VV VAVDE GN
Sbjct: 57  RVVATGRTSMHIHVSVHAG--DPKGGVLRQTTDCLVVFVAVDENGN 100


>gi|284163345|ref|YP_003401624.1| thioesterase superfamily protein [Haloterrigena turkmenica DSM
           5511]
 gi|284013000|gb|ADB58951.1| thioesterase superfamily protein [Haloterrigena turkmenica DSM
           5511]
          Length = 151

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 4/112 (3%)

Query: 36  KIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLV 95
           + +  P   N +  + GG +M  +D    + A +      VT  V EL FE+PI + D  
Sbjct: 12  RYRVQPNHANNNETLHGGNLMKWLDEIGAMSAMRFAGETCVTARVNELDFERPIGIGDTA 71

Query: 96  HIYTQIRKIGKTSVTIYCDVW-TCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +   +   G+ SV +    W   PR   +   ++T E++   VA+DE G+P
Sbjct: 72  MVEAFVYDAGRRSVHVGLRAWREEPRTGET---ERTTESSFTFVAIDESGSP 120


>gi|268680063|ref|YP_003304494.1| thioesterase superfamily protein [Sulfurospirillum deleyianum DSM
           6946]
 gi|268618094|gb|ACZ12459.1| thioesterase superfamily protein [Sulfurospirillum deleyianum DSM
           6946]
          Length = 161

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 55/114 (48%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   NL GNV GG I+  +D      AS+ C   VVT +V +++F+ P+ V 
Sbjct: 11  LTMSVLMTPDKANLAGNVHGGDILKLLDQVAYACASRYCGHYVVTMSVDQVIFKHPVSVG 70

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            L+     +   GKTS+ +   V +      + +   +C  T+V +  D K  P
Sbjct: 71  SLLTFLASVNYTGKTSMEVGIKVISEDIQKGTTMHTNSCFFTMVAIGKDGKPTP 124


>gi|68535421|ref|YP_250126.1| putative acyl-CoA hydrolase [Corynebacterium jeikeium K411]
 gi|68263020|emb|CAI36508.1| putative acyl-CoA hydrolase [Corynebacterium jeikeium K411]
          Length = 343

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 60/122 (49%), Gaps = 6/122 (4%)

Query: 33  LTLKIQTMPTDVNLDG--NVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           +TL+    PTDV + G   V GG ++  ID A    A    +   VT  V  + F +PI 
Sbjct: 22  VTLRFLAAPTDVLMAGAMGVHGGRVLEWIDKAAYACAVGWAQSYCVTAYVGHIHFTRPIP 81

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              +V + ++I   G++S+ I  +V +  PR     V  + C+  V+ VA+DE G  K I
Sbjct: 82  SGHMVEVRSRIAYTGRSSMHIVNEVLSADPREG---VFTRACDCLVIFVALDENGKSKQI 138

Query: 150 RT 151
            T
Sbjct: 139 PT 140



 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 50/111 (45%), Gaps = 2/111 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           PTDVN  GNV GG  M  ID A      Q    R        + F +P+ + DLV +  +
Sbjct: 191 PTDVNWGGNVHGGTAMEWIDEAATACTMQWTGERTTAVYAGGIRFYRPVHIGDLVEVDAR 250

Query: 101 IRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           + +  + S+T+   +    PR    + L     A++  +A+D  GNP   R
Sbjct: 251 LVRTDERSMTVMVHLRAGDPREGKGN-LPVAIHASMTYIAIDLDGNPLQAR 300


>gi|225873329|ref|YP_002754788.1| thioesterase domain protein [Acidobacterium capsulatum ATCC 51196]
 gi|225792296|gb|ACO32386.1| thioesterase domain protein [Acidobacterium capsulatum ATCC 51196]
          Length = 182

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 53/105 (50%), Gaps = 2/105 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  GN+ GG +M  ID+   + A +  +  VVT ++  + F  P+ V DL+ + +
Sbjct: 25  LPNDTNTLGNLLGGRLMHFIDLVGAMAAYRHSRTHVVTASMDHIDFIAPVHVGDLLILKS 84

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
            + +   TS+ +   +W    N  + + +    A +  VAVD +G
Sbjct: 85  SVNRAFNTSMEVGVKIWV--ENTIAGMHRHVASAYLTFVAVDSQG 127


>gi|227356047|ref|ZP_03840438.1| acyl-CoA hydrolase [Proteus mirabilis ATCC 29906]
 gi|227163824|gb|EEI48732.1| acyl-CoA hydrolase [Proteus mirabilis ATCC 29906]
          Length = 140

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            PT  N    +FGG  ++ +D    I A++ C+ R+VT +  ++ F  PI    ++ +  
Sbjct: 26  FPTTTNHHSTLFGGTALAWMDEVSFITATRFCRKRLVTVSTEKINFNHPIPSGTIIELVG 85

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ ++G+TS+T+   ++    +  ++  ++        VAVDE G P
Sbjct: 86  EVIRVGRTSLTVNVSIFL--EDMYAEGREEVIHGQFNFVAVDEHGKP 130


>gi|239997064|ref|ZP_04717588.1| Thioesterase superfamily protein [Alteromonas macleodii ATCC 27126]
          Length = 185

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P+  N  G V GG I+S +D      AS+      VT  V  + F +P++V DL+H+  
Sbjct: 18  VPSFANFGGKVHGGVILSLMDKVAYACASKHAGAYCVTVTVDGVEFLQPVEVGDLLHLDA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +  +G TS+ +   V T   N  ++ ++ T  +   MVA D+ G P S+
Sbjct: 78  TVHYVGNTSLVVGIKVTT--ENIKTNEVKHTNNSFFTMVAKDDSGTPVSV 125


>gi|289581535|ref|YP_003480001.1| thioesterase superfamily protein [Natrialba magadii ATCC 43099]
 gi|289531088|gb|ADD05439.1| thioesterase superfamily protein [Natrialba magadii ATCC 43099]
          Length = 145

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 52/112 (46%), Gaps = 4/112 (3%)

Query: 36  KIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLV 95
           + +  P   N +  + GG +M  +D    + A +      VT  V EL FE+PI++ D  
Sbjct: 12  RFRVQPNHANNNATLHGGTLMKWLDEVGAMSAMRFAGETCVTARVNELDFERPIRIGDTA 71

Query: 96  HIYTQIRKIGKTSVTIYCDVW-TCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +   +   G+TSV +    W   PR+  +   ++T  ++   VA+DE   P
Sbjct: 72  LVEAYVYDSGRTSVHVALRAWREEPRSGET---ERTTASSFTFVAIDEDNTP 120


>gi|58177025|pdb|1VPM|A Chain A, Crystal Structure Of Acyl-Coa Hydrolase (Np_241664.1) From
           Bacillus Halodurans At 1.66 A Resolution
 gi|58177026|pdb|1VPM|B Chain B, Crystal Structure Of Acyl-Coa Hydrolase (Np_241664.1) From
           Bacillus Halodurans At 1.66 A Resolution
 gi|58177027|pdb|1VPM|C Chain C, Crystal Structure Of Acyl-Coa Hydrolase (Np_241664.1) From
           Bacillus Halodurans At 1.66 A Resolution
          Length = 169

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 56/116 (48%), Gaps = 5/116 (4%)

Query: 37  IQT---MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           IQT   +P D N  G +FGG +++ ID    + A +     VVT ++  + F+    V D
Sbjct: 25  IQTRLVLPPDTNHLGTIFGGKVLAYIDEIAALTAXKHANSAVVTASIDSVDFKSSATVGD 84

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            + +   +   G+TS  +Y  V +   N  +     T E+ +  VAVDE G PK +
Sbjct: 85  ALELEGFVTHTGRTSXEVYVRVHSN--NLLTGERTLTTESFLTXVAVDESGKPKPV 138


>gi|294670907|ref|ZP_06735763.1| hypothetical protein NEIELOOT_02611 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307394|gb|EFE48637.1| hypothetical protein NEIELOOT_02611 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 141

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP   N  GNV GG ++  +D      AS+      VT +V ++LF++PI V DLV  Y 
Sbjct: 1   MPDTANFSGNVHGGELLRLLDQVAYSCASRYSGNYCVTLSVDKVLFKEPIHVGDLVTFYA 60

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +   G+TS+ I   V    +N  +  ++ T      MVAV E G P
Sbjct: 61  SVNYTGRTSMEIGIRVEA--QNIRTGEVRHTNSCYFTMVAV-ENGKP 104


>gi|24214864|ref|NP_712345.1| acyl-CoA hydrolase [Leptospira interrogans serovar Lai str. 56601]
 gi|45657624|ref|YP_001710.1| acyl-CoA hydrolase [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|24195883|gb|AAN49363.1| acyl-CoA hydrolase [Leptospira interrogans serovar Lai str. 56601]
 gi|45600864|gb|AAS70347.1| acyl-CoA hydrolase [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 140

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 61/108 (56%), Gaps = 3/108 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCK-CRVVTKAVTELLFEKPIQVSDLVHIY 98
           M  D+N  G +FGG +++ ID  C +   +  +   +VT ++ +++F+ P  + D++ I+
Sbjct: 21  MSRDLNQHGFLFGGQMLAWIDEGCAMFVMEKIRYSNIVTVSMADVVFKSPGLLGDIIQIF 80

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++I KIG +S+TI     +  ++ S   L++  +  +  V +DE G P
Sbjct: 81  SKIDKIGNSSITIRNT--SIGKSQSRKELKEIIDCKITYVCLDENGKP 126


>gi|29655084|ref|NP_820776.1| thioesterase family protein [Coxiella burnetii RSA 493]
 gi|161830222|ref|YP_001597620.1| thioesterase family protein [Coxiella burnetii RSA 331]
 gi|212211832|ref|YP_002302768.1| acyl-CoA hydrolase [Coxiella burnetii CbuG_Q212]
 gi|29542353|gb|AAO91290.1| acyl-CoA hydrolase [Coxiella burnetii RSA 493]
 gi|161762089|gb|ABX77731.1| thioesterase family protein [Coxiella burnetii RSA 331]
 gi|212010242|gb|ACJ17623.1| acyl-CoA hydrolase [Coxiella burnetii CbuG_Q212]
          Length = 146

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 2/109 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P  VN  GN+ GG+I+  ID      A++     VVT +V  +LF++PI + +LV  Y  
Sbjct: 3   PEKVNFAGNIHGGYILKLIDQTAYACAARYSGHYVVTLSVDGVLFKQPIYLGELVTCYAM 62

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           I  +G+TS+ +   +     N  +   + T    V MVAVD    P ++
Sbjct: 63  INYVGRTSMEV--GIKVVAENLITGEKRHTNSCYVTMVAVDTNLKPVAV 109


>gi|237784999|ref|YP_002905704.1| putative acyl-CoA hydrolase [Corynebacterium kroppenstedtii DSM
           44385]
 gi|237757911|gb|ACR17161.1| putative acyl-CoA hydrolase [Corynebacterium kroppenstedtii DSM
           44385]
          Length = 352

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 54/123 (43%), Gaps = 10/123 (8%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L  +    P DVN  G V GG  M+ ID A      +    R V      + F +PIQ+ 
Sbjct: 193 LVTRFMAKPQDVNWGGKVHGGTAMAWIDEAATACTMEFAGHRTVAVYAGGIRFYRPIQIG 252

Query: 93  DLVH-----IYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           DL+      I T  R + +TSV +Y      PR   S  ++    A+   + +DE GNP 
Sbjct: 253 DLIEADARIIRTDTRSM-QTSVHVYAG---DPREGRSG-MKLAIHASAAYMGIDEDGNPL 307

Query: 148 SIR 150
           + R
Sbjct: 308 AAR 310



 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 63/129 (48%), Gaps = 12/129 (9%)

Query: 28  HSSG----VLTLKIQTMPTDVNLDG--NVFGGWIMSQIDIACGIRASQLCKCRVVTKAVT 81
           H++G     +TL+    P D+ L G   V GG ++  ID A    A        VT  V 
Sbjct: 23  HATGRRNNSVTLRFLAAPNDILLAGAMGVHGGRVLEWIDKAAYACAVGWSGAYCVTAYVG 82

Query: 82  ELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAV 140
            + F +PI    LV + + I   G++S+ I  +V++  PR+ S     + C+  V+ VA+
Sbjct: 83  HIHFTRPIPSGHLVEVKSTIAYTGRSSMHIVNEVFSADPRDGS---FSRACDCLVIFVAL 139

Query: 141 DEKGNPKSI 149
           DE G  KSI
Sbjct: 140 DEHG--KSI 146


>gi|226941476|ref|YP_002796550.1| Thioesterase superfamily protein [Laribacter hongkongensis HLHK9]
 gi|226716403|gb|ACO75541.1| Thioesterase superfamily protein [Laribacter hongkongensis HLHK9]
          Length = 153

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 55/114 (48%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG I+  +D      A++     VVT +V ++ F++PI V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGAILKLLDQVAYACAARYAGQYVVTLSVDQVTFKQPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++V     +  +G++S+ I   V     N    V++ T      MVAVD  G P
Sbjct: 68  EMVSFLASVNYVGRSSMEIGIKV--IAENIHDRVVRHTNSCYFTMVAVDGHGRP 119


>gi|91790407|ref|YP_551359.1| thioesterase superfamily protein [Polaromonas sp. JS666]
 gi|91699632|gb|ABE46461.1| thioesterase superfamily [Polaromonas sp. JS666]
          Length = 149

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 2/113 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P+ VN  G V GG +M  ID A    A+   K   VT +V  + F++PI + 
Sbjct: 4   ITLRFLAEPSTVNFGGKVHGGTVMKWIDEAGYACATSWAKRYCVTVSVGTIRFQRPIMIG 63

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           DLV +  ++   G+TS+ I  +V     +  +  ++   +  VV VAVD  G 
Sbjct: 64  DLVEVQARLAYTGRTSMNISVEVRAG--DMKTGHMEVITDCLVVFVAVDAAGQ 114


>gi|224368892|ref|YP_002603054.1| Acyl-CoA thioester hydrolase [Desulfobacterium autotrophicum HRM2]
 gi|223691609|gb|ACN14892.1| Acyl-CoA thioester hydrolase [Desulfobacterium autotrophicum HRM2]
          Length = 168

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 44/85 (51%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL     P D N  G V GG IM QID A G+ A +  K   VT ++  L F  P+Q+ 
Sbjct: 11  VTLSQVMQPQDANPAGLVHGGVIMKQIDNAAGVVAVRHTKKICVTASIDRLDFHNPVQIG 70

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWT 117
           +LV     I  +G+TS+ I   V T
Sbjct: 71  NLVTFQASINNVGETSMEIGVRVET 95


>gi|71065304|ref|YP_264031.1| acyl-CoA thioester hydrolase-related protein [Psychrobacter
           arcticus 273-4]
 gi|71038289|gb|AAZ18597.1| probable acyl-CoA thioester hydrolase-related protein
           [Psychrobacter arcticus 273-4]
          Length = 187

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +PI V 
Sbjct: 19  LYMSVLMTPDMANFIGNVHGGDLLKMLDQVAYACASRYSGSYVVTLSVDQVMFREPIYVG 78

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +LV     I  +GKTS+ +   V     +  +  ++ T      MVA+D+KG P
Sbjct: 79  ELVTFAASINYVGKTSMEVGIRVEA--EDVRARKVRHTNSCYFTMVAIDDKGKP 130


>gi|332140843|ref|YP_004426581.1| Thioesterase superfamily protein [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327550865|gb|AEA97583.1| Thioesterase superfamily protein [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 185

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P+  N  G V GG I+S +D      AS+      VT  V  + F +P++V DL+H+  
Sbjct: 18  VPSFANFGGKVHGGVILSLMDKVAYACASKHAGAYCVTVTVDGVEFLQPVEVGDLLHLDA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +  +G TS+ +   V T   N  ++ ++ T  +   MVA D+ G P S+
Sbjct: 78  TVHYVGNTSLVVGIKVTT--ENIKTNEVKHTNNSFFTMVAKDDSGTPVSV 125


>gi|255065221|ref|ZP_05317076.1| thioesterase family protein [Neisseria sicca ATCC 29256]
 gi|255050642|gb|EET46106.1| thioesterase family protein [Neisseria sicca ATCC 29256]
          Length = 160

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP   N  GNV GG ++  +D      AS+      VT +V ++LF++PI V DLV  Y 
Sbjct: 19  MPDTANFSGNVHGGELLRLLDQVAYSCASRYSGNYCVTLSVDKVLFKEPIHVGDLVTFYA 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +   G+TS+ I   V    +N  +  ++ T      MVAV E G P
Sbjct: 79  SVNYTGRTSMEIGIRVEA--QNIRTGEVRHTNSCYFTMVAV-EDGKP 122


>gi|261365630|ref|ZP_05978513.1| thioesterase family protein [Neisseria mucosa ATCC 25996]
 gi|288565868|gb|EFC87428.1| thioesterase family protein [Neisseria mucosa ATCC 25996]
          Length = 160

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP   N  GNV GG ++  +D      AS+      VT +V ++LF++PI V DLV  Y 
Sbjct: 19  MPDTANFSGNVHGGELLRLLDQVAYSCASRYSGNYCVTLSVDKVLFKEPIHVGDLVTFYA 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +   G+TS+ I   V    +N  +  ++ T      MVAV E G P
Sbjct: 79  SVNYTGRTSMEIGIRVEA--QNIRTGEVRHTNSCYFTMVAV-EDGKP 122


>gi|83648168|ref|YP_436603.1| acyl-CoA hydrolase [Hahella chejuensis KCTC 2396]
 gi|83636211|gb|ABC32178.1| Acyl-CoA hydrolase [Hahella chejuensis KCTC 2396]
          Length = 162

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 57/119 (47%), Gaps = 2/119 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LTL+    PTDVN  G V GG +M  ID+A    A+       VT  V  + F  PI + 
Sbjct: 11  LTLQFLAEPTDVNFGGKVHGGVVMKWIDLAGYACAAGWSGRYCVTAYVGGIRFICPIHIG 70

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
            LV +  ++   G++S+ +  DV+   R+      +K     ++ VA+D  G P  + T
Sbjct: 71  MLVEVQAKVIYTGQSSMHLAIDVYC--RDPIEQERKKATHCIMIFVAIDRDGKPVRVPT 127


>gi|298368736|ref|ZP_06980054.1| thioesterase family protein [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282739|gb|EFI24226.1| thioesterase family protein [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 161

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP   N  GNV GG ++  +D      AS+      VT +V ++LF++PI V DLV  Y 
Sbjct: 19  MPDTANFSGNVHGGELLRLLDQVAYSCASRYSGNYCVTLSVDKVLFKEPIHVGDLVTFYA 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +   G+TS+ I   V    +N  +  ++ T      MVAV E G P
Sbjct: 79  SVNYTGRTSMEIGIRVEA--QNIRTGEVRHTNSCYFTMVAV-EDGKP 122


>gi|56478915|ref|YP_160504.1| putative thioesterase [Aromatoleum aromaticum EbN1]
 gi|56314958|emb|CAI09603.1| conserved hypothetical protein, putative thioesterase [Aromatoleum
           aromaticum EbN1]
          Length = 161

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 2/112 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI V 
Sbjct: 8   LAMTVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYAGHYVVTLSVDQVMFRQPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           +LV     +   GKTS+ +   V     N    V++        MVAVD+ G
Sbjct: 68  ELVSFLASVNYTGKTSMEVGIKVLA--ENIREKVVRHANSCFFTMVAVDDDG 117


>gi|241768131|ref|ZP_04765604.1| thioesterase superfamily protein [Acidovorax delafieldii 2AN]
 gi|241360510|gb|EER57592.1| thioesterase superfamily protein [Acidovorax delafieldii 2AN]
          Length = 151

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 54/114 (47%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG I+  +D      AS+   C VVT +V +++F +PI V 
Sbjct: 8   LSMTVLMSPDMANFSGNVHGGAILKLLDQVAYSCASRFSACYVVTLSVDQVMFLQPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +LV     +   G +S+ +   V     +  S V++        MVAVDE   P
Sbjct: 68  ELVTFLASVNYTGSSSMEVGIKVIA--EDIRSQVVRHVNSCFFTMVAVDEARKP 119


>gi|296392384|ref|ZP_06881859.1| putative acyl-CoA thioester hydrolase [Pseudomonas aeruginosa PAb1]
 gi|313111540|ref|ZP_07797339.1| putative acyl-CoA thioester hydrolase [Pseudomonas aeruginosa
           39016]
 gi|310883841|gb|EFQ42435.1| putative acyl-CoA thioester hydrolase [Pseudomonas aeruginosa
           39016]
          Length = 160

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 58/118 (49%), Gaps = 2/118 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           +LV     +   G+TS+ I   V T   N     ++ T      MVA+D++  P ++R
Sbjct: 68  ELVTFLASVNYTGRTSMEIGVKVIT--ENIREQSVRHTNSCFFTMVALDDERKPVAVR 123


>gi|332878315|ref|ZP_08446041.1| thioesterase family protein [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332683766|gb|EGJ56637.1| thioesterase family protein [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 179

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P + N    +FGG +++++D A  I + +      VT +V  + F   I+V  +V +  
Sbjct: 23  LPGETNHLKAMFGGELLARMDRAASIASQRHSNRATVTVSVNHVAFTHSIRVGSVVTVEA 82

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            I +   TS+ +Y DVW    N   + + K  EA    VAVDE G P
Sbjct: 83  AISRAFSTSMEVYIDVWM--ENMFGERI-KATEAIYSFVAVDENGRP 126


>gi|197285550|ref|YP_002151422.1| thioesterase superfamilyl protein [Proteus mirabilis HI4320]
 gi|194683037|emb|CAR43527.1| thioesterase superfamilyl protein [Proteus mirabilis HI4320]
          Length = 140

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 53/107 (49%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            PT  N    +FGG  ++ +D    I A++ C+ R+VT +  ++ F  PI    ++ +  
Sbjct: 26  FPTTTNHHSTLFGGTALAWMDEVSFITATRFCRKRLVTVSTEKINFNHPIPSGTIIELVG 85

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ ++G+TS+T+   ++     A     ++        VAVDE G P
Sbjct: 86  EVIRVGRTSLTVNVSIFLEEMYAEGR--EEVIHGQFNFVAVDEHGKP 130


>gi|313677474|ref|YP_004055470.1| thioesterase superfamily protein [Marivirga tractuosa DSM 4126]
 gi|312944172|gb|ADR23362.1| thioesterase superfamily protein [Marivirga tractuosa DSM 4126]
          Length = 129

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 52/107 (48%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N    +FGG  +  +D    I A++  + ++VT +  ++ F K I    +V +  
Sbjct: 21  FPNTTNHYDTLFGGTALQWMDEVAFITATRYSRQKMVTVSSDKIDFNKAIPAGTIVELVG 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           QI K+G TS+ +  DV+T      SD  +K+      MVA+DE   P
Sbjct: 81  QIEKVGNTSLEVRVDVFT--EEMYSDHREKSISGRFTMVAIDEHKKP 125


>gi|89097429|ref|ZP_01170318.1| acyl-CoA hydrolase [Bacillus sp. NRRL B-14911]
 gi|89087725|gb|EAR66837.1| acyl-CoA hydrolase [Bacillus sp. NRRL B-14911]
          Length = 157

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 54/113 (47%), Gaps = 5/113 (4%)

Query: 37  IQT---MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           IQT   +P D N    +FGG ++S ID    I A +     VVT ++  + F     V D
Sbjct: 13  IQTRLVLPPDTNHLQTIFGGKVLSYIDEIAAITAMKHSGSMVVTASIDSVDFLSSASVGD 72

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            + +   +   G+TS+ +Y  V     N  + +   T E+ + MVAVDE G P
Sbjct: 73  ALTLEAFVASTGRTSMEVYVKVHAA--NLLTGIRTLTTESFLTMVAVDENGKP 123


>gi|163788514|ref|ZP_02182960.1| long-chain acyl-CoA thioester hydrolase family protein
           [Flavobacteriales bacterium ALC-1]
 gi|159876834|gb|EDP70892.1| long-chain acyl-CoA thioester hydrolase family protein
           [Flavobacteriales bacterium ALC-1]
          Length = 128

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 58/107 (54%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG +++ ID    +    QL   ++VTK ++E+ F    +  D+V I  
Sbjct: 11  PEDLNPNGTLFGGQLLAWIDEEAALYTIIQLENSKIVTKYISEINFMASAKQGDIVEIGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ K GK+S+T+ C+     RN  +     T +  ++MV + E G P
Sbjct: 71  EVTKFGKSSITMKCEA----RNKMTRETILTVD-NIIMVNLGEDGKP 112


>gi|306836833|ref|ZP_07469791.1| acyl-CoA hydrolase [Corynebacterium accolens ATCC 49726]
 gi|304567294|gb|EFM42901.1| acyl-CoA hydrolase [Corynebacterium accolens ATCC 49726]
          Length = 336

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 49/111 (44%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           PTDVN  G V GG  M  ID A      +    R V      + F KPI + DL+ +  +
Sbjct: 186 PTDVNWGGKVHGGTAMQWIDEAGTACTMEWSGERTVAVYAGGIRFYKPISIGDLIEVDAR 245

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           + +  + S+ +   V +       D L+    ATV  + +D  G P + RT
Sbjct: 246 MMRTDRRSMQMSVHVRSGDPRGGRDNLKTAIHATVAYIGMDRDGQPMTART 296



 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 24  VCQMHSSGVLTLKIQTMPTDVNLDG--NVFGGWIMSQIDIACGIRASQLCKCRVVTKAVT 81
             +   S  LTL+    PTDV + G   + GG ++  ID A    A Q      VT  V 
Sbjct: 7   AAETQKSPTLTLRFMASPTDVTMAGAPGINGGRVLEWIDKAAYACAVQWSGQYCVTAYVG 66

Query: 82  ELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAV 140
            + F +PI    +V + ++I   G++S+ I  +V +  PR     +  + C+  V+ VA 
Sbjct: 67  HIHFTRPIPSGHIVEVRSRIAMTGRSSMHIINEVLSADPREG---IFTRACDCLVIFVAK 123

Query: 141 DEKGN 145
           D + +
Sbjct: 124 DPESD 128


>gi|13541468|ref|NP_111156.1| Acyl-CoA hydrolase [Thermoplasma volcanium GSS1]
 gi|14324852|dbj|BAB59778.1| acyl coenzyme A thioester hydrolase [Thermoplasma volcanium GSS1]
          Length = 165

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D+++   ++GG +M  ID    I A++ C+ R VT ++  L F  PI + D+V ++ 
Sbjct: 18  LPEDMDIYEYLYGGRLMEWIDNCASIVATKHCRKRTVTGSIDSLFFLLPIHLGDMVLLHG 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            I    K+++ I  DV    +   + + +   +A +  VA+D  G P  I
Sbjct: 78  YINYTTKSTMEIEIDV--IKQEGLTGIRRYATKAYLTYVAIDADGRPTEI 125


>gi|116328131|ref|YP_797851.1| Acyl-CoA hydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116331416|ref|YP_801134.1| Acyl-CoA hydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|116120875|gb|ABJ78918.1| Acyl-CoA hydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116125105|gb|ABJ76376.1| Acyl-CoA hydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 140

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 61/108 (56%), Gaps = 3/108 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCK-CRVVTKAVTELLFEKPIQVSDLVHIY 98
           M  D+N  G +FGG +++ ID  C +   +  +   +VT ++ +++F+ P  + D++ I+
Sbjct: 21  MSRDLNQHGFLFGGQMLAWIDEGCAMYVMEKIRYSNIVTVSMADVVFKSPGLLGDIIQIF 80

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++I ++G +S+TI     +  ++ S   L++  +  V  V +DE G P
Sbjct: 81  SKIERMGNSSITIRNT--SIGKSQSRKELKEIIDCKVTYVCLDENGRP 126


>gi|28872180|ref|NP_794799.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213971876|ref|ZP_03399977.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Pseudomonas
           syringae pv. tomato T1]
 gi|237798157|ref|ZP_04586618.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|298485025|ref|ZP_07003122.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|301385280|ref|ZP_07233698.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Pseudomonas
           syringae pv. tomato Max13]
 gi|302063419|ref|ZP_07254960.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Pseudomonas
           syringae pv. tomato K40]
 gi|302131055|ref|ZP_07257045.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|28855434|gb|AAO58494.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213923360|gb|EEB56954.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Pseudomonas
           syringae pv. tomato T1]
 gi|298160435|gb|EFI01459.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|330878079|gb|EGH12228.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
 gi|330957001|gb|EGH57261.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. maculicola str. ES4326]
 gi|331015968|gb|EGH96024.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
 gi|331021009|gb|EGI01066.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 131

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
              + G+TS+T+ C V    RN  +     T E  +V V +DE G P
Sbjct: 71  TATEFGRTSITLKCQV----RNKITRKSILTVEK-IVFVNLDEDGQP 112


>gi|302186247|ref|ZP_07262920.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Pseudomonas
           syringae pv. syringae 642]
          Length = 131

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
              + G+TS+T+ C V    RN  +     T E  +V V +DE G P
Sbjct: 71  TATEFGRTSITLKCQV----RNKITRRSILTVEK-IVFVNLDEDGQP 112


>gi|262203255|ref|YP_003274463.1| thioesterase superfamily protein [Gordonia bronchialis DSM 43247]
 gi|262086602|gb|ACY22570.1| thioesterase superfamily protein [Gordonia bronchialis DSM 43247]
          Length = 178

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 8/120 (6%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGW---IMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           L++ +   P   N  GNV GG    ++ Q+  AC   AS+  +   VT +V  ++F +PI
Sbjct: 36  LSMSLLMTPDMANFAGNVHGGTLLKLLDQVAYAC---ASRYSRRYAVTLSVDRVIFREPI 92

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +V +L+ +   I   G+TS+ +   V T   N  + V + T      MVA D+ G P  +
Sbjct: 93  RVGELLILSASINYTGRTSMEVGIRVET--ENIHTGVRRHTNSCYFTMVATDDDGKPHPV 150


>gi|66043728|ref|YP_233569.1| thioesterase superfamily protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254435|gb|AAY35531.1| Thioesterase superfamily [Pseudomonas syringae pv. syringae B728a]
 gi|330972615|gb|EGH72681.1| thioesterase superfamily protein [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 131

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
              + G+TS+T+ C V    RN  +     T E  +V V +DE G P
Sbjct: 71  TATEFGRTSITLKCQV----RNKITRKSILTVEK-IVFVNLDEDGQP 112


>gi|183219724|ref|YP_001837720.1| acetyl-CoA hydrolase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189909860|ref|YP_001961415.1| acyl-CoA hydrolase [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Ames)']
 gi|167774536|gb|ABZ92837.1| Acyl-CoA hydrolase [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Ames)']
 gi|167778146|gb|ABZ96444.1| Acetyl-CoA hydrolase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 169

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  G  FGG IMS ID+   + A +      VT ++  + F  PIQ+ D V++  
Sbjct: 24  LPNDANHYGTAFGGAIMSWIDLIAAMSAQRHSGREAVTVSIDRINFITPIQIGDHVNLKA 83

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +  +G TS+ +   V     N  +  + +   A +  VA+DE   P  +
Sbjct: 84  MVNYVGTTSMEVGVQVNR--ENPYTGEMVRATTAYLSFVALDENKKPAPV 131


>gi|254523477|ref|ZP_05135532.1| cytosolic acyl coenzyme A thioester hydrolase [Stenotrophomonas sp.
           SKA14]
 gi|219721068|gb|EED39593.1| cytosolic acyl coenzyme A thioester hydrolase [Stenotrophomonas sp.
           SKA14]
          Length = 168

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 58/123 (47%), Gaps = 10/123 (8%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  G V GG I+  +D      AS+     VVT +V +++F +PI V 
Sbjct: 10  LSMTVLMSPEMANFSGKVHGGAILRLLDQVAYACASRYAGSYVVTLSVDQVMFRQPIAVG 69

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEAT----VVMVAVDEKGNPKS 148
           +LV     +   G +S+ I   V       + D+L+++          MVAVDE+G P  
Sbjct: 70  ELVTFLASVNYTGTSSMEIGIKV------VAEDILKRSVRHANSCFFTMVAVDEEGRPTP 123

Query: 149 IRT 151
           + T
Sbjct: 124 VPT 126


>gi|222833123|gb|EEE71600.1| predicted protein [Populus trichocarpa]
          Length = 154

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 53/111 (47%), Gaps = 2/111 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P   N  GNV GG ++ Q+D      AS+     VVT +V +++F +PI V +LV     
Sbjct: 3   PDMANFSGNVHGGAVLKQLDQVAYACASRYAGRYVVTLSVDQVMFLQPIHVGELVTFLAS 62

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           +   GK+S+ I   V     +  + V++        MVAVDE   P  + T
Sbjct: 63  VNHTGKSSMEIGIKV--VAEDIRTQVVRHVNSCFFTMVAVDENKQPAPVPT 111


>gi|330967977|gb|EGH68237.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 131

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
              + G+TS+T+ C V    RN  +     T E  +V V +DE G P
Sbjct: 71  TATEFGRTSITLKCQV----RNKITRKSILTVEK-IVFVNLDEDGQP 112


>gi|327482219|gb|AEA85529.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas stutzeri DSM 4166]
          Length = 167

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 54/114 (47%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LTMTVLMTPDKANFSGNVHGGTLLKYLDEVAYACASRYAGQYVVTLSVDQVVFRQPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +LV     +   G TS+ I   V T   +  S  ++ T      MVA+ E G P
Sbjct: 68  ELVTFLASVNYTGTTSMEIGIKVVT--EDIRSKTVRHTNSCFFTMVALGEDGKP 119


>gi|260578356|ref|ZP_05846271.1| acyl-CoA thioester hydrolase [Corynebacterium jeikeium ATCC 43734]
 gi|258603537|gb|EEW16799.1| acyl-CoA thioester hydrolase [Corynebacterium jeikeium ATCC 43734]
          Length = 351

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 6/120 (5%)

Query: 33  LTLKIQTMPTDVNLDG--NVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           +TL+    PTDV + G   V GG ++  ID A    A    +   VT  V  + F +PI 
Sbjct: 30  VTLRFLAAPTDVLMAGAMGVHGGRVLEWIDKAAYACAVGWAQSYCVTAYVGHIHFTRPIP 89

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              +V + ++I   G++S+ I  +V +  PR     V  + C+  V+ VA+DE G  K I
Sbjct: 90  SGHMVEVRSRIAYTGRSSMHIVNEVLSADPREG---VFTRACDCLVIFVALDENGKSKQI 146



 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 50/111 (45%), Gaps = 2/111 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           PTDVN  GNV GG  M  ID A      Q    R        + F +P+ + DLV +  +
Sbjct: 199 PTDVNWGGNVHGGTAMEWIDEAATACTMQWTGERTTAVYAGGIRFYRPVHIGDLVEVDAR 258

Query: 101 IRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           + +  + S+T+   +    PR    + L     A++  +A+D  GNP   R
Sbjct: 259 LVRTDERSMTVMVHLRAGDPREGKGN-LPVAIHASMTYIAIDLDGNPLQAR 308


>gi|315225477|ref|ZP_07867290.1| thioesterase domain protein [Capnocytophaga ochracea F0287]
 gi|314944575|gb|EFS96611.1| thioesterase domain protein [Capnocytophaga ochracea F0287]
          Length = 175

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (50%), Gaps = 5/108 (4%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRV-VTKAVTELLFEKPIQVSDLVHIY 98
           +P + N    +FGG +++++D A  I ASQ    R+ VT +V  + F   I++  +V + 
Sbjct: 20  LPGETNHLNALFGGELLARMDRAASI-ASQRHSGRLTVTVSVNHVAFTHSIRIGSIVTVE 78

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
             I +   TS+ +Y DVW    N   +   K  EA    VAVDE G P
Sbjct: 79  AAISRAFSTSMEVYIDVWM--ENIYGE-RTKATEAIYSFVAVDENGRP 123


>gi|325680832|ref|ZP_08160370.1| thioesterase family protein [Ruminococcus albus 8]
 gi|324107612|gb|EGC01890.1| thioesterase family protein [Ruminococcus albus 8]
          Length = 162

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D+N    +FGG +M  ID A G+ A + C    VT  V  L F+    ++D+V +  ++ 
Sbjct: 25  DINGQNRLFGGRLMEWIDEAAGVAAMRHCGGDAVTLMVDSLKFKHGAFINDIVVLIAKVT 84

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +G+TS+ +  D +   +  ++ + +    A +  V VD+KG PK I
Sbjct: 85  YVGRTSMEVRVDTYVEEK--ATGLRRAINHAYLTCVHVDDKGRPKPI 129


>gi|15600712|ref|NP_254206.1| hypothetical protein PA5519 [Pseudomonas aeruginosa PAO1]
 gi|116053669|ref|YP_793996.1| hypothetical protein PA14_72810 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894622|ref|YP_002443492.1| putative acyl-CoA thioester hydrolase [Pseudomonas aeruginosa
           LESB58]
 gi|254237801|ref|ZP_04931124.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254243069|ref|ZP_04936391.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|9951856|gb|AAG08904.1|AE004964_7 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115588890|gb|ABJ14905.1| putative acyl-CoA thioester hydrolase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126169732|gb|EAZ55243.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126196447|gb|EAZ60510.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218774851|emb|CAW30669.1| putative acyl-CoA thioester hydrolase [Pseudomonas aeruginosa
           LESB58]
          Length = 188

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 58/118 (49%), Gaps = 2/118 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 36  LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPVHVG 95

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           +LV     +   G+TS+ I   V T   N     ++ T      MVA+D++  P ++R
Sbjct: 96  ELVTFLASVNYTGRTSMEIGVKVIT--ENIREQSVRHTNSCFFTMVALDDERKPVAVR 151


>gi|121606729|ref|YP_984058.1| thioesterase superfamily protein [Polaromonas naphthalenivorans
           CJ2]
 gi|120595698|gb|ABM39137.1| thioesterase superfamily protein [Polaromonas naphthalenivorans
           CJ2]
          Length = 149

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 58/117 (49%), Gaps = 12/117 (10%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    P+ VN  G V GG +M  ID A    A++  K   VT +V  + F++PI + 
Sbjct: 4   ITLRFLAEPSTVNFGGKVHGGTVMKWIDEAGYACATRWAKRSCVTVSVGSIRFQRPILIG 63

Query: 93  DLVHIYTQIRKIGKTSVTIYC-----DVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           DLV +  ++   G++S+ I       D+ T   N  +D L       VV VAVD  G
Sbjct: 64  DLVEVEARLAYTGRSSMNIAVEVRSGDIKTGQMNVVTDCL-------VVFVAVDADG 113


>gi|90425002|ref|YP_533372.1| thioesterase superfamily protein [Rhodopseudomonas palustris
           BisB18]
 gi|90107016|gb|ABD89053.1| thioesterase superfamily [Rhodopseudomonas palustris BisB18]
          Length = 143

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  G +FGG  +S +  A  + A++  +  VV     ++ F +PI+V ++V +  
Sbjct: 21  FPEQANHYGTLFGGNALSLMGKAAFVAATRRARASVVMATSDKIAFHEPIRVGEIVELVA 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ ++G+ S+T+  ++     +  + + +     T  MVAVD++G P  I
Sbjct: 81  RVERVGRCSMTVSVEMIR--EDLLTGLRRSAVRGTFEMVAVDQRGRPVPI 128


>gi|226942340|ref|YP_002797413.1| Thioesterase superfamily protein [Azotobacter vinelandii DJ]
 gi|226717267|gb|ACO76438.1| Thioesterase superfamily protein [Azotobacter vinelandii DJ]
          Length = 163

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 56/122 (45%), Gaps = 2/122 (1%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
           + +  LT+ +   P   N  GNV GG ++  +D      AS+      VT +V +++F +
Sbjct: 3   YGNAQLTMTVLMTPDMANFSGNVHGGTLLKLLDEVAYACASRYAGSYAVTLSVDQVIFRQ 62

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           P+ V +LV     +   G TS+ I   V T   N     ++ T  +   MVA+DE   P 
Sbjct: 63  PVHVGELVTFLASVNYTGSTSMEIGIRVVT--ENIRERTVRHTNSSFFTMVALDENRKPT 120

Query: 148 SI 149
            +
Sbjct: 121 HV 122


>gi|300932490|ref|ZP_07147746.1| putative acyl-CoA hydrolase [Corynebacterium resistens DSM 45100]
          Length = 358

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 51/118 (43%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT +    PTDVN  GNV GG  M  ID A      Q    R V      + F +P+ + 
Sbjct: 198 LTNRFLAKPTDVNWGGNVHGGTAMEWIDEAATACTMQWSGERTVAVYAGGIRFYRPVHIG 257

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           DLV +  ++ +    S+++   +         D L     A+   +A+D  GNP + R
Sbjct: 258 DLVEVDARLVRTDSRSMSVIVHLRAGDPREGKDNLPVAIHASFTYIAMDIDGNPLAAR 315



 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 6/120 (5%)

Query: 33  LTLKIQTMPTDVNLDG--NVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           +TL+    PTDV + G   V GG ++  ID A    A    +   VT  V  + F +PI 
Sbjct: 37  VTLRFLAAPTDVLMAGAMGVHGGRVLEWIDKAAYACAVGWAQSYCVTAYVGHIHFNRPIP 96

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              +V + ++I   G++S+ I  +V++  PR     +  + C+  V+ VA+DE    K +
Sbjct: 97  SGHMVEVRSRIAYTGRSSMHIVNEVFSADPREG---IFTRACDCLVIFVAMDENRKAKPV 153


>gi|326799104|ref|YP_004316923.1| thioesterase superfamily protein [Sphingobacterium sp. 21]
 gi|326549868|gb|ADZ78253.1| thioesterase superfamily protein [Sphingobacterium sp. 21]
          Length = 129

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 57/107 (53%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   +VVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGTLLRWIDEEAVIYAIVQLGNSKVVTKFISEINFVSSAKAGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           Q    G TS+T+ C+V    RN  +     T +  +V V +D+ GNP
Sbjct: 71  QATHFGTTSITLTCEV----RNKITRKSILTIDK-LVFVNLDDNGNP 112


>gi|296113362|ref|YP_003627300.1| putative acyl-CoA thioester hydrolase [Moraxella catarrhalis RH4]
 gi|295921056|gb|ADG61407.1| putative acyl-CoA thioester hydrolase [Moraxella catarrhalis RH4]
 gi|326559702|gb|EGE10113.1| putative acyl-CoA thioester hydrolase [Moraxella catarrhalis
           46P47B1]
 gi|326560342|gb|EGE10730.1| putative acyl-CoA thioester hydrolase [Moraxella catarrhalis 7169]
 gi|326561999|gb|EGE12329.1| putative acyl-CoA thioester hydrolase [Moraxella catarrhalis
           103P14B1]
 gi|326563542|gb|EGE13801.1| putative acyl-CoA thioester hydrolase [Moraxella catarrhalis
           12P80B1]
 gi|326566338|gb|EGE16488.1| putative acyl-CoA thioester hydrolase [Moraxella catarrhalis BC1]
 gi|326570148|gb|EGE20193.1| putative acyl-CoA thioester hydrolase [Moraxella catarrhalis BC8]
 gi|326570887|gb|EGE20911.1| putative acyl-CoA thioester hydrolase [Moraxella catarrhalis BC7]
 gi|326574493|gb|EGE24435.1| putative acyl-CoA thioester hydrolase [Moraxella catarrhalis
           101P30B1]
 gi|326575919|gb|EGE25842.1| putative acyl-CoA thioester hydrolase [Moraxella catarrhalis CO72]
 gi|326576383|gb|EGE26292.1| putative acyl-CoA thioester hydrolase [Moraxella catarrhalis O35E]
          Length = 160

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 2/112 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V +++F++PI V 
Sbjct: 14  LTMTVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYAGGYVVTLSVDQVIFKEPIYVG 73

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           +LV    +I  +G TS+ +   +     N  +   + T      MVAVD+ G
Sbjct: 74  ELVTFLARINHVGTTSMEV--GIRVEAENIQTRTARHTNSCYFSMVAVDQAG 123


>gi|56460134|ref|YP_155415.1| Acyl-CoA thioester hydrolase [Idiomarina loihiensis L2TR]
 gi|56179144|gb|AAV81866.1| Acyl-CoA thioester hydrolase [Idiomarina loihiensis L2TR]
          Length = 130

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 55/106 (51%), Gaps = 8/106 (7%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIY 98
           MP D+N  G++FGG I+  ID    I AS QL    +VTK +  + FE      D+V   
Sbjct: 10  MPNDLNFAGSLFGGRILEWIDEEAYIFASCQLGAKSLVTKHIGAITFETSAFQGDVVEFG 69

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEA-TVVMVAVDEK 143
            Q++ +G+TS+ I C V    RN  +   Q  C A  +V V +D +
Sbjct: 70  LQVKSVGRTSLAITCLV----RNKHTK--QNICSADDIVFVHIDPE 109


>gi|88860215|ref|ZP_01134854.1| hypothetical protein PTD2_19425 [Pseudoalteromonas tunicata D2]
 gi|88818209|gb|EAR28025.1| hypothetical protein PTD2_19425 [Pseudoalteromonas tunicata D2]
          Length = 154

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 55/119 (46%), Gaps = 2/119 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +  +    PTDVN  G V GG +M  ID A    A+       VT +   + F +PI V 
Sbjct: 6   MVFRFLAEPTDVNFGGKVHGGVVMKWIDQAGYACAAGWSGHYCVTISTGTIRFHRPILVG 65

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
            +V +  +I   GKTS+ I+  V  C  +  +  + +T    +  VA D+ G P  + T
Sbjct: 66  QIVEVSAKIAHTGKTSMQIFISV-KC-GDPKTQAMNETNHCIINFVATDQAGYPVEVPT 122


>gi|209363647|ref|YP_001423459.2| acyl-CoA hydrolase [Coxiella burnetii Dugway 5J108-111]
 gi|207081580|gb|ABS77433.2| acyl-CoA hydrolase [Coxiella burnetii Dugway 5J108-111]
          Length = 173

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 2/109 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P  VN  GN+ GG+I+  ID      A++     VVT +V  +LF++PI + +LV  Y  
Sbjct: 30  PEKVNFAGNIHGGYILKLIDQTAYACAARYSGHYVVTLSVDGVLFKQPIYLGELVTCYAM 89

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           I  +G+TS+ +   +     N  +   + T    V MVAVD    P ++
Sbjct: 90  INYVGRTSMEV--GIKVVAENLITGEKRHTNSCYVTMVAVDTNLKPVAV 136


>gi|322434909|ref|YP_004217121.1| thioesterase superfamily protein [Acidobacterium sp. MP5ACTX9]
 gi|321162636|gb|ADW68341.1| thioesterase superfamily protein [Acidobacterium sp. MP5ACTX9]
          Length = 173

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 51/105 (48%), Gaps = 2/105 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  GN+FGG +M  +D+   + AS+  +   VT ++  L F  P+ V DL+ +  
Sbjct: 22  FPGDANALGNLFGGRLMQFMDLTGAMAASRHARAITVTASMDHLDFVAPVHVGDLLILKA 81

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
            + +  KTS+ +   V     +     L+    A +  VAVD+ G
Sbjct: 82  SVNRAFKTSMEV--GVKAMVEDVRKQRLRHVSSAYITFVAVDQNG 124


>gi|299138331|ref|ZP_07031510.1| thioesterase superfamily protein [Acidobacterium sp. MP5ACTX8]
 gi|298599577|gb|EFI55736.1| thioesterase superfamily protein [Acidobacterium sp. MP5ACTX8]
          Length = 169

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 53/106 (50%), Gaps = 2/106 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  GN+FGG +M  ID+   + AS+  +   VT ++  L F  P++V DL+ + +
Sbjct: 18  FPGDANALGNLFGGRLMQFIDLVGAMAASRHARAITVTASMDHLDFVAPVKVGDLLILKS 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
            + +  KTS+ +   V     +  +  L+    A +  VAVD  G 
Sbjct: 78  SVNRAYKTSMEV--GVKAMVEDVRAQRLRHVSSAYLTFVAVDSTGQ 121


>gi|256820061|ref|YP_003141340.1| thioesterase superfamily protein [Capnocytophaga ochracea DSM 7271]
 gi|256581644|gb|ACU92779.1| thioesterase superfamily protein [Capnocytophaga ochracea DSM 7271]
          Length = 175

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (50%), Gaps = 5/108 (4%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRV-VTKAVTELLFEKPIQVSDLVHIY 98
           +P + N    +FGG +++++D A  I ASQ    R+ VT +V  + F   I++  +V + 
Sbjct: 20  LPGETNHLNALFGGELLARMDRAASI-ASQRHSGRLTVTVSVNHVAFTHSIRIGSIVTVE 78

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
             I +   TS+ +Y DVW    N   +   K  EA    VAVDE G P
Sbjct: 79  AAISRAFSTSMEVYIDVWM--ENIYGE-RTKATEAIYSFVAVDENGRP 123


>gi|52785170|ref|YP_090999.1| YkhA [Bacillus licheniformis ATCC 14580]
 gi|319646390|ref|ZP_08000620.1| YkhA protein [Bacillus sp. BT1B_CT2]
 gi|52347672|gb|AAU40306.1| YkhA [Bacillus licheniformis ATCC 14580]
 gi|317392140|gb|EFV72937.1| YkhA protein [Bacillus sp. BT1B_CT2]
          Length = 173

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N    +FGG +MS ID    I A++  +C  VT ++  + F +PI+  D V + +
Sbjct: 22  FPLDTNNHNTLFGGKLMSYIDDIASISAARHSRCETVTASMDSVDFLEPIRQEDSVCLES 81

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +  +G+TS+ ++  V           L  T  + +  VA+D+ GNP+++
Sbjct: 82  YVTWVGRTSMEVFVKVIKEHLLTGERKLAAT--SFLTFVALDQDGNPQAV 129


>gi|149911991|ref|ZP_01900586.1| long-chain acyl-CoA thioester hydrolase family protein [Moritella
           sp. PE36]
 gi|149804926|gb|EDM64959.1| long-chain acyl-CoA thioester hydrolase family protein [Moritella
           sp. PE36]
          Length = 145

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 53/113 (46%), Gaps = 2/113 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P+ VN    +FGG  +S +D    I A++ C   +VT +   + F  PI    +V +  
Sbjct: 34  FPSTVNHHDTLFGGQALSWMDETAFIAATRFCHKPLVTVSSDRIDFSHPIPAGSIVELVG 93

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
            I K+G+TS+ +  D++    + + +   K       +VAVDE   P  I  E
Sbjct: 94  TIDKVGRTSIRVKVDIFV--ESMTEEGRTKAISGMFSLVAVDENRKPTPIMDE 144


>gi|15891126|ref|NP_356798.1| acyl-CoA hydrolase [Agrobacterium tumefaciens str. C58]
 gi|15159470|gb|AAK89583.1| acyl-CoA hydrolase [Agrobacterium tumefaciens str. C58]
          Length = 276

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 54/111 (48%), Gaps = 2/111 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  G +FGG  ++ +  A  + AS+ C   VV  +   + F + I++ ++V    
Sbjct: 155 FPDQANSAGRMFGGEAIAYMTKAAFVAASRYCGKLVVLASSERIDFARAIEIGEIVEAQA 214

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
            + ++G++S++I   +W+   N  +     T      MVAVD+   P +IR
Sbjct: 215 HVERVGRSSMSIQTKLWS--ENLLTGERHITATGHFTMVAVDKDHRPATIR 263



 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 38/76 (50%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  G +FGG  ++ +D    I A++  +   VT +   + F +P ++  +V    
Sbjct: 24  FPGDTNHHGTLFGGTGLALMDRVAFIAATRFGRTPFVTASCERIDFRQPARIGHIVEFTA 83

Query: 100 QIRKIGKTSVTIYCDV 115
           +  K G+ S+T+  ++
Sbjct: 84  RPVKAGRRSLTVEVEM 99


>gi|227502130|ref|ZP_03932179.1| 4-hydroxybenzoyl-CoA thioesterase [Corynebacterium accolens ATCC
           49725]
 gi|227077114|gb|EEI15077.1| 4-hydroxybenzoyl-CoA thioesterase [Corynebacterium accolens ATCC
           49725]
          Length = 336

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 48/111 (43%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           PTDVN  G V GG  M  ID A      +    R V      + F KPI + DL+ +  +
Sbjct: 186 PTDVNWGGKVHGGTAMQWIDEAGTACTMEWSGERTVAVYAGGIRFYKPISIGDLIEVDAR 245

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           + +  + S+ +   V         D L+    ATV  + +D  G P + RT
Sbjct: 246 MMRTDRRSMQMSVHVRAGDPRGGRDNLKTAIHATVAYIGMDRDGQPMTART 296



 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 24  VCQMHSSGVLTLKIQTMPTDVNLDG--NVFGGWIMSQIDIACGIRASQLCKCRVVTKAVT 81
             +   S  LTL+    PTDV + G   + GG ++  ID A    A Q      VT  V 
Sbjct: 7   AAETQKSPTLTLRFMASPTDVTMAGAPGINGGRVLEWIDKAAYACAVQWSGQYCVTAYVG 66

Query: 82  ELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAV 140
            + F +PI    +V + ++I   G++S+ I  +V +  PR     +  + C+  V+ VA 
Sbjct: 67  HIHFTRPIPSGHIVEVRSRIAMTGRSSMHIINEVLSADPREG---IFTRACDCLVIFVAK 123

Query: 141 DEKGN 145
           D + +
Sbjct: 124 DPESD 128


>gi|16081697|ref|NP_394072.1| acyl-CoA hydrolase related protein [Thermoplasma acidophilum DSM
           1728]
 gi|10639766|emb|CAC11738.1| acyl-CoA hydrolase related protein [Thermoplasma acidophilum]
          Length = 165

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D+++   ++GG +M  ID    I A++ C+ R VT ++  L F  PI + D+V ++ 
Sbjct: 18  LPEDMDIYEYLYGGRLMEWIDNCASIVATKHCRKRTVTGSIDSLFFLLPIHLGDMVILHG 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            I    K+++ I  DV        + + +   +A +  VA+D  G P  I
Sbjct: 78  YINYTTKSTMEIEIDV--IKEEGLTGIRRYATKAYLTYVAIDSDGRPTEI 125


>gi|255325910|ref|ZP_05367002.1| 4-hydroxybenzoyl-CoA thioesterase [Corynebacterium
           tuberculostearicum SK141]
 gi|255297122|gb|EET76447.1| 4-hydroxybenzoyl-CoA thioesterase [Corynebacterium
           tuberculostearicum SK141]
          Length = 336

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 48/110 (43%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           PTDVN  G V GG  M  ID A      +    R V      + F +PI + DL+ +  +
Sbjct: 186 PTDVNWGGKVHGGTAMQWIDEAGAACTMEWSAERTVAVYAGGIRFYRPISIGDLIEVDAR 245

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           + +    S+ +   V +       D LQ    ATV  +A+D  G P+  R
Sbjct: 246 MMRTDTRSMQMSIHVRSGNPRGGRDNLQTAIHATVAYIALDHDGQPQVAR 295



 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 57/121 (47%), Gaps = 6/121 (4%)

Query: 24  VCQMHSSGVLTLKIQTMPTDVNLDG--NVFGGWIMSQIDIACGIRASQLCKCRVVTKAVT 81
           V +   S  LTL+    PTDV + G   + GG ++  ID A    A Q      VT  V 
Sbjct: 7   VAENQKSPALTLRFMASPTDVTMAGATGISGGRVLEWIDKAAYACAVQWSGQYCVTAYVG 66

Query: 82  ELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAV 140
            + F +PI    +V + ++I   G++S+ I  +V +  PR     +  + C+  V+ VA 
Sbjct: 67  HIHFTRPIPSGHIVEVRSRIAMTGRSSMHIVNEVLSADPREG---IFTRACDCLVIFVAK 123

Query: 141 D 141
           D
Sbjct: 124 D 124


>gi|300088408|ref|YP_003758930.1| thioesterase superfamily protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299528141|gb|ADJ26609.1| thioesterase superfamily protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 126

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 55/112 (49%), Gaps = 3/112 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQ-LCKCRVVTKAVTELLFEKPIQVSDLVHIY 98
           +P  +N DG +FGG ++  ID    I ASQ     R VT A+  + F   +   +++   
Sbjct: 8   LPEHLNHDGFLFGGNMLKWIDEFAYITASQEFPDNRFVTVALDNVAFHHAVAGGEIIRFV 67

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
            ++ ++GKTS   +   +   R+A  + +    E  +  V+VDE G  + IR
Sbjct: 68  VELNRLGKTSAQYHVRAFGTRRHACPETI--LFETRITFVSVDEAGLKRVIR 117


>gi|187479610|ref|YP_787635.1| acyl-CoA thioester hydrolase [Bordetella avium 197N]
 gi|115424197|emb|CAJ50750.1| putative acyl-CoA thioester hydrolase [Bordetella avium 197N]
          Length = 166

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 56/116 (48%), Gaps = 2/116 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ I   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI
Sbjct: 6   SHQLSMTILMTPDMANFSGNVHGGTILKYLDQVAYACASRYAGQYVVTLSVDQVVFREPI 65

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
            V ++V     +   G+TS+ +   V T   +    +++ T      MVAVDE G 
Sbjct: 66  HVGEMVTFLASVNFTGRTSMEVGIKVVT--EDIRRKLVRHTNSCYFTMVAVDEHGQ 119


>gi|114569971|ref|YP_756651.1| thioesterase superfamily protein [Maricaulis maris MCS10]
 gi|114340433|gb|ABI65713.1| thioesterase superfamily protein [Maricaulis maris MCS10]
          Length = 260

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  G+ FGG  M+++D    + A++  +   VT +  +L F  P+ V +L+ +  
Sbjct: 17  FPDQSNHQGSYFGGAAMAEMDKIAFLVAARHARRPFVTASCDKLDFVAPVHVGNLIELTG 76

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           Q+R +G+TS+ +  DV     + ++            MVA D K NP  +
Sbjct: 77  QVRMVGRTSLIV--DVELAAEDLTTGARHVCTRGAFTMVAADRKTNPDRL 124



 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  G +FGG  MS +  A  I AS+  +  V   A  ++ F  P    +++ +  
Sbjct: 149 FPGDTNHLGQLFGGNAMSIMGKAAYIAASRHTRFDVGMAATDKIDFIAPTLEGEMLDVIA 208

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ K+G+TS+T+   V     N  +   +K   A  VMVA+D++G P
Sbjct: 209 EVTKVGRTSMTV--SVLAEAENLMTGERRKVGTADYVMVALDDEGRP 253


>gi|52079800|ref|YP_078591.1| putative acyl-CoA thioester hydrolase [Bacillus licheniformis ATCC
           14580]
 gi|52003011|gb|AAU22953.1| Putative acyl-CoA thioester hydrolase [Bacillus licheniformis ATCC
           14580]
          Length = 172

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N    +FGG +MS ID    I A++  +C  VT ++  + F +PI+  D V + +
Sbjct: 21  FPLDTNNHNTLFGGKLMSYIDDIASISAARHSRCETVTASMDSVDFLEPIRQEDSVCLES 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +  +G+TS+ ++  V           L  T  + +  VA+D+ GNP+++
Sbjct: 81  YVTWVGRTSMEVFVKVIKEHLLTGERKLAAT--SFLTFVALDQDGNPQAV 128


>gi|304559165|gb|ADM41829.1| Acyl-CoA hydrolase [Edwardsiella tarda FL6-60]
          Length = 111

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            PT +N    +FGG  ++ +D    I A++ C+ R+VT +   + F+ PI    +V +  
Sbjct: 2   FPTTINHHATLFGGTALAWMDEVSFITATRFCRKRLVTVSTERINFQHPIPSGSIVELDG 61

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ ++G+TS+T+   ++    +   +  ++        VAVD+ G P
Sbjct: 62  RVTRVGRTSLTVSVTIFL--EDMYREGREEVINGQFNFVAVDDDGRP 106


>gi|332534600|ref|ZP_08410433.1| acyl-CoA thioester hydrolase protein [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332035950|gb|EGI72430.1| acyl-CoA thioester hydrolase protein [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 154

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 27  MHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           M SS V+  +    PTDVN  G V GG +M  ID A    A+       VT +V  + F 
Sbjct: 1   MPSSKVI-FRFLAEPTDVNFGGKVHGGAVMKWIDQAGYACAAGWSGHYCVTVSVAGVKFR 59

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +PI V  +V +  +I   G++S+ I+  V  C    + ++++ T    +  +A+DE G P
Sbjct: 60  RPILVGQIVEVEAKIAHTGRSSMQIFIQV-RCGDPKTQNMVE-TNHCVISFIAMDETGYP 117


>gi|261377561|ref|ZP_05982134.1| thioesterase family protein [Neisseria cinerea ATCC 14685]
 gi|269146301|gb|EEZ72719.1| thioesterase family protein [Neisseria cinerea ATCC 14685]
          Length = 160

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP   N  GNV GG ++  +D      AS+      VT +V ++LF++PI V DLV  Y 
Sbjct: 19  MPDTANFSGNVHGGELLRLLDQVAYSCASRYSGNYCVTLSVDKVLFKEPIHVGDLVTFYA 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +   G+TS+ I   V    +N  +  ++ T      MVAV + G P
Sbjct: 79  SVNYTGRTSMEIGIRVEA--QNIRTGEIRHTNSCYFTMVAVKD-GKP 122


>gi|109897667|ref|YP_660922.1| thioesterase superfamily protein [Pseudoalteromonas atlantica T6c]
 gi|109699948|gb|ABG39868.1| thioesterase superfamily [Pseudoalteromonas atlantica T6c]
          Length = 135

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIY 98
           MP D+N   ++FGG  +  ID    I A  QL   ++VTK + E+ FE P    D+V   
Sbjct: 10  MPNDLNYANSLFGGRALEWIDEESAIYAICQLETNQLVTKHIGEISFESPALQGDVVEFG 69

Query: 99  TQIRKIGKTSVTIYC 113
            + +K+G+TS+T+ C
Sbjct: 70  LETKKVGRTSITVTC 84


>gi|242310582|ref|ZP_04809737.1| acyl-coa hydrolase [Helicobacter pullorum MIT 98-5489]
 gi|239522980|gb|EEQ62846.1| acyl-coa hydrolase [Helicobacter pullorum MIT 98-5489]
          Length = 158

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 52/116 (44%), Gaps = 2/116 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  G V GG ++  +D      AS+ C   VVT +V  + F+ PI+V 
Sbjct: 13  LTMTVLMTPAMANFKGRVHGGDLLKLLDQVAYACASRYCGKYVVTLSVDSVTFKYPIEVG 72

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
            LV     +   G +S+ +   +     N    ++  T  A   MV VDE G P S
Sbjct: 73  SLVTFLASVNYTGTSSLEV--GIKVIAENIHKRIVTHTNSAYFTMVCVDENGKPTS 126


>gi|190572824|ref|YP_001970669.1| putative acyl-CoA thioester hydrolase [Stenotrophomonas maltophilia
           K279a]
 gi|190010746|emb|CAQ44355.1| putative acyl-CoA thioester hydrolase [Stenotrophomonas maltophilia
           K279a]
          Length = 168

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 57/121 (47%), Gaps = 10/121 (8%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  G V GG I+  +D      AS+     VVT +V +++F +PI V 
Sbjct: 10  LSMTVLMSPEMANFSGKVHGGAILRLLDQVAYACASRYAGSYVVTLSVDQVMFRQPIAVG 69

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEAT----VVMVAVDEKGNPKS 148
           +LV     +   G +S+ I   V       + D+L+++          MVAVDE+G P  
Sbjct: 70  ELVTFLASVNYTGTSSMEIGIKV------VAEDILKRSVRHANSCFFTMVAVDEEGRPTP 123

Query: 149 I 149
           +
Sbjct: 124 V 124


>gi|300778391|ref|ZP_07088249.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Chryseobacterium
           gleum ATCC 35910]
 gi|300503901|gb|EFK35041.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Chryseobacterium
           gleum ATCC 35910]
          Length = 131

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 57/107 (53%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N + ++FGG ++  ID    + A  QL   +VVTK ++E+ F    +  D++ I  
Sbjct: 11  PEDLNPNHSLFGGRLLQWIDEEAALYAIIQLENTKVVTKFISEINFVSSAKQGDIIEIGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +    G +S+T+ CDV    RN  +     T +  +VMV +D  GNP
Sbjct: 71  EATHFGSSSITLKCDV----RNKMTHQTIITVDK-IVMVNLDADGNP 112


>gi|86142466|ref|ZP_01060976.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Leeuwenhoekiella
           blandensis MED217]
 gi|85831218|gb|EAQ49675.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Leeuwenhoekiella
           blandensis MED217]
          Length = 130

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 58/108 (53%), Gaps = 6/108 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N + ++FGG ++  ID    + A  QL   R VTK ++E+ F+   +  D+V I  
Sbjct: 11  PQDLNPNRSLFGGRLLEWIDEEAALYAIIQLENPRTVTKYISEIDFKSSAREGDIVEIGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           +  K G  S+T+ C+V    RN  +     T +  +VMV +DE GN K
Sbjct: 71  EPVKFGTASLTLKCEV----RNKMTRETIITIDK-IVMVGLDENGNAK 113


>gi|85858039|ref|YP_460241.1| rubrerythrin and thioesterase superfamily protein [Syntrophus
           aciditrophicus SB]
 gi|85721130|gb|ABC76073.1| rubrerythrin and thioesterase superfamily protein [Syntrophus
           aciditrophicus SB]
          Length = 291

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 68/150 (45%), Gaps = 7/150 (4%)

Query: 5   SKNINLLLINIITKKEVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACG 64
            KN   LL  I  + E       HSS  + +    +P   N  G V GG +M  +D A G
Sbjct: 118 EKNFQELLHGIEKETEFEGRTVGHSS--VEMAQLMLPEQANPAGFVHGGELMKMMDNAAG 175

Query: 65  IRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDV--WTCPRNA 122
           + A++     VVT  V +++F+ P++V  +V +  ++    ++S+ I  D+         
Sbjct: 176 VVAARHAHSNVVTARVEDIVFQSPVRVGSVVFVKARLVFASRSSMVIRVDLEMEHISLEK 235

Query: 123 SSDVLQK---TCEATVVMVAVDEKGNPKSI 149
             D  +       A  VMVAVDE+G   ++
Sbjct: 236 GHDGQEHRVPAMTANFVMVAVDEQGKASAV 265


>gi|229593441|ref|YP_002875560.1| putative thioesterase [Pseudomonas fluorescens SBW25]
 gi|312963953|ref|ZP_07778424.1| thioesterase superfamily [Pseudomonas fluorescens WH6]
 gi|229365307|emb|CAY53659.1| putative thioesterase [Pseudomonas fluorescens SBW25]
 gi|311281988|gb|EFQ60598.1| thioesterase superfamily [Pseudomonas fluorescens WH6]
          Length = 161

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +PI V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G TS+ +   V T   N     ++ T      MVAVD++  P ++
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHTNSCFFTMVAVDDQRKPAAV 122


>gi|110638328|ref|YP_678537.1| acyl-CoA thioester hydrolase [Cytophaga hutchinsonii ATCC 33406]
 gi|110281009|gb|ABG59195.1| possible acyl-CoA thioester hydrolase [Cytophaga hutchinsonii ATCC
           33406]
          Length = 173

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 3/123 (2%)

Query: 28  HSSGVLTLKIQ-TMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           H S  + +K +  +P D N   N+ GG +M  +D+   I A + C   VVT +V  + F+
Sbjct: 7   HPSESMVIKSELVLPNDTNTLNNLMGGRLMYLMDVVGAICALRHCSHGVVTASVDNVSFK 66

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            PI + +++ +  +I +   TS+ ++ +VW    +  S V  K+ EA    VA+     P
Sbjct: 67  APIALGNILTLEAKITRAFHTSMEVHIEVWA--EDVLSRVKTKSNEAFFTFVALSADKKP 124

Query: 147 KSI 149
             I
Sbjct: 125 LPI 127


>gi|284049134|ref|YP_003399473.1| thioesterase superfamily protein [Acidaminococcus fermentans DSM
           20731]
 gi|283953355|gb|ADB48158.1| thioesterase superfamily protein [Acidaminococcus fermentans DSM
           20731]
          Length = 128

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 61/125 (48%), Gaps = 2/125 (1%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           Q H+  V+  +   M +  N  G++FGG +M  +D   GI A +    RV T AV  + F
Sbjct: 3   QEHNQPVIMTR-SVMLSMANSAGHLFGGTLMGWMDELSGITAHRFAWTRVTTAAVKGMNF 61

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
             PI    ++ +  ++ ++G TS+ +    W  P     + + +  +A  V V++DE   
Sbjct: 62  YVPIPYGSVLQLEGRVVRVGNTSMDVEVVAWMEPEQEEQEPI-RAADALFVYVSLDENRK 120

Query: 146 PKSIR 150
           PK I+
Sbjct: 121 PKKIQ 125


>gi|213962834|ref|ZP_03391094.1| acyl-CoA thioester hydrolase [Capnocytophaga sputigena Capno]
 gi|213954491|gb|EEB65813.1| acyl-CoA thioester hydrolase [Capnocytophaga sputigena Capno]
          Length = 186

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 54/108 (50%), Gaps = 5/108 (4%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRV-VTKAVTELLFEKPIQVSDLVHIY 98
           +P + N    +FGG +++++D A  I ASQ    R  VT +V  + F   I+V  +V + 
Sbjct: 31  LPGETNHLNAMFGGELLARMDRAASI-ASQRHSGRATVTVSVNHVAFTHSIRVGSIVTVE 89

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
             I +   +S+ +Y DVW    N   +   K  EA    VAVDE G P
Sbjct: 90  AAISRAFSSSMEVYIDVWM--ENTYGE-RTKATEAIYSFVAVDENGRP 134


>gi|107104621|ref|ZP_01368539.1| hypothetical protein PaerPA_01005700 [Pseudomonas aeruginosa PACS2]
          Length = 151

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V +LV     
Sbjct: 7   PDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPVHVGELVTFLAS 66

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           +   G+TS+ I   V T   N     ++ T      MVA+D++  P ++R
Sbjct: 67  VNYTGRTSMEIGVKVIT--ENIREQSVRHTNSCFFTMVALDDERKPVAVR 114


>gi|319638197|ref|ZP_07992960.1| acyl CoA thioester hydrolase [Neisseria mucosa C102]
 gi|317400470|gb|EFV81128.1| acyl CoA thioester hydrolase [Neisseria mucosa C102]
          Length = 160

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 55/110 (50%), Gaps = 3/110 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP   N  GNV GG ++  +D      AS+      VT +V ++LF++PI V +LV  Y 
Sbjct: 19  MPDTANFSGNVHGGELLRLLDQVAYSCASRYSGNYCVTLSVDKVLFKEPIHVGELVTFYA 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            I   G+TS+ +   V    +N  +  ++ T      MVAV E G P ++
Sbjct: 79  SINYTGRTSMEVGIRVEA--QNIRTGEVRHTNSCYFTMVAV-EDGKPVAV 125


>gi|332974355|gb|EGK11284.1| cytosolic long-chain acyl-CoA thioester hydrolase [Psychrobacter
           sp. 1501(2011)]
          Length = 188

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  GNV GG ++  +D      AS+     +VT +V +++F +PI V 
Sbjct: 19  LYMSVLMTPDMANFIGNVHGGDLLKMLDQVAYACASRYSGGYIVTLSVDQVMFLEPIYVG 78

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     I  +G+TS+ +   V     N     ++ T      MVAVDE G P  +
Sbjct: 79  ELVTFAATINYVGRTSMEVGIRVEA--ENIQERTVRHTNSCFFTMVAVDEAGKPTPV 133


>gi|255505847|ref|ZP_05348470.3| thioesterase family protein [Bryantella formatexigens DSM 14469]
 gi|255265497|gb|EET58702.1| thioesterase family protein [Bryantella formatexigens DSM 14469]
          Length = 176

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 3/110 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP  +N  G +FGG +++ ID   GI   +  +  +VT     L+F+    ++D V +  
Sbjct: 38  MPRHINGSGRLFGGQLVAWIDEVAGIVGKRHAESDIVTACFDNLIFKAGAYLNDTVVVRG 97

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +  +G TS+ +  D +    + +  ++ +   A VVMVAVD  G  + +
Sbjct: 98  HLTYVGNTSMEVRVDTYREALDGTRTMINR---AYVVMVAVDRNGKSRPV 144


>gi|194364407|ref|YP_002027017.1| thioesterase superfamily protein [Stenotrophomonas maltophilia
           R551-3]
 gi|194347211|gb|ACF50334.1| thioesterase superfamily protein [Stenotrophomonas maltophilia
           R551-3]
          Length = 168

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 57/121 (47%), Gaps = 10/121 (8%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  G V GG I+  +D      AS+     VVT +V +++F +PI V 
Sbjct: 10  LSMTVLMSPEMANFSGKVHGGAILRLLDQVAYACASRYAGRYVVTLSVDQVMFRQPIAVG 69

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEAT----VVMVAVDEKGNPKS 148
           +LV     +   G +S+ I   V       + D+L+++          MVAVDE+G P  
Sbjct: 70  ELVTFLASVNHTGTSSMEIGVKV------VAEDILKRSVRHANSCFFTMVAVDEEGRPTP 123

Query: 149 I 149
           +
Sbjct: 124 V 124


>gi|283853249|ref|ZP_06370500.1| thioesterase superfamily protein [Desulfovibrio sp. FW1012B]
 gi|283571354|gb|EFC19363.1| thioesterase superfamily protein [Desulfovibrio sp. FW1012B]
          Length = 177

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 2/121 (1%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
           S+  + +  + +P+D N  GNV GG I+  ID A GI A +  +  VVT ++  + F KP
Sbjct: 15  SASRVVMPQRMLPSDANPAGNVHGGVILKYIDTAGGIVAIRHARSAVVTASIDRMDFLKP 74

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
             + ++V     I  +G TS+ +   V  C  N  +   +    A +  VA+D    P +
Sbjct: 75  AYIGEVVTFLASINLVGATSMEVGVRV-EC-ENPITGETRHAGSAYLTYVALDADRRPHA 132

Query: 149 I 149
           +
Sbjct: 133 V 133


>gi|121595165|ref|YP_987061.1| thioesterase superfamily protein [Acidovorax sp. JS42]
 gi|222111506|ref|YP_002553770.1| thioesterase superfamily protein [Acidovorax ebreus TPSY]
 gi|120607245|gb|ABM42985.1| thioesterase superfamily protein [Acidovorax sp. JS42]
 gi|221730950|gb|ACM33770.1| thioesterase superfamily protein [Acidovorax ebreus TPSY]
          Length = 166

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI V 
Sbjct: 8   LSMTVLMSPDMANFSGNVHGGAILKLLDQVAYACASRYSGSYVVTLSVDQVMFLQPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G +S+ I   V     N  + V++        MVAVD+ G P  +
Sbjct: 68  ELVTFLASVNHTGTSSMEIGIKV--VAENIRTQVVRHVNSCFFSMVAVDDAGKPTPV 122


>gi|332527262|ref|ZP_08403330.1| acyl-CoA thioester hydrolase [Rubrivivax benzoatilyticus JA2]
 gi|332111682|gb|EGJ11663.1| acyl-CoA thioester hydrolase [Rubrivivax benzoatilyticus JA2]
          Length = 176

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  G V GG I+  +D      A++     VVT +V +++F +PIQV 
Sbjct: 20  LQMTVLMTPDTANFSGKVHGGVILRHLDQVAYACAARYAGRYVVTLSVDQVMFRQPIQVG 79

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G++S+ I   V     +  + V++        MVAVD+ G P ++
Sbjct: 80  ELVTFLASVNHTGRSSMEIGIKVLA--EDIRAGVVRHVNSCFFTMVAVDDGGQPVAV 134


>gi|332702077|ref|ZP_08422165.1| thioesterase superfamily protein [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332552226|gb|EGJ49270.1| thioesterase superfamily protein [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 165

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 10/115 (8%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  GN+ GG I+  ID+A    A +  +  VVTK++  + F  P  V +L+    
Sbjct: 18  FPQDANPAGNIHGGVILRYIDLAGATAAMRHSRTPVVTKSIDRMEFRAPALVGELLTFKA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVL----QKTCEATVVMVAVDEKGNPKSIR 150
            +   G TS+ +   V       + D+L    + T  A +  VA+  +G P +++
Sbjct: 78  SVNMAGSTSMEVGVRVE------AEDLLTGEVRHTASAYLTFVAMSAEGRPTAVQ 126


>gi|94498378|ref|ZP_01304936.1| putative acyl-CoA thioester hydrolase [Sphingomonas sp. SKA58]
 gi|94422133|gb|EAT07176.1| putative acyl-CoA thioester hydrolase [Sphingomonas sp. SKA58]
          Length = 103

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 50/103 (48%), Gaps = 2/103 (1%)

Query: 50  VFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSV 109
           +FGG  +S +  A  I AS   +  VV     ++ F  P+ V  LV ++  + + G++S+
Sbjct: 2   LFGGTALSLMGEAAFIAASHHARAAVVMARSEQIAFHHPVSVGQLVELHAYVTRDGRSSM 61

Query: 110 TIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           T+  +V       S+    +  +    MV+VDE G PK  R +
Sbjct: 62  TV--EVEMISETLSTGYRSQAVKGQFEMVSVDEHGKPKPYRPQ 102


>gi|187921658|ref|YP_001890690.1| thioesterase superfamily protein [Burkholderia phytofirmans PsJN]
 gi|187720096|gb|ACD21319.1| thioesterase superfamily protein [Burkholderia phytofirmans PsJN]
          Length = 159

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAICQLDNQRVVTKFMSEINFVSSARQGDIIELGM 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
                G+TS+T+ C+V    RN  +     T E  +V V +DE G P
Sbjct: 71  TATHFGRTSITLRCEV----RNKITRKSILTVE-KMVFVNLDENGEP 112


>gi|77461869|ref|YP_351376.1| thioesterase superfamily protein [Pseudomonas fluorescens Pf0-1]
 gi|77385872|gb|ABA77385.1| putative thioesterase [Pseudomonas fluorescens Pf0-1]
          Length = 160

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +PI V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G TS+ +   V T   N     ++ T      MVAVD++  P ++
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHTNSCFFTMVAVDDQRKPAAV 122


>gi|332981112|ref|YP_004462553.1| thioesterase superfamily protein [Mahella australiensis 50-1 BON]
 gi|332698790|gb|AEE95731.1| thioesterase superfamily protein [Mahella australiensis 50-1 BON]
          Length = 164

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 2/94 (2%)

Query: 56  MSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDV 115
           M  IDIA  I AS+     VVT AV  L F++PI+V +LV +  +I   G+TS+ +  DV
Sbjct: 42  MHWIDIAGAIVASRHSGHTVVTVAVDSLDFKEPIKVGELVILRGKITWSGRTSMEVAVDV 101

Query: 116 WTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +    N ++   + T EA +  VA+D+ G+P  +
Sbjct: 102 YG--ENLTTGQRRLTNEAYLTFVALDDDGHPTPV 133


>gi|288556856|ref|YP_003428791.1| acyl-CoA thioester hydrolase [Bacillus pseudofirmus OF4]
 gi|288548016|gb|ADC51899.1| acyl-CoA thioester hydrolase [Bacillus pseudofirmus OF4]
          Length = 164

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 56/114 (49%), Gaps = 10/114 (8%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  G +FGG +M+ ID    I A +  + +VVT +   L F  PI+  + + +  
Sbjct: 21  LPPDTNYHGTIFGGNVMAYIDKVASIAAMRHARSQVVTASSDSLDFISPIRTGEAICLEG 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVL----QKTCEATVVMVAVDEKGNPKSI 149
            +    KTS+ ++  V       + D++    + T  + +  VA+DE G PK +
Sbjct: 81  YVSYTRKTSMEVFVKV------EAEDLITGERRLTATSYLTFVALDEAGKPKEV 128


>gi|220929289|ref|YP_002506198.1| thioesterase superfamily protein [Clostridium cellulolyticum H10]
 gi|219999617|gb|ACL76218.1| thioesterase superfamily protein [Clostridium cellulolyticum H10]
          Length = 159

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 54/110 (49%), Gaps = 3/110 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP  +N    +FGG +M  ID+   + A +   C V T ++  L F+    V+  + +  
Sbjct: 21  MPEHINGFNRLFGGKLMEWIDVVAAVVARRHSGCNVTTASIDNLQFKAAAYVNSTIFLLG 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           QI  +G TS+ +  D +    N    ++ +   A +V+VA+DE   P S+
Sbjct: 81  QITYVGNTSMEVRVDTFVEELNGIRRMINR---AYLVLVALDENDLPVSV 127


>gi|183598533|ref|ZP_02960026.1| hypothetical protein PROSTU_01927 [Providencia stuartii ATCC 25827]
 gi|188020710|gb|EDU58750.1| hypothetical protein PROSTU_01927 [Providencia stuartii ATCC 25827]
          Length = 134

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            PT  N    +FGG  ++ +D    I A++ C+ R+VT +  ++ F  PI    +V +  
Sbjct: 25  FPTTTNHHDTLFGGTALAWMDEVSFITATRFCRKRLVTVSTEKINFTHPIPSGTIVELVG 84

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ ++G+TS+T+   ++    +   +  ++        VAVD+ G P  I
Sbjct: 85  KVSRVGRTSLTVNVSIFL--EDMYREGREEVIHGQFNFVAVDDNGKPTPI 132


>gi|313677183|ref|YP_004055179.1| thioesterase superfamily protein [Marivirga tractuosa DSM 4126]
 gi|312943881|gb|ADR23071.1| thioesterase superfamily protein [Marivirga tractuosa DSM 4126]
          Length = 174

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 52/107 (48%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N   N+ GG +M  +DI   I A + C   VVT +V  + F+ PI + D+V +  
Sbjct: 20  LPNDTNPLNNLMGGRLMHWMDIVSAIAAQKHCNRIVVTASVDNISFQHPIALGDVVTLEA 79

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ +   +SV ++  V     N  S     +  A    VAVD+ G P
Sbjct: 80  KVTRAFSSSVEVHIVVKG--ENIPSGKKYPSNSAFFTFVAVDQSGRP 124


>gi|225019168|ref|ZP_03708360.1| hypothetical protein CLOSTMETH_03120 [Clostridium methylpentosum
           DSM 5476]
 gi|224948068|gb|EEG29277.1| hypothetical protein CLOSTMETH_03120 [Clostridium methylpentosum
           DSM 5476]
          Length = 157

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 55/108 (50%), Gaps = 3/108 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P  +N    +FGG +M  +DI   + A +  +  V T A+  L F+ P  V+  V +  
Sbjct: 19  LPQHINGYHRLFGGTLMEWVDIVASVVARRHSEAEVTTVAIDNLQFKAPAYVNSTVILIG 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           ++  +G+TS+ +  D +     + S    K  +A +V+VA+DE   PK
Sbjct: 79  RMTYVGRTSMEVRVDTYV---ESLSGERYKVNKAYLVLVALDEHERPK 123


>gi|152987275|ref|YP_001351631.1| hypothetical protein PSPA7_6320 [Pseudomonas aeruginosa PA7]
 gi|150962433|gb|ABR84458.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 160

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 57/118 (48%), Gaps = 2/118 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           +LV     +   G+TS+ I   V T   N     ++ T      MVA+D++  P  +R
Sbjct: 68  ELVTFLASVNYTGRTSMEIGVKVIT--ENIREQSVRHTNSCFFTMVALDDERKPVVVR 123


>gi|93005562|ref|YP_579999.1| thioesterase superfamily protein [Psychrobacter cryohalolentis K5]
 gi|92393240|gb|ABE74515.1| thioesterase superfamily [Psychrobacter cryohalolentis K5]
          Length = 178

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 55/118 (46%), Gaps = 10/118 (8%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +PI V 
Sbjct: 19  LYMSVLMTPDMANFIGNVHGGDLLKMLDQVAYACASRYSGSYVVTLSVDQVMFREPIHVG 78

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEAT----VVMVAVDEKGNP 146
           +LV     +  +GKTS+ +   V       + DV  +T   T      MVA+DE   P
Sbjct: 79  ELVTFAASVNYVGKTSMEVGIRV------EAEDVRARTVRHTNSCYFTMVAIDENRKP 130


>gi|257483571|ref|ZP_05637612.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|331009649|gb|EGH89705.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 131

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
              + G+TS+T+ C V    RN  +     T +  +V V +DE G P
Sbjct: 71  TATEFGRTSITLKCQV----RNKITRKSILTVDK-IVFVNLDEDGQP 112


>gi|71733864|ref|YP_272755.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|289625032|ref|ZP_06457986.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289647879|ref|ZP_06479222.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|71554417|gb|AAZ33628.1| 4-hydroxybenzoyl-CoA thioesterase domain protein [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|320321999|gb|EFW78095.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320330894|gb|EFW86868.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330865779|gb|EGH00488.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330872118|gb|EGH06267.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330892521|gb|EGH25182.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. mori str. 301020]
          Length = 131

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
              + G+TS+T+ C V    RN  +     T +  +V V +DE G P
Sbjct: 71  TATEFGRTSITLKCQV----RNKITRKSILTVDK-IVFVNLDEDGQP 112


>gi|239908899|ref|YP_002955641.1| hypothetical protein DMR_42640 [Desulfovibrio magneticus RS-1]
 gi|239798766|dbj|BAH77755.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 176

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 61/121 (50%), Gaps = 2/121 (1%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
           S+  + +  + +P+D N  GNV GG I+  ID A GI A +  +  VVT ++  + F KP
Sbjct: 15  SASHVVMPQRMLPSDANPAGNVHGGVILKYIDTAGGICAIRHARSAVVTASIDRMDFLKP 74

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
             + ++V     +  +G TS+ +   V  C  N  +   +    A +  VA+D +  P++
Sbjct: 75  AYIGEVVTFMASVNLVGATSMEVGVRV-EC-ENPITGETRHAGSAYLTYVALDAERRPQA 132

Query: 149 I 149
           +
Sbjct: 133 V 133


>gi|225025396|ref|ZP_03714588.1| hypothetical protein EIKCOROL_02294 [Eikenella corrodens ATCC
           23834]
 gi|224941840|gb|EEG23049.1| hypothetical protein EIKCOROL_02294 [Eikenella corrodens ATCC
           23834]
          Length = 165

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP   N  GNV GG ++  +D      AS+      VT +V ++LF++PI V +LV  Y 
Sbjct: 21  MPNAANFSGNVHGGELLRLLDQVAYSCASRYSGHYCVTLSVDKVLFKEPIHVGELVTFYA 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +   G+TS+ I   V    +N  +  ++ T      MVA+ E G P
Sbjct: 81  SVNYTGRTSMEIGIRVEA--QNIRTGQVRHTNSCYFTMVAM-ENGKP 124


>gi|124002731|ref|ZP_01687583.1| acyl-CoA hydrolase [Microscilla marina ATCC 23134]
 gi|123991959|gb|EAY31346.1| acyl-CoA hydrolase [Microscilla marina ATCC 23134]
          Length = 136

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 53/111 (47%), Gaps = 2/111 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N    +FGG  +  +D    I A++  + +VVT +   + F++PI     + +  
Sbjct: 21  FPNTTNHYDTLFGGTALQLMDEVAFITATRFTRLKVVTVSSDRVDFKQPIPAGSFIELIG 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           ++ K+G TS+ +  D++    +   +  Q+        VA+DE  +P +IR
Sbjct: 81  KVVKVGNTSLGVQVDIFL--EHMYEETRQRAISGNFTFVAIDENRHPLTIR 129


>gi|34496611|ref|NP_900826.1| acy-CoA thioester hydrolase-like protein [Chromobacterium violaceum
           ATCC 12472]
 gi|34102466|gb|AAQ58831.1| probable acy-CoA thioester hydrolase-related protein
           [Chromobacterium violaceum ATCC 12472]
          Length = 159

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 56/119 (47%), Gaps = 3/119 (2%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  GNV GG ++  +D      AS+   C VVT +V ++LF++PI V 
Sbjct: 11  LVMSVLMTPDMANFSGNVHGGVLLKLLDQVAYACASRYAGCYVVTLSVDQVLFKQPIHVG 70

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           +LV     +  +G+TS+ +   +     N      + T      MVA  + G P ++ T
Sbjct: 71  ELVTFLASVNHVGRTSMEV--GIKVVAENIQQRSQRHTNSCYFTMVAYQD-GKPMTVPT 126


>gi|16265301|ref|NP_438093.1| putative acyl-CoA thioester hydrolase protein [Sinorhizobium
           meliloti 1021]
 gi|15141441|emb|CAC49953.1| ADP-dependent short-chain-acyl-CoA hydrolase acyl-CoA + H2O = CoA +
           a carboxylate [Sinorhizobium meliloti 1021]
          Length = 167

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 54/114 (47%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  G V GG +++ +D      AS+  K   VT +V +++F++PI V 
Sbjct: 10  LVMTVLMTPDMANFSGKVHGGALLNLLDRVAFSCASRFSKQYAVTLSVDQVIFKEPIHVG 69

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +LV     I   G+TS+ +   V     N  +   + T      MVAVD+ G P
Sbjct: 70  ELVTFRAAINYAGRTSMEVGIRVEA--ENIRAGTRRHTNSCYFTMVAVDDAGRP 121


>gi|292654211|ref|YP_003534108.1| acyl-CoA thioester hydrolase [Haloferax volcanii DS2]
 gi|291372677|gb|ADE04904.1| acyl-CoA thioester hydrolase [Haloferax volcanii DS2]
          Length = 164

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 53/107 (49%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  G   GG I+  +D+   I   +  + +VVT ++  + F  PI V D+V +  
Sbjct: 24  MPNDTNNLGRALGGRILEWMDVCGAIAGRRFAERQVVTASMDHVDFLAPIDVGDVVTVEA 83

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +   G+TS+ I  DV T  R +  D  ++T  +    VA+D+   P
Sbjct: 84  YVFDTGRTSMDIKVDV-TAERPSEGD-RRETLTSFFTFVALDDDEKP 128


>gi|21219497|ref|NP_625276.1| hypothetical protein SCO0980 [Streptomyces coelicolor A3(2)]
 gi|14970645|emb|CAC44330.1| hypothetical protein (fragment) [Streptomyces coelicolor A3(2)]
          Length = 119

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G + GG +M  ID A    A +      VT +V  + F  P++  DL+ ++ ++ 
Sbjct: 11  DTNLYGTIHGGVVMKLIDDAAAAAAGRHADGPAVTASVDRMAFLAPVRSGDLLTVHAELE 70

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           + G+TS+T+   V T  R  ++    +     +  VA+D  G P+ +
Sbjct: 71  RAGRTSMTVGVRV-TAERWNAAGPGTEVATGRLAFVAIDADGRPRPV 116


>gi|313900554|ref|ZP_07834047.1| thioesterase family protein [Clostridium sp. HGF2]
 gi|312954616|gb|EFR36291.1| thioesterase family protein [Clostridium sp. HGF2]
          Length = 161

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 58/110 (52%), Gaps = 3/110 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           M   +N  G +FGG +   ID+  G+ A + C   + T ++  L F++ + +++L+ ++ 
Sbjct: 20  MANHLNGSGRLFGGQLAEWIDVLAGVVARRHCNSNITTASIDSLNFKEAVHLNELMVLHG 79

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++  +G TS+ I  D +   R+    V +    A +  VA+D++  P ++
Sbjct: 80  KVTYVGNTSMEIRVDSYVENRDG---VRRLVNTAYLTEVALDDEDRPTTV 126


>gi|89890887|ref|ZP_01202396.1| acyl-CoA thioester hydrolase [Flavobacteria bacterium BBFL7]
 gi|89517032|gb|EAS19690.1| acyl-CoA thioester hydrolase [Flavobacteria bacterium BBFL7]
          Length = 132

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 56/107 (52%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    + A  Q+   +VVTK ++E+ F    +  D+V I  
Sbjct: 11  PEDLNPNGTLFGGRLLEWIDEEAALYAIIQIENQKVVTKYMSEINFRSSAKPGDIVEIGL 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            + K GK+S+ + C+V    RN  +          +++V +DE G P
Sbjct: 71  AVNKFGKSSIDLKCEV----RNKMT-YETIITIENIILVNLDEDGKP 112


>gi|15677335|ref|NP_274490.1| acyl CoA thioester hydrolase family protein [Neisseria meningitidis
           MC58]
 gi|7226722|gb|AAF41838.1| acyl CoA thioester hydrolase family protein [Neisseria meningitidis
           MC58]
 gi|316984627|gb|EFV63592.1| thioesterase superfamily protein [Neisseria meningitidis H44/76]
 gi|325140581|gb|EGC63101.1| thioesterase family protein [Neisseria meningitidis CU385]
 gi|325199910|gb|ADY95365.1| thioesterase family protein [Neisseria meningitidis H44/76]
          Length = 160

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 55/111 (49%), Gaps = 11/111 (9%)

Query: 40  MPTDVNLDGNVFGG---WIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLV 95
           MP   N  GNV GG    ++ Q+  +C  R S   C    VT +V ++LF++PI V DLV
Sbjct: 19  MPDTANFSGNVHGGELLLLLDQVAYSCASRYSGNYC----VTLSVDKVLFKEPIHVGDLV 74

Query: 96  HIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
             Y  +   G+TS+ I   V    +N  +  ++ T      MVAV + G P
Sbjct: 75  TFYASVNYTGRTSMEIGIRVEA--QNIRTGEIRHTNSCYFTMVAVKD-GKP 122


>gi|309790708|ref|ZP_07685258.1| thioesterase superfamily protein [Oscillochloris trichoides DG6]
 gi|308227239|gb|EFO80917.1| thioesterase superfamily protein [Oscillochloris trichoides DG6]
          Length = 177

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 55/121 (45%), Gaps = 10/121 (8%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  GNV GG ++  +D      AS+ C   VVT +V +++F + I V 
Sbjct: 14  LEMTVLMTPDTANFSGNVHGGHVLKLLDQVAYACASRYCGGYVVTGSVDQVIFREGIHVG 73

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATV----VMVAVDEKGNPKS 148
           +LV     +   G +S+ I   V       + +++  T    +     MVAV E G P+ 
Sbjct: 74  ELVTFLASVNYTGNSSMEIGVRV------TAEEIISHTARHVITCYFTMVAVGEDGRPRR 127

Query: 149 I 149
           I
Sbjct: 128 I 128


>gi|253577853|ref|ZP_04855125.1| thioesterase superfamily protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850171|gb|EES78129.1| thioesterase superfamily protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 159

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 57/107 (53%), Gaps = 3/107 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP  +N  G +FGG +++ ID   GI A +  +  VVT AV  + F+   +V+D + +  
Sbjct: 21  MPKCLNAAGYLFGGQLLAWIDETAGIVAKRHAEMNVVTVAVDNMYFKAGARVNDTIVLIG 80

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++  +G++S+ +  D +    + +  ++ +   A  +MV  DE  +P
Sbjct: 81  RLTHVGRSSMEVRIDTYCEALDGTRTMINR---AYFIMVGTDEHQHP 124


>gi|330984673|gb|EGH82776.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 133

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
              + G+TS+T+ C V    RN  +     T +  +V V +DE G P
Sbjct: 71  TATEFGRTSITLKCQV----RNKITRKSILTVDK-IVFVNLDEDGQP 112


>gi|307301477|ref|ZP_07581237.1| thioesterase superfamily protein [Sinorhizobium meliloti BL225C]
 gi|307316798|ref|ZP_07596240.1| thioesterase superfamily protein [Sinorhizobium meliloti AK83]
 gi|306897420|gb|EFN28164.1| thioesterase superfamily protein [Sinorhizobium meliloti AK83]
 gi|306903534|gb|EFN34122.1| thioesterase superfamily protein [Sinorhizobium meliloti BL225C]
          Length = 166

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 54/114 (47%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  G V GG +++ +D      AS+  K   VT +V +++F++PI V 
Sbjct: 9   LVMTVLMTPDMANFSGKVHGGALLNLLDRVAFSCASRFSKQYAVTLSVDQVIFKEPIHVG 68

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +LV     I   G+TS+ +   V     N  +   + T      MVAVD+ G P
Sbjct: 69  ELVTFRAAINYAGRTSMEVGIRVEA--ENIRAGTRRHTNSCYFTMVAVDDAGRP 120


>gi|159041298|ref|YP_001540550.1| thioesterase superfamily protein [Caldivirga maquilingensis IC-167]
 gi|157920133|gb|ABW01560.1| thioesterase superfamily protein [Caldivirga maquilingensis IC-167]
          Length = 327

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 3/109 (2%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P D  +   V  G +++ ID      AS+  K  VVT ++ + +F  PI+  ++V I   
Sbjct: 184 PQDAFMSNMVSAGRLLAWIDNIAASLASEYAKSVVVTGSIDDTVFYSPIRTGEIVKIAVG 243

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           I  +GKTS+     V T   +A  +V ++ C A    +A+D+KG P+ +
Sbjct: 244 ISYVGKTSLETLIHVTT--EDAYGNV-KRVCTAYYTYIAIDDKGKPQPV 289



 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 51/120 (42%), Gaps = 4/120 (3%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL     P D N  G +FGG I+  I     +   +  +   V   +    F  P  + 
Sbjct: 15  VTLLEMVQPFDANSIGRLFGGRILEWIANVGTVATVKFSRGPTVLAYMDRHFFLAPAFIG 74

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           D + +  ++  +G++S+  Y +     R+    V+      T   VAVD+ G P+ IR E
Sbjct: 75  DSITLKARVEYVGRSSMETYIEA--VRRHGGDQVIMTMT--TAAYVAVDDYGQPRLIRNE 130


>gi|71909131|ref|YP_286718.1| thioesterase superfamily protein [Dechloromonas aromatica RCB]
 gi|71848752|gb|AAZ48248.1| Thioesterase superfamily [Dechloromonas aromatica RCB]
          Length = 162

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 2/112 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI V 
Sbjct: 8   LAMTVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYASQYVVTLSVDQVMFRQPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           +LV     +   G TS+ I   V T   +    V++        MVAVD+ G
Sbjct: 68  ELVTFLASVNYTGNTSMEIGVKVLT--ESIRDQVVRHANSCFFTMVAVDDNG 117


>gi|95930122|ref|ZP_01312861.1| thioesterase superfamily [Desulfuromonas acetoxidans DSM 684]
 gi|95133816|gb|EAT15476.1| thioesterase superfamily [Desulfuromonas acetoxidans DSM 684]
          Length = 348

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 72/148 (48%), Gaps = 15/148 (10%)

Query: 17  TKKEVLMVCQMHSS-------GVLTLKI------QTMPTDVNLDGNVFGGWIMSQIDIAC 63
           +++E  ++ ++H +       G+L+ K+      +  P   N+   +FGG++M +     
Sbjct: 174 SREEYELLTKLHKAQDEPGFKGLLSGKLVADSWERMYPAKENVPTTIFGGYLMRRAYELS 233

Query: 64  GIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNAS 123
            I A  +   R V  AV  + F  P+++ D +H   ++   GKTS+++  ++    R+ +
Sbjct: 234 SICAELVAPNRPVIVAVNRVNFFHPVRLGDKLHYTCRVVYTGKTSISVEANIRRISRDRT 293

Query: 124 SDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           S+ L  +C  T   V VD+  NP  + T
Sbjct: 294 SEALSNSCLFT--FVNVDDHLNPLPVPT 319


>gi|229491831|ref|ZP_04385652.1| acyl-CoA hydrolase [Rhodococcus erythropolis SK121]
 gi|229321512|gb|EEN87312.1| acyl-CoA hydrolase [Rhodococcus erythropolis SK121]
          Length = 200

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 61/137 (44%), Gaps = 16/137 (11%)

Query: 20  EVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWI---MSQIDIACGIRASQLCKCRVV 76
           E+    Q  S   L++ +   P   N  GNV GG I   + Q+  AC   AS+  +  VV
Sbjct: 26  ELKQASQQASKQTLSMTVLMTPDMSNFSGNVHGGTILKFLDQVAYAC---ASRYAQTYVV 82

Query: 77  TKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL----QKTCE 132
           T +V  ++F +P+ V +LV     +   G+TS+ I   V T       D+L    + T  
Sbjct: 83  TLSVDRVVFREPVHVGELVTFSASVNYTGRTSMEIGIRVET------EDILLGKSRHTNS 136

Query: 133 ATVVMVAVDEKGNPKSI 149
               MVA+   G P  +
Sbjct: 137 CYFTMVAMGSDGKPAEV 153


>gi|192291026|ref|YP_001991631.1| thioesterase superfamily protein [Rhodopseudomonas palustris TIE-1]
 gi|192284775|gb|ACF01156.1| thioesterase superfamily protein [Rhodopseudomonas palustris TIE-1]
          Length = 141

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 56/111 (50%), Gaps = 2/111 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  G +FGG  ++ +  A  + A++  +  +V     ++ F  P++V DLV +  
Sbjct: 19  FPEQANHYGTLFGGNALNLMGKAAFVAATRRARQPIVMATSDKIEFHVPVKVGDLVELTA 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           ++ ++G++S+T+  DV +      S   Q     +  MVAVD+ G P  ++
Sbjct: 79  RVVRVGRSSMTVVVDVVS--EALISGARQLAVRGSFEMVAVDKAGRPTPVQ 127


>gi|326794327|ref|YP_004312147.1| thioesterase [Marinomonas mediterranea MMB-1]
 gi|326545091|gb|ADZ90311.1| thioesterase superfamily protein [Marinomonas mediterranea MMB-1]
          Length = 132

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N    +FGG  +  +D    I A++  + +VVT +   + F KPI    LV +  
Sbjct: 22  FPNTTNHYDTLFGGIALQWMDEVAYIAATRFARKQVVTISTERVDFNKPIPTGILVELVA 81

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++ K+GKTS+ +  +++       SD ++K        VAVDE   P  I
Sbjct: 82  RVVKVGKTSLKVEVNIYL--EQLHSDKVEKAITGHFNFVAVDEDKRPTPI 129


>gi|323490339|ref|ZP_08095554.1| acyl-CoA hydrolase [Planococcus donghaensis MPA1U2]
 gi|323396009|gb|EGA88840.1| acyl-CoA hydrolase [Planococcus donghaensis MPA1U2]
          Length = 159

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 63/117 (53%), Gaps = 6/117 (5%)

Query: 37  IQT---MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCR-VVTKAVTELLFEKPIQVS 92
           IQT   +P D N   ++FGG +++ ID   GI A +  + + VVT ++  + F    +V 
Sbjct: 12  IQTKLVLPPDTNHMDSIFGGKVLAYIDEIAGITAMKHARRQVVVTASIDSVDFLSSAKVG 71

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           D++ +   +   G+TS+ +Y  V +  +N  +   + T E+ + MVA+ + GNP  +
Sbjct: 72  DVLELEANVTSTGRTSMEVYVRVKS--KNLQTGDEKLTTESFLTMVAMGDDGNPTPV 126


>gi|292655700|ref|YP_003535597.1| acyl-CoA thioester hydrolase [Haloferax volcanii DS2]
 gi|291370460|gb|ADE02687.1| acyl-CoA thioester hydrolase [Haloferax volcanii DS2]
          Length = 160

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  G   GG ++  +DI   I A +    + VT ++  + F  PI + ++  +  
Sbjct: 20  LPNDTNNLGRALGGAVLHWMDICGAIAAMRFSNRQCVTASMDHVDFIGPIDLGEVAVMEA 79

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +  +G+TSV +  DV     N  +D  +KT  + +  VA+D+ G P  +
Sbjct: 80  YVFNVGRTSVDVKVDVHA--ENPKTDERRKTTTSFLTFVALDDDGKPTPV 127


>gi|226309098|ref|YP_002769058.1| hypothetical protein RER_56110 [Rhodococcus erythropolis PR4]
 gi|226188215|dbj|BAH36319.1| conserved hypothetical protein [Rhodococcus erythropolis PR4]
          Length = 183

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 59/134 (44%), Gaps = 10/134 (7%)

Query: 20  EVLMVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKA 79
           E+    Q  S   L++ +   P   N  GNV GG I+  +D      AS+  +  VVT +
Sbjct: 9   ELKQASQQASKQTLSMTVLMTPDMSNFSGNVHGGTILKFLDQVAYACASRYAQTYVVTLS 68

Query: 80  VTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVL----QKTCEATV 135
           V  ++F +P+ V +LV     +   G+TS+ I   V T       D+L    + T     
Sbjct: 69  VDRVVFREPVHVGELVTFSASVNYTGRTSMEIGIRVET------EDILLGKSRHTNSCYF 122

Query: 136 VMVAVDEKGNPKSI 149
            MVA+   G P  +
Sbjct: 123 TMVAMGSDGKPAEV 136


>gi|85713187|ref|ZP_01044217.1| Acyl-CoA thioester hydrolase [Idiomarina baltica OS145]
 gi|85692985|gb|EAQ30953.1| Acyl-CoA thioester hydrolase [Idiomarina baltica OS145]
          Length = 130

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 53/104 (50%), Gaps = 8/104 (7%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIY 98
           MP D+N  G++FGG I+  ID    I AS QL    +VTK +  + FE      D+V   
Sbjct: 10  MPNDLNFAGSLFGGRILEWIDEEAYIFASCQLGAKSLVTKHIGAITFETSAFQGDVVEFG 69

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEA-TVVMVAVD 141
            Q++  G+TS+ I C V    RN  +   Q  C A  +V V +D
Sbjct: 70  LQVKSAGRTSLNITCVV----RNKHTK--QNICTADDIVFVHID 107


>gi|70733450|ref|YP_263225.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas fluorescens Pf-5]
 gi|68347749|gb|AAY95355.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas fluorescens Pf-5]
          Length = 161

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +PI V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G TS+ +   V T   N     ++ T      MVAVD++  P  +
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHTNSCFFTMVAVDDQRKPAQV 122


>gi|300709795|ref|YP_003735609.1| thioesterase superfamily protein [Halalkalicoccus jeotgali B3]
 gi|299123478|gb|ADJ13817.1| thioesterase superfamily protein [Halalkalicoccus jeotgali B3]
          Length = 145

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 51/112 (45%), Gaps = 4/112 (3%)

Query: 36  KIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLV 95
           + +  P   N   ++ GG +M  +D    + A +      VT  VTEL F++P+ +  + 
Sbjct: 12  RYRVQPNHANNYESLHGGTLMKWMDEVGAMAAMRFAGESCVTAGVTELDFQQPVPIGAIA 71

Query: 96  HIYTQIRKIGKTSVTIYCDVW-TCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            I     + G+TSV +    W   PR   +     T EA+   VAVD  G+P
Sbjct: 72  RIGAYAYETGRTSVRVRIRAWREDPRTGET---AHTTEASFTFVAVDGDGSP 120


>gi|241760541|ref|ZP_04758634.1| acyl CoA thioester hydrolase family protein [Neisseria flavescens
           SK114]
 gi|261380730|ref|ZP_05985303.1| thioesterase family protein [Neisseria subflava NJ9703]
 gi|241319045|gb|EER55547.1| acyl CoA thioester hydrolase family protein [Neisseria flavescens
           SK114]
 gi|284796447|gb|EFC51794.1| thioesterase family protein [Neisseria subflava NJ9703]
          Length = 160

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 55/112 (49%), Gaps = 13/112 (11%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRV-----VTKAVTELLFEKPIQVSDL 94
           MP   N  GNV GG ++  +D     + +  C CR      VT +V ++LF++PI V +L
Sbjct: 19  MPYTANFSGNVHGGDLLRLLD-----QVAYSCACRYSGTYCVTLSVDKVLFKEPIHVGEL 73

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           V  Y  I   G+TS+ +   V    +N  +  ++ T      MVAV E G P
Sbjct: 74  VTFYASINYTGRTSMEVGIRVEA--QNIHTGEVRHTNSCYFTMVAV-EDGKP 122


>gi|332307405|ref|YP_004435256.1| thioesterase superfamily protein [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332174734|gb|AEE23988.1| thioesterase superfamily protein [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 135

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIY 98
           MP D+N   ++FGG  +  ID    I A  QL   ++VTK + E+ FE P    D+V   
Sbjct: 10  MPNDLNYANSLFGGRALEWIDEESAIYAICQLETNQLVTKHIGEISFESPALQGDVVEFG 69

Query: 99  TQIRKIGKTSVTIYC 113
            + +++G+TS+T+ C
Sbjct: 70  LETKQVGRTSITVTC 84


>gi|256423076|ref|YP_003123729.1| thioesterase superfamily protein [Chitinophaga pinensis DSM 2588]
 gi|256037984|gb|ACU61528.1| thioesterase superfamily protein [Chitinophaga pinensis DSM 2588]
          Length = 158

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 52/115 (45%), Gaps = 2/115 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  +TL+    P+DVN  G V GG +M  ID A    A+       VT  V  + F KPI
Sbjct: 6   SNTVTLRFLAEPSDVNFGGKVHGGAVMKWIDQAGYACAANWSGQYCVTVYVGGIRFFKPI 65

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
            + D+V I   +   G +S+ I  +V     N       KT    +V  AVD+ G
Sbjct: 66  SIGDMVEITATVIYTGNSSMHISINVQAG--NPRRKERIKTTHCVMVFAAVDDAG 118


>gi|260886758|ref|ZP_05898021.1| thioesterase family protein [Selenomonas sputigena ATCC 35185]
 gi|330839426|ref|YP_004414006.1| thioesterase superfamily protein [Selenomonas sputigena ATCC 35185]
 gi|260863357|gb|EEX77857.1| thioesterase family protein [Selenomonas sputigena ATCC 35185]
 gi|329747190|gb|AEC00547.1| thioesterase superfamily protein [Selenomonas sputigena ATCC 35185]
          Length = 177

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 55/110 (50%), Gaps = 1/110 (0%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP+  N +GNV GG IM  +D A    A +  +  VVT  V EL F  PI++ DLV +  
Sbjct: 18  MPSQANPNGNVHGGEIMKLMDSAAYAAARRYARSNVVTARVDELEFHLPIRIGDLVVVTA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +  +G +S+ I   V     +  S+  Q    A   MVA+D    PK++
Sbjct: 78  DVVYVGHSSMEIAVHVIVEDLDDGSEP-QLGLSAYFTMVALDRNARPKAV 126


>gi|167042774|gb|ABZ07493.1| putative thioesterase superfamily protein [uncultured marine
           microorganism HF4000_ANIW137G21]
          Length = 149

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 58/121 (47%), Gaps = 2/121 (1%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
           SS  + L  +  P D N    +FGG +M+ +D A G+ ASQ      VT +V  L F+KP
Sbjct: 6   SSNPVVLLNEVFPGDTNALDTLFGGRLMAIMDTAAGMAASQYAHNVFVTVSVDSLKFKKP 65

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
               D+  I T+ R +  +  T+   V +C    +    ++ C     MVAVD++  P  
Sbjct: 66  AYQGDV--IRTKARVVWTSPHTVGVLVRSCRMTRADWDPEEICSGYFFMVAVDDEMKPTK 123

Query: 149 I 149
           +
Sbjct: 124 V 124


>gi|160880459|ref|YP_001559427.1| thioesterase superfamily protein [Clostridium phytofermentans ISDg]
 gi|160429125|gb|ABX42688.1| thioesterase superfamily protein [Clostridium phytofermentans ISDg]
          Length = 164

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 55/110 (50%), Gaps = 3/110 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           M   +N  G +FGG +++ ID   GI   +     V+T ++  L F+    ++D+V +  
Sbjct: 26  MQAHINGSGRLFGGQLLAWIDELAGIVGMRHSGGNVITASIDNLQFKHGAHLNDIVVLVG 85

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++  +G +S+ +  D +   +  +   + +   A  VMVA+DE   PK +
Sbjct: 86  RVTYVGNSSMEVRIDTYVENKKGTRHPINR---AYFVMVALDENEQPKKV 132


>gi|261344229|ref|ZP_05971873.1| long-chain acyl-CoA thioester hydrolase family protein [Providencia
           rustigianii DSM 4541]
 gi|282567829|gb|EFB73364.1| long-chain acyl-CoA thioester hydrolase family protein [Providencia
           rustigianii DSM 4541]
          Length = 135

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            PT  N    +FGG  ++ +D    I A++ C+ R+VT +  ++ F  PI    +V +  
Sbjct: 25  FPTTTNHHSTLFGGTALAWMDEVSFITATRFCRKRLVTVSTEKINFTHPIPSGTIVELVG 84

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ ++G+TS+T+   ++    +  ++  ++        VA+D+ G P
Sbjct: 85  EVIRVGRTSLTVNVSIFL--EDMYAEGREEVIHGQFNFVAIDDNGKP 129


>gi|322368524|ref|ZP_08043092.1| thioesterase superfamily protein [Haladaptatus paucihalophilus
           DX253]
 gi|320551808|gb|EFW93454.1| thioesterase superfamily protein [Haladaptatus paucihalophilus
           DX253]
          Length = 158

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           MP D N  G   GG I+  +DI   I + +  + +VVT ++  + F  PI + D+V +  
Sbjct: 19  MPNDANNLGRALGGSILHWMDICAAISSRRFSRRQVVTASMDHVDFLGPIDLGDIVTVEG 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            + + G+TS+ +   V       S D   +T  +   MVA+D+   P ++
Sbjct: 79  YVFETGETSMEVVVSVRA--ERPSHDEKGETATSFFTMVALDDDETPTAV 126


>gi|320106029|ref|YP_004181619.1| thioesterase superfamily protein [Terriglobus saanensis SP1PR4]
 gi|319924550|gb|ADV81625.1| thioesterase superfamily protein [Terriglobus saanensis SP1PR4]
          Length = 172

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 52/108 (48%), Gaps = 3/108 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKC-RVVTKAVTELLFEKPIQVSDLVHIY 98
            P D N  GN+FGG +M  ID+   + A +      VVT ++  L F  P+ + DL+ + 
Sbjct: 20  FPGDSNALGNLFGGRLMQFIDLVGAVAAYRHAHATTVVTASMDHLDFVAPVHIGDLLILK 79

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
             + +  +TS+ +   V     +  S  L+    A +  VAVD+ G P
Sbjct: 80  ASVNRAFRTSMEV--GVKAMVEDPKSRTLRHVSTAYITYVAVDQNGTP 125


>gi|298208616|ref|YP_003716795.1| thioesterase family protein domain protein [Croceibacter atlanticus
           HTCC2559]
 gi|83848539|gb|EAP86408.1| thioesterase family protein domain protein [Croceibacter atlanticus
           HTCC2559]
          Length = 129

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 57/108 (52%), Gaps = 6/108 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    + A  QL   + VTK ++E+ F    +  D++ I  
Sbjct: 11  PEDLNPNGTLFGGRLLEWIDEEAALYAIIQLENPKTVTKYMSEINFASSARKGDIIEIGL 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           +  K G TS+T+ C+V    RN  +         T++MVA+ E G PK
Sbjct: 71  EPIKYGTTSLTLKCEV----RNKMT-YDTIITIDTIIMVALGEDGKPK 113


>gi|325954907|ref|YP_004238567.1| thioesterase superfamily protein [Weeksella virosa DSM 16922]
 gi|323437525|gb|ADX67989.1| thioesterase superfamily protein [Weeksella virosa DSM 16922]
          Length = 131

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 58/107 (54%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N + ++FGG +++ ID    + +  QL    VVTK ++E+ F+   +  D++ I  
Sbjct: 11  PEDLNPNKSLFGGRLLAWIDEEAALYSIIQLENSHVVTKYMSEINFQASAKQGDIIEIGL 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ K G+TS+ + C+V    RN  +     T E  + MV +D  G P
Sbjct: 71  EVVKFGRTSLVLKCEV----RNKMTHQTIITVE-NITMVNLDANGKP 112


>gi|289676384|ref|ZP_06497274.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. syringae FF5]
 gi|330899333|gb|EGH30752.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. japonica str. M301072PT]
 gi|330942533|gb|EGH45117.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 131

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
                G+TS+T+ C V    RN  +     T +  +V V +DE G P
Sbjct: 71  TATDFGRTSITLKCQV----RNKITRKSILTVDK-IVFVNLDEDGQP 112


>gi|121635162|ref|YP_975407.1| putative acyl-CoA hydrolase [Neisseria meningitidis FAM18]
 gi|254805257|ref|YP_003083478.1| putative acyl-CoA hydrolase [Neisseria meningitidis alpha14]
 gi|120866868|emb|CAM10627.1| putative acyl-CoA hydrolase [Neisseria meningitidis FAM18]
 gi|254668799|emb|CBA06759.1| putative acyl-CoA hydrolase [Neisseria meningitidis alpha14]
 gi|254671771|emb|CBA09618.1| putative acyl-CoA thioester hydrolase [Neisseria meningitidis
           alpha153]
 gi|254674284|emb|CBA10068.1| putative acyl-CoA thioester hydrolase [Neisseria meningitidis
           alpha275]
 gi|261392264|emb|CAX49784.1| putative acyl-CoA thioester hydrolase [Neisseria meningitidis 8013]
 gi|308389119|gb|ADO31439.1| putative acyl-CoA hydrolase [Neisseria meningitidis alpha710]
 gi|325128560|gb|EGC51433.1| thioesterase family protein [Neisseria meningitidis N1568]
 gi|325130558|gb|EGC53310.1| thioesterase family protein [Neisseria meningitidis OX99.30304]
 gi|325131209|gb|EGC53922.1| thioesterase superfamily protein [Neisseria meningitidis M6190]
 gi|325134602|gb|EGC57245.1| thioesterase family protein [Neisseria meningitidis M13399]
 gi|325136625|gb|EGC59226.1| thioesterase family protein [Neisseria meningitidis M0579]
 gi|325138519|gb|EGC61084.1| thioesterase family protein [Neisseria meningitidis ES14902]
 gi|325144777|gb|EGC67069.1| thioesterase family protein [Neisseria meningitidis M01-240013]
 gi|325198612|gb|ADY94068.1| thioesterase family protein [Neisseria meningitidis G2136]
 gi|325201827|gb|ADY97281.1| thioesterase family protein [Neisseria meningitidis M01-240149]
 gi|325204465|gb|ADY99918.1| thioesterase family protein [Neisseria meningitidis M01-240355]
 gi|325208421|gb|ADZ03873.1| thioesterase family protein [Neisseria meningitidis NZ-05/33]
          Length = 160

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 55/111 (49%), Gaps = 11/111 (9%)

Query: 40  MPTDVNLDGNVFGG---WIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLV 95
           MP   N  GNV GG    ++ Q+  +C  R S   C    VT +V ++LF++PI + DLV
Sbjct: 19  MPDTANFSGNVHGGELLLLLDQVAYSCASRYSGNYC----VTLSVDKVLFKEPIHIGDLV 74

Query: 96  HIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
             Y  +   G+TS+ I   V    +N  +  ++ T      MVAV + G P
Sbjct: 75  TFYAAVNYTGRTSMEIGIRVEA--QNIRTGEIRHTNSCYFTMVAVKD-GKP 122


>gi|59801426|ref|YP_208138.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae FA 1090]
 gi|194098294|ref|YP_002001352.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae NCCP11945]
 gi|239998714|ref|ZP_04718638.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae 35/02]
 gi|240014368|ref|ZP_04721281.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae DGI18]
 gi|240016801|ref|ZP_04723341.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae FA6140]
 gi|240080998|ref|ZP_04725541.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae FA19]
 gi|240112644|ref|ZP_04727134.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae MS11]
 gi|240115389|ref|ZP_04729451.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae PID18]
 gi|240117686|ref|ZP_04731748.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae PID1]
 gi|240121930|ref|ZP_04734892.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae PID24-1]
 gi|240123241|ref|ZP_04736197.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae PID332]
 gi|240125492|ref|ZP_04738378.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae SK-92-679]
 gi|240127944|ref|ZP_04740605.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae SK-93-1035]
 gi|254493504|ref|ZP_05106675.1| acyl-CoA hydrolase [Neisseria gonorrhoeae 1291]
 gi|260440803|ref|ZP_05794619.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae DGI2]
 gi|268594563|ref|ZP_06128730.1| acyl CoA thioester hydrolase [Neisseria gonorrhoeae 35/02]
 gi|268597109|ref|ZP_06131276.1| acyl CoA thioester hydrolase [Neisseria gonorrhoeae FA19]
 gi|268598710|ref|ZP_06132877.1| acyl-CoA hydrolase [Neisseria gonorrhoeae MS11]
 gi|268601068|ref|ZP_06135235.1| acyl-CoA hydrolase [Neisseria gonorrhoeae PID18]
 gi|268603386|ref|ZP_06137553.1| acyl-CoA hydrolase [Neisseria gonorrhoeae PID1]
 gi|268681867|ref|ZP_06148729.1| acyl-CoA hydrolase [Neisseria gonorrhoeae PID332]
 gi|268684082|ref|ZP_06150944.1| acyl-CoA hydrolase [Neisseria gonorrhoeae SK-92-679]
 gi|268686337|ref|ZP_06153199.1| acyl-CoA hydrolase [Neisseria gonorrhoeae SK-93-1035]
 gi|291044119|ref|ZP_06569835.1| acyl CoA thioester hydrolase [Neisseria gonorrhoeae DGI2]
 gi|293399284|ref|ZP_06643449.1| acyl-CoA hydrolase [Neisseria gonorrhoeae F62]
 gi|59718321|gb|AAW89726.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae FA 1090]
 gi|193933584|gb|ACF29408.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae NCCP11945]
 gi|226512544|gb|EEH61889.1| acyl-CoA hydrolase [Neisseria gonorrhoeae 1291]
 gi|268547952|gb|EEZ43370.1| acyl CoA thioester hydrolase [Neisseria gonorrhoeae 35/02]
 gi|268550897|gb|EEZ45916.1| acyl CoA thioester hydrolase [Neisseria gonorrhoeae FA19]
 gi|268582841|gb|EEZ47517.1| acyl-CoA hydrolase [Neisseria gonorrhoeae MS11]
 gi|268585199|gb|EEZ49875.1| acyl-CoA hydrolase [Neisseria gonorrhoeae PID18]
 gi|268587517|gb|EEZ52193.1| acyl-CoA hydrolase [Neisseria gonorrhoeae PID1]
 gi|268622151|gb|EEZ54551.1| acyl-CoA hydrolase [Neisseria gonorrhoeae PID332]
 gi|268624366|gb|EEZ56766.1| acyl-CoA hydrolase [Neisseria gonorrhoeae SK-92-679]
 gi|268626621|gb|EEZ59021.1| acyl-CoA hydrolase [Neisseria gonorrhoeae SK-93-1035]
 gi|291012582|gb|EFE04571.1| acyl CoA thioester hydrolase [Neisseria gonorrhoeae DGI2]
 gi|291610698|gb|EFF39808.1| acyl-CoA hydrolase [Neisseria gonorrhoeae F62]
 gi|317164006|gb|ADV07547.1| putative acyl-CoA hydrolase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 160

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 55/111 (49%), Gaps = 11/111 (9%)

Query: 40  MPTDVNLDGNVFGG---WIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLV 95
           MP   N  GNV GG    ++ Q+  +C  R S   C    VT +V ++LF++PI + DLV
Sbjct: 19  MPDTANFSGNVHGGELLLLLDQVAYSCASRYSGNYC----VTLSVDKVLFKEPIHIGDLV 74

Query: 96  HIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
             Y  +   G+TS+ I   V    +N  +  ++ T      MVAV + G P
Sbjct: 75  TFYAAVNYTGRTSMEIGIRVEA--QNIRTGEIRHTNSCYFTMVAVKD-GKP 122


>gi|322420539|ref|YP_004199762.1| thioesterase superfamily protein [Geobacter sp. M18]
 gi|320126926|gb|ADW14486.1| thioesterase superfamily protein [Geobacter sp. M18]
          Length = 144

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  GN+FGG IMS +D   G+   +  + RVVT     + F  PI V ++++   
Sbjct: 13  LPKDTNAYGNIFGGVIMSIMDKTAGVVCWRYARKRVVTACAQRITFHTPINVGEVIYSRA 72

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            I  +G++S+ +  +V T      +  L         MVAVDE  +P  +
Sbjct: 73  TIIHVGRSSMEVEVEVETENVMDGNKHL--AASGIFTMVAVDENWHPSQV 120


>gi|66048293|ref|YP_238134.1| thioesterase superfamily protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|302187823|ref|ZP_07264496.1| thioesterase superfamily protein [Pseudomonas syringae pv. syringae
           642]
 gi|63259000|gb|AAY40096.1| Thioesterase superfamily [Pseudomonas syringae pv. syringae B728a]
 gi|330898712|gb|EGH30131.1| thioesterase superfamily protein [Pseudomonas syringae pv. japonica
           str. M301072PT]
 gi|330937385|gb|EGH41372.1| thioesterase superfamily protein [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330970260|gb|EGH70326.1| thioesterase superfamily protein [Pseudomonas syringae pv. aceris
           str. M302273PT]
 gi|330976332|gb|EGH76389.1| thioesterase superfamily protein [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 161

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G TS+ +   V T   N     ++ +      MVAVD+   P S+
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHSNSCFFTMVAVDDNRKPASV 122


>gi|330952403|gb|EGH52663.1| thioesterase superfamily protein [Pseudomonas syringae Cit 7]
          Length = 161

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G TS+ +   V T   N     ++ +      MVAVD+   P S+
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHSNSCFFTMVAVDDNRKPASV 122


>gi|269139257|ref|YP_003295958.1| hypothetical protein ETAE_1910 [Edwardsiella tarda EIB202]
 gi|267984918|gb|ACY84747.1| hypothetical protein ETAE_1910 [Edwardsiella tarda EIB202]
          Length = 224

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            PT +N    +FGG  ++ +D    I A++ C+ R+VT +   + F+ PI    +V +  
Sbjct: 115 FPTTINHHATLFGGTALAWMDEVSFITATRFCRKRLVTVSTERINFQHPIPSGSIVELDG 174

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ ++G+TS+T+   ++    +   +  ++        VAVD+ G P
Sbjct: 175 RVTRVGRTSLTVSVTIFL--EDMYREGREEVINGQFNFVAVDDDGRP 219


>gi|319955604|ref|YP_004166871.1| thioesterase superfamily protein [Cellulophaga algicola DSM 14237]
 gi|319424264|gb|ADV51373.1| thioesterase superfamily protein [Cellulophaga algicola DSM 14237]
          Length = 131

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +  +FGG +++ ID  C + +  QL   +VVTK ++E+ F    +  D++ I  
Sbjct: 11  PEDLNANNTLFGGKLLAWIDEECALYSIIQLENKKVVTKYMSEINFMSTAEKGDIIEIGI 70

Query: 100 QIRKIGKTSVTIYCDV 115
           ++ K GK+S+T+ C+V
Sbjct: 71  EVVKFGKSSLTLNCEV 86


>gi|257485676|ref|ZP_05639717.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289625511|ref|ZP_06458465.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289649766|ref|ZP_06481109.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298489457|ref|ZP_07007468.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298156031|gb|EFH97140.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|320321769|gb|EFW77867.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331519|gb|EFW87459.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330870929|gb|EGH05638.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330880970|gb|EGH15119.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330890587|gb|EGH23248.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. mori str. 301020]
 gi|330986946|gb|EGH85049.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331011964|gb|EGH92020.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 161

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G TS+ +   V T   N     ++ +      MVAVD+   P S+
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHSNSCFFTMVAVDDNRKPASV 122


>gi|325969205|ref|YP_004245397.1| thioesterase superfamily protein [Vulcanisaeta moutnovskia 768-28]
 gi|323708408|gb|ADY01895.1| thioesterase superfamily protein [Vulcanisaeta moutnovskia 768-28]
          Length = 338

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 3/109 (2%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P+D  +   V GG +++ +D   G+ A++      VT +V E  F  PI+V D+V I   
Sbjct: 193 PSDAFVGNLVSGGRLLAWLDEIAGLLAARYSGGAAVTGSVDETAFYAPIRVGDIVTIRAG 252

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           I  +GK S+ I  DV       +    +  C A    V VD  G P  +
Sbjct: 253 ITYVGKASMEIMLDVIA---EGAYGHARHVCTAYYTYVHVDSNGRPAPV 298



 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 69/141 (48%), Gaps = 6/141 (4%)

Query: 10  LLLINIITKKEVL-MVCQMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRAS 68
           ++++ +++ KE   MV    +  VL   +Q  P D+N  GN+FGG ++  +     + A+
Sbjct: 1   MIMLKLMSIKEYTNMVSIKETEVVLVEAVQ--PFDINSLGNLFGGRMLEWMANIGTVAAT 58

Query: 69  QLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQ 128
           +  +   V   +    F +P+++ + V +  ++  +G +S+ +  + W        +++ 
Sbjct: 59  RFSRGPAVLAYLDRHFFIRPVRLGEFVILKARVEYVGTSSMEVRIEAWKESLGGKQELVT 118

Query: 129 KTCEATVVMVAVDEKGNPKSI 149
            T   T   VA+DE G P+ I
Sbjct: 119 MT---TASYVAIDEYGVPRPI 136


>gi|237801762|ref|ZP_04590223.1| thioesterase superfamily protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|237806700|ref|ZP_04593404.1| thioesterase superfamily protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331024621|gb|EGI04677.1| thioesterase superfamily protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331027814|gb|EGI07869.1| thioesterase superfamily protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 161

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G TS+ +   V T   N     ++ +      MVAVD+   P S+
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHSNSCFFTMVAVDDNRKPASV 122


>gi|254418074|ref|ZP_05031798.1| thioesterase family protein [Brevundimonas sp. BAL3]
 gi|196184251|gb|EDX79227.1| thioesterase family protein [Brevundimonas sp. BAL3]
          Length = 248

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 59/119 (49%), Gaps = 2/119 (1%)

Query: 31  GVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQ 90
           G L       PT  N  G ++GG  +  +  A  I A++  +  +V  A   + F  PI+
Sbjct: 122 GWLRTAEMVFPTWTNHYGTLYGGDALKLMGKAAFICATRRARGVMVMAASNRIDFSSPIR 181

Query: 91  VSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
             D++ + +++ ++G++SVTI  ++W       +   +++  A  VMVAVDE G    I
Sbjct: 182 EGDMIELASRVTRVGRSSVTIEVELWV--EALLTGERRRSAVAEFVMVAVDEAGRSAPI 238



 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 50/107 (46%), Gaps = 4/107 (3%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D N  G +FGG  ++ +D    + A++  +   VT     + F  P ++ ++V    
Sbjct: 3   FPGDANHHGTLFGGVGLAHLDKVAFLAAARHARRHTVTAGCERIDFAAPARIGEMVEATG 62

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVV-MVAVDEKGN 145
           ++ ++G+TS+ +  ++W     A     ++ C   V  MVA  E G 
Sbjct: 63  RVVRVGRTSMGVEVELWA---EAPVSGERRLCTRGVFNMVAPREAGQ 106


>gi|330961419|gb|EGH61679.1| thioesterase superfamily protein [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 161

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G TS+ +   V T   N     ++ +      MVAVD+   P S+
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHSNSCFFTMVAVDDNRKPASV 122


>gi|218768474|ref|YP_002342986.1| putative acyl-CoA hydrolase [Neisseria meningitidis Z2491]
 gi|304387122|ref|ZP_07369370.1| thioesterase [Neisseria meningitidis ATCC 13091]
 gi|121052482|emb|CAM08821.1| putative acyl-CoA hydrolase [Neisseria meningitidis Z2491]
 gi|304338796|gb|EFM04902.1| thioesterase [Neisseria meningitidis ATCC 13091]
 gi|319410722|emb|CBY91104.1| putative acyl-CoA thioester hydrolase [Neisseria meningitidis WUE
           2594]
          Length = 160

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 55/111 (49%), Gaps = 11/111 (9%)

Query: 40  MPTDVNLDGNVFGG---WIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLV 95
           MP   N  GNV GG    ++ Q+  +C  R S   C    VT +V ++LF++PI + DLV
Sbjct: 19  MPDTANFSGNVHGGELLLLLDQVAYSCASRYSGNYC----VTLSVDKVLFKEPIHIGDLV 74

Query: 96  HIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
             Y  +   G+TS+ I   V    +N  +  ++ T      MVAV + G P
Sbjct: 75  TFYAAVNYTGRTSMEIGIRVEA--QNIRTGEIRHTNSCYFTMVAVKD-GKP 122


>gi|300311987|ref|YP_003776079.1| acyl-CoA thioester hydrolase [Herbaspirillum seropedicae SmR1]
 gi|300074772|gb|ADJ64171.1| acyl-CoA thioester hydrolase protein [Herbaspirillum seropedicae
           SmR1]
          Length = 159

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 56/120 (46%), Gaps = 8/120 (6%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWI---MSQIDIACGIRASQLCKCRVVTKAVTELLFE 86
           S  LT+ +   P   N  GNV GG I   + Q+  ACG   S+     VVT +V +++F 
Sbjct: 5   SHQLTMTVLMTPDMANFAGNVHGGTILKLLDQVAYACG---SRYAGQYVVTLSVDQVMFR 61

Query: 87  KPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +PI V +LV     +   GK+S+ I   V     N  +   +        MVAVD++  P
Sbjct: 62  QPIHVGELVTFLASVNHTGKSSMEIGIKVVA--ENIRTQETRHVNSCFFTMVAVDDQRKP 119


>gi|261401463|ref|ZP_05987588.1| thioesterase family protein [Neisseria lactamica ATCC 23970]
 gi|296314083|ref|ZP_06864024.1| thioesterase family protein [Neisseria polysaccharea ATCC 43768]
 gi|313668129|ref|YP_004048413.1| acyl-CoA hydrolase [Neisseria lactamica ST-640]
 gi|269208512|gb|EEZ74967.1| thioesterase family protein [Neisseria lactamica ATCC 23970]
 gi|296839339|gb|EFH23277.1| thioesterase family protein [Neisseria polysaccharea ATCC 43768]
 gi|309378350|emb|CBX23047.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313005591|emb|CBN87027.1| putative acyl-CoA hydrolase [Neisseria lactamica 020-06]
          Length = 160

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 55/111 (49%), Gaps = 11/111 (9%)

Query: 40  MPTDVNLDGNVFGG---WIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLV 95
           MP   N  GNV GG    ++ Q+  +C  R S   C    VT +V ++LF++PI + DLV
Sbjct: 19  MPDTANFSGNVHGGELLLLLDQVAYSCASRYSGNYC----VTLSVDKVLFKEPIHIGDLV 74

Query: 96  HIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
             Y  +   G+TS+ I   V    +N  +  ++ T      MVAV + G P
Sbjct: 75  TFYAAVNYTGRTSMEIGIRVEA--QNIRTGEIRHTNSCYFTMVAVKD-GKP 122


>gi|212709889|ref|ZP_03318017.1| hypothetical protein PROVALCAL_00938 [Providencia alcalifaciens DSM
           30120]
 gi|212687700|gb|EEB47228.1| hypothetical protein PROVALCAL_00938 [Providencia alcalifaciens DSM
           30120]
          Length = 135

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            PT  N    +FGG  ++ +D    I A++ C+ R+VT +  ++ F  PI    +V +  
Sbjct: 25  FPTTTNHHSTLFGGTALAWMDEVSFITATRFCRKRLVTVSTEKINFTHPIPSGTIVELVG 84

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ ++G+TS+T+   ++    +  ++  ++        VA+D+ G P
Sbjct: 85  KVIRVGRTSLTVNVSIFL--EDMYAEGREEVIHGQFNFVAIDDNGKP 129


>gi|227825044|ref|ZP_03989876.1| thioesterase [Acidaminococcus sp. D21]
 gi|226905543|gb|EEH91461.1| thioesterase [Acidaminococcus sp. D21]
          Length = 130

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 52/107 (48%), Gaps = 3/107 (2%)

Query: 45  NLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIRKI 104
           N  G++FGG +M+ +D   GI A +    RV T AV  + F  PI    ++ +  ++  +
Sbjct: 18  NSAGHLFGGTLMAWMDELSGITAHRYVWTRVTTAAVKGMNFYVPIHYGRVLELEGRVVHV 77

Query: 105 GKTSVTIYCDVWTCP-RNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           G++S+ +    +  P       VL    +A  V V++ E G P  IR
Sbjct: 78  GRSSLDVEIKAYLEPVEEGGERVL--AADAVFVYVSISETGRPLPIR 122


>gi|309777266|ref|ZP_07672228.1| thioesterase family protein [Erysipelotrichaceae bacterium 3_1_53]
 gi|308914946|gb|EFP60724.1| thioesterase family protein [Erysipelotrichaceae bacterium 3_1_53]
          Length = 161

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 58/110 (52%), Gaps = 3/110 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           M   +N  G +FGG +   ID+  G+ A + C   + T ++  L F++ + +++L+ ++ 
Sbjct: 20  MANHLNGSGRLFGGQLAEWIDVLAGVVARRHCNRNITTASIDSLNFKEAVHLNELMVLHG 79

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++  +G TS+ I  D +   R+    V +    A +  VA+D++  P ++
Sbjct: 80  KVTYVGNTSMEIRVDSYLENRDG---VRRLVNTAYLTEVALDDEDRPATV 126


>gi|289677460|ref|ZP_06498350.1| thioesterase superfamily protein [Pseudomonas syringae pv. syringae
           FF5]
          Length = 121

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 54/116 (46%), Gaps = 2/116 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           +LV     +   G TS+ +   V T   N     ++ +      MVAVD+   P S
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHSNSCFFTMVAVDDNRKPAS 121


>gi|251797288|ref|YP_003012019.1| thioesterase superfamily protein [Paenibacillus sp. JDR-2]
 gi|247544914|gb|ACT01933.1| thioesterase superfamily protein [Paenibacillus sp. JDR-2]
          Length = 170

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 59/111 (53%), Gaps = 10/111 (9%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            PTDVN    +FGG +M+ ID    I A++ C+  VVT +   + F +PI+ SD V + +
Sbjct: 18  FPTDVNNHNTLFGGKLMAYIDDIASIAATKHCRRAVVTASTDSVDFLQPIRPSDSVCLES 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVL--QKTCEAT--VVMVAVDEKGNP 146
            +   G+TSV ++  V         D+L  ++   AT  +  VA+D+  +P
Sbjct: 78  FVTWTGRTSVEVFVKV------IKEDLLTGERIVAATSFLTFVALDQNRHP 122


>gi|319951151|ref|ZP_08024996.1| 4-hydroxybenzoyl-CoA thioesterase [Dietzia cinnamea P4]
 gi|319435167|gb|EFV90442.1| 4-hydroxybenzoyl-CoA thioesterase [Dietzia cinnamea P4]
          Length = 326

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           TL++   P+DVN  GN  GG IMS ID A  + A+Q       +     + F  P+++ D
Sbjct: 176 TLRLLAAPSDVNWGGNAHGGRIMSWIDDAANLCAAQWSGTPCTSVYAGGVRFYHPVRIGD 235

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +V +  ++   G  ++ +   V +    +S+  L   C      +  D +  P
Sbjct: 236 VVEVEARLLHTGHETMHVSVHVRSGAATSSARTLSTHCLTVCAALGADGRPTP 288



 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 51/115 (44%), Gaps = 3/115 (2%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDL 94
           L+    PTDV     V  G I+  ID A    A+       VT  V  + F +PI   DL
Sbjct: 19  LRFLAAPTDVGTGTQVHTGRILEWIDKAAYALAAGWSGGYAVTAYVGNVRFSRPIASGDL 78

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           V +  ++   G +S+ I CDV  C  + +    +   E  VV +AV + G P  +
Sbjct: 79  VEVSARLVHTGTSSMHIQCDVRAC--DPARPGYRHCAECLVVFIAVRD-GAPTPV 130


>gi|150376295|ref|YP_001312891.1| thioesterase superfamily protein [Sinorhizobium medicae WSM419]
 gi|150030842|gb|ABR62958.1| thioesterase superfamily protein [Sinorhizobium medicae WSM419]
          Length = 167

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  G V GG +++ +D      AS+  K   VT +V +++F++PI V 
Sbjct: 10  LVMTVLMTPDMANFSGKVHGGALLNLLDRVAFSCASRFSKQYAVTLSVDQVIFKEPILVG 69

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G+TS+ +   V     N  +   + T      MVAVDE G P ++
Sbjct: 70  ELVTFRAAVNFAGRTSMEVGIRVEA--ENIRAGTRRHTNSCYFTMVAVDEAGRPVAV 124


>gi|256420767|ref|YP_003121420.1| thioesterase superfamily protein [Chitinophaga pinensis DSM 2588]
 gi|256035675|gb|ACU59219.1| thioesterase superfamily protein [Chitinophaga pinensis DSM 2588]
          Length = 131

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N  G +FGG ++  ID    I +  QL   R VTK ++E+ F    +  D+V +  
Sbjct: 11  PEDLNAHGTLFGGSLLRWIDEEAAIYSIIQLGTNRCVTKYMSEINFVSSAKQGDIVELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +    G+TS+T+ C V    RN  +  +  T +  +V V+VDE G P
Sbjct: 71  KATHFGRTSLTLACQV----RNKITQKVILTVDK-MVFVSVDENGTP 112


>gi|157374390|ref|YP_001472990.1| thioesterase superfamily protein [Shewanella sediminis HAW-EB3]
 gi|157316764|gb|ABV35862.1| thioesterase superfamily protein [Shewanella sediminis HAW-EB3]
          Length = 122

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P  +N    +FGG ++S ID    I A  Q+    +VTK ++E+ F  P +  D++    
Sbjct: 11  PEHLNPANALFGGQLLSWIDEEAAIFAGCQMKSVSIVTKLISEINFMAPARQGDVIEFGL 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++   G TS+ + C+V    RN  +  L   C   +V V VDEKG P
Sbjct: 71  ELISAGSTSIVVRCEV----RNKMTH-LPVVCINKMVFVNVDEKGVP 112


>gi|71734145|ref|YP_277228.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71554698|gb|AAZ33909.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 170

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G TS+ +   V T   N     ++ +      MVAVD+   P S+
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHSNSCFFTMVAVDDNRKPASV 122


>gi|330721859|gb|EGG99824.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [gamma proteobacterium IMCC2047]
          Length = 169

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 55/114 (48%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  GNV GG I+  +D      A++ C+  VVT ++  ++F KPI+V 
Sbjct: 8   LHMTVLMTPDMGNFSGNVHGGSILKLLDQVAYACAARYCRHYVVTLSIDHVMFNKPIKVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +LV     I  +G +S+ +   V     +  ++  + T    + M+ VD+   P
Sbjct: 68  ELVSFRANINYVGTSSMEV--GVKVIAEDLETNTKRHTNSCYITMICVDKDHRP 119


>gi|325920757|ref|ZP_08182663.1| acyl-CoA hydrolase [Xanthomonas gardneri ATCC 19865]
 gi|325548809|gb|EGD19757.1| acyl-CoA hydrolase [Xanthomonas gardneri ATCC 19865]
          Length = 163

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 50/112 (44%), Gaps = 2/112 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT +    P+DVN  G V GG +M  ID      AS       VT AV  + F  P+++ 
Sbjct: 8   LTFRFLAEPSDVNFGGKVHGGVVMKWIDQVGFAAASGWSGHYCVTVAVGGIRFVAPVRIG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           DLV +  ++   G+TS+    DV           L   C   +V VA+D  G
Sbjct: 68  DLVAVSAKLVYTGRTSMHFAIDVRARSPMGGDSRLCTHC--IIVFVAMDPDG 117


>gi|308178459|ref|YP_003917865.1| thioesterase family domain-containing protein [Arthrobacter
           arilaitensis Re117]
 gi|307745922|emb|CBT76894.1| thioesterase family domain-containing protein [Arthrobacter
           arilaitensis Re117]
          Length = 328

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 56/118 (47%), Gaps = 4/118 (3%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    PTDV++ G V  G ++  +D A    A        VT  V  + FE PI   
Sbjct: 13  VTLRFLAAPTDVDVTGIVPAGSVLEWVDKAAYAAAVGWSSSYCVTAYVGNIHFEDPIHSG 72

Query: 93  DLVHIYTQIRKIGKTSVTIYCDV-WTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           DLV +   +   G +S+ I+ +V ++ PR     V   +C   V+ VAV E G P  +
Sbjct: 73  DLVEVTASVVYTGTSSMHIHTEVSFSDPRELRP-VKSSSC--LVIFVAVGEDGKPTPV 127



 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 52/112 (46%), Gaps = 2/112 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL+    PTDVN  G V GG +M  ID A  + A++ C+   V      + F +P+ + 
Sbjct: 172 VTLRFLAAPTDVNWGGKVHGGIVMKWIDDAAELCAARYCQQETVAVFSGGVRFYRPLLIG 231

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
            LV +  ++   G   + +   V +   +  +  +Q T     VMV  DE G
Sbjct: 232 HLVEVEARLVYTGNKGMHVAVHVRSG--DPKTGEMQLTTYCLTVMVTRDETG 281


>gi|189910541|ref|YP_001962096.1| acyl-CoA hydrolase [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Ames)']
 gi|167775217|gb|ABZ93518.1| Acyl-CoA hydrolase [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Ames)']
          Length = 137

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N   N+FGG ++S ID    +   +++    +VT ++  ++F  P +  D++ IY 
Sbjct: 22  PDDLNYHNNLFGGKMLSWIDEGMAMYVMNKIRYTNIVTMSMDNVVFRSPARAGDIIQIYG 81

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           +I K GK+S+T          +  +  +    E+ +  V + E G P +
Sbjct: 82  KIVKYGKSSIT--SRTLAITNHPQTGKMSAVIESDITYVCLGENGKPTA 128


>gi|161870349|ref|YP_001599519.1| acyl-CoA hydrolase [Neisseria meningitidis 053442]
 gi|161595902|gb|ABX73562.1| acyl-CoA hydrolase [Neisseria meningitidis 053442]
 gi|325205763|gb|ADZ01216.1| thioesterase family protein [Neisseria meningitidis M04-240196]
          Length = 160

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 55/111 (49%), Gaps = 11/111 (9%)

Query: 40  MPTDVNLDGNVFGG---WIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLV 95
           MP   N  GNV GG    ++ Q+  +C  R S   C    VT +V ++LF++PI + DLV
Sbjct: 19  MPDTANFSGNVHGGELLLLLDQVAYSCASRYSGNYC----VTLSVDKVLFKEPIHIGDLV 74

Query: 96  HIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
             Y  +   G+TS+ I   V    +N  +  ++ T      MVAV + G P
Sbjct: 75  TFYAAVNYTGRTSMEIGIRVEA--QNIRTGEVRHTNSCYFTMVAVKD-GKP 122


>gi|332284821|ref|YP_004416732.1| acyl-CoA hydrolase [Pusillimonas sp. T7-7]
 gi|330428774|gb|AEC20108.1| acyl-CoA hydrolase [Pusillimonas sp. T7-7]
          Length = 160

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  G V GG I+  +D      AS+     VVT +V +++F +PI+V 
Sbjct: 8   LTMTVLMTPDTANFSGKVHGGAILKLLDQVAYACASRYAGRYVVTLSVDQVMFRQPIKVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G +S+ I   V     +    V++        M+AVD+ G P  +
Sbjct: 68  ELVTFLASVNHTGNSSMEIGIKVIA--EDIRDKVVRHVNSCFFTMIAVDDDGKPAKV 122


>gi|146283890|ref|YP_001174043.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas stutzeri A1501]
 gi|145572095|gb|ABP81201.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas stutzeri A1501]
          Length = 158

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 10/110 (9%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V +LV     
Sbjct: 7   PDKANFSGNVHGGTLLKYLDEVAYACASRYAGQYVVTLSVDQVVFRQPVHVGELVTFLAS 66

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEAT----VVMVAVDEKGNP 146
           +   G TS+ I   V T       D+  KT   T      MVA+ E G P
Sbjct: 67  VNYTGTTSMEIGIKVVT------EDIRSKTVRHTNSCFFTMVALGEDGKP 110


>gi|289583142|ref|YP_003481608.1| thioesterase superfamily protein [Natrialba magadii ATCC 43099]
 gi|289532695|gb|ADD07046.1| thioesterase superfamily protein [Natrialba magadii ATCC 43099]
          Length = 146

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 53/114 (46%), Gaps = 12/114 (10%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P   N+  +  GG +M  +D    + A +      VT  V ++ FE+PI V D  +I   
Sbjct: 17  PNHANMLESAHGGNVMKWMDEVGAMSAMRFSGETCVTARVNQMNFERPISVGDTAYITAY 76

Query: 101 IRKIGKTSVTIYC-----DVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +   G++SV +       D+ T  R       +KT E+  V VA+DE  +P S+
Sbjct: 77  VYDAGESSVRVRLVTEREDLRTRER-------EKTTESYFVYVAIDENNDPTSV 123


>gi|325287838|ref|YP_004263628.1| thioesterase superfamily protein [Cellulophaga lytica DSM 7489]
 gi|324323292|gb|ADY30757.1| thioesterase superfamily protein [Cellulophaga lytica DSM 7489]
          Length = 129

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 59/108 (54%), Gaps = 6/108 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +  +FGG +++ +D    +    QL   +VVTK ++E+ F    +  D+V I  
Sbjct: 11  PGDLNANKTLFGGKVLAWVDEEAALYTIIQLENKKVVTKYMSEINFMSSAKEGDIVEIGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPK 147
           ++ K G +S+T+ C+V    RN  +     T +  ++MV +DE G PK
Sbjct: 71  EVIKFGVSSLTLNCEV----RNKMTRETILTVD-NIIMVNLDENGKPK 113


>gi|255038158|ref|YP_003088779.1| thioesterase superfamily protein [Dyadobacter fermentans DSM 18053]
 gi|254950914|gb|ACT95614.1| thioesterase superfamily protein [Dyadobacter fermentans DSM 18053]
          Length = 187

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 58/116 (50%), Gaps = 2/116 (1%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSD 93
           TL    +P+  N  G + GG ++S ID      AS+      VT +V  + F +P++V D
Sbjct: 14  TLTELMIPSYANFGGKIHGGILLSLIDKVAYACASRHAGTYCVTVSVDGVDFLQPVEVGD 73

Query: 94  LVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           LV ++  +  +G+TS+ +   +     N  +  ++ T  + V MVA D+   P ++
Sbjct: 74  LVSLHASVNYVGRTSLVV--GIRVIAENVRNRTVRHTNTSYVTMVAKDDDNKPTAV 127


>gi|268590040|ref|ZP_06124261.1| long-chain acyl-CoA thioester hydrolase family protein [Providencia
           rettgeri DSM 1131]
 gi|291314575|gb|EFE55028.1| long-chain acyl-CoA thioester hydrolase family protein [Providencia
           rettgeri DSM 1131]
          Length = 135

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            PT  N    +FGG  ++ +D    I A++  + R+VT +  ++ F  PI    +V +  
Sbjct: 25  FPTTTNHHSTLFGGTALAWMDEVSFITATRFSRKRLVTVSTEKINFTHPIPSGTIVELVG 84

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ ++G+TS+T+   ++    +  SD  ++        VA+D+ G P
Sbjct: 85  KVIRVGRTSLTVNVSIFL--EDMYSDGREEVIHGQFNFVAIDDNGKP 129


>gi|183220428|ref|YP_001838424.1| putative acyl-CoA thioester hydrolase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|167778850|gb|ABZ97148.1| Putative acyl-CoA thioester hydrolase (modular protein) [Leptospira
           biflexa serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 126

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N   N+FGG ++S ID    +   +++    +VT ++  ++F  P +  D++ IY 
Sbjct: 11  PDDLNYHNNLFGGKMLSWIDEGMAMYVMNKIRYTNIVTMSMDNVVFRSPARAGDIIQIYG 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           +I K GK+S+T          +  +  +    E+ +  V + E G P +
Sbjct: 71  KIVKYGKSSIT--SRTLAITNHPQTGKMSAVIESDITYVCLGENGKPTA 117


>gi|162454055|ref|YP_001616422.1| Acyl-CoA thioester hydrolase [Sorangium cellulosum 'So ce 56']
 gi|161164637|emb|CAN95942.1| Acyl-CoA thioester hydrolase [Sorangium cellulosum 'So ce 56']
          Length = 162

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 58/121 (47%), Gaps = 2/121 (1%)

Query: 29  SSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKP 88
           S  V T+    +PT  N  G++FGG +++ ID+   I A +     VVT  + +L F+  
Sbjct: 10  SESVTTMTEYVLPTHTNALGSIFGGQVLAWIDLCAAICAQRHTGSAVVTAGIDDLSFDHG 69

Query: 89  IQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
           I+V  +V +  ++    +TS+ I   V     +A +  +     A V  VAVD    P S
Sbjct: 70  IKVGQVVRLAARVTATFRTSLEILVSVEG--EDAMTGAIWPMVTAFVTFVAVDASLRPTS 127

Query: 149 I 149
           +
Sbjct: 128 V 128


>gi|120435433|ref|YP_861119.1| acyl-CoA thioester hydrolase [Gramella forsetii KT0803]
 gi|117577583|emb|CAL66052.1| acyl-CoA thioester hydrolase [Gramella forsetii KT0803]
          Length = 183

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 8/109 (7%)

Query: 40  MPTDVNLDGNVFGGWIMS---QIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVH 96
           +P+  N +G + GG+I+S   QI  AC   AS+  +   VT +V  + F KPI++ +LV 
Sbjct: 20  LPSHSNFNGKIHGGYILSLLDQIAFAC---ASKHSRAYCVTASVDTVDFLKPIEIGELVT 76

Query: 97  IYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           +   +  +G++S+ I   V     N  + + +    +   MVA ++KG+
Sbjct: 77  MKASVNYVGRSSMVIGIRVEA--ENIQTGITKHCNSSYFTMVAKNDKGD 123


>gi|160893831|ref|ZP_02074614.1| hypothetical protein CLOL250_01385 [Clostridium sp. L2-50]
 gi|156864483|gb|EDO57914.1| hypothetical protein CLOL250_01385 [Clostridium sp. L2-50]
          Length = 158

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 53/113 (46%), Gaps = 3/113 (2%)

Query: 37  IQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVH 96
            Q  P  +N  G +FGG +M+ ID   G+   +     V+T +V  L F +   + DL+ 
Sbjct: 17  FQVRPEHLNGAGRLFGGQLMAWIDEVAGLVGIRHSNGDVITASVDNLKFMRGAYLKDLIV 76

Query: 97  IYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +  +I  +G TS+ +  D +         + +    A + +VAVDE   P+ +
Sbjct: 77  LVGRITYVGHTSMDVRVDTYIEDHRG---IRRSINRAYLTLVAVDENDKPRPV 126


>gi|330951362|gb|EGH51622.1| 4-hydroxybenzoyl-CoA thioesterase domain-containing protein
           [Pseudomonas syringae Cit 7]
          Length = 131

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
                G+TS+T+ C V    RN  +     T +  +V V +DE G P
Sbjct: 71  TPTDFGRTSITLKCQV----RNKITRKSILTVDK-IVFVNLDEDGQP 112


>gi|78355383|ref|YP_386832.1| thioesterase family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78217788|gb|ABB37137.1| thioesterase family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 176

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCR-VVTKAVTELLFEKPIQVSDLVH 96
           + +P D N  GN+ GG I+  ID+A  + A +  + R VVT ++  + F+  + V +L+ 
Sbjct: 16  RGLPQDANPAGNIHGGTILKHIDLAGAVAAMRHARGRTVVTASIDRMEFKAAVHVGELMV 75

Query: 97  IYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +   +  +  TS+ +   V     N  +  ++    A +  VA+DE   P ++
Sbjct: 76  LKASVNMVSNTSMEVGVRVEA--ENLLTGEVRHAASAYLTFVAMDENRRPTAV 126


>gi|307594971|ref|YP_003901288.1| thioesterase superfamily protein [Vulcanisaeta distributa DSM
           14429]
 gi|307550172|gb|ADN50237.1| thioesterase superfamily protein [Vulcanisaeta distributa DSM
           14429]
          Length = 324

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 51/109 (46%), Gaps = 3/109 (2%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P+D  +   V GG +++ +D   G+ A++      VT +V E  F  PI+V D+V +   
Sbjct: 179 PSDAFVGNLVSGGRLLAWLDEIAGLLAARYSGGAAVTGSVDETAFYAPIRVGDIVTVRAG 238

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           I  +GK+S+ I  DV       +    +  C A    V VD  G P  +
Sbjct: 239 ITYVGKSSMEIMLDVIA---EGTYGQARHVCTAYYTYVHVDSSGRPAPV 284



 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 56/117 (47%), Gaps = 3/117 (2%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           +TL     P D+N  GN+FGG ++  +     + A++  +   V   +    F +P+++ 
Sbjct: 9   VTLVEAVQPFDINSLGNLFGGRMLEWMANIGTVAATRFSRGPAVLAYLDRHFFIRPVRLG 68

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           + V +  ++  +G +S+ +  + W        +++  T   T   VAVDE G P+ I
Sbjct: 69  EFVILRARVEYVGTSSMEVRIEAWKESPGGKQELVTMT---TASYVAVDEYGVPRPI 122


>gi|157962374|ref|YP_001502408.1| thioesterase superfamily protein [Shewanella pealeana ATCC 700345]
 gi|157847374|gb|ABV87873.1| thioesterase superfamily protein [Shewanella pealeana ATCC 700345]
          Length = 142

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P+  N    +FGG  ++ +D    I A++ C+  +VT +   + F KPI    L  I  
Sbjct: 30  FPSITNHHNTLFGGEALAWMDETAFIAATRFCRKTLVTVSSDRIDFNKPIPAGSLAEIIA 89

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++  +G TSV +  +++    +   D+ +         VAVDE+  P ++
Sbjct: 90  RVIHVGNTSVKVEVNIFV--EDMYQDLREHAIRGVFTFVAVDEQRKPTAV 137


>gi|311746854|ref|ZP_07720639.1| thioesterase domain protein [Algoriphagus sp. PR1]
 gi|126578539|gb|EAZ82703.1| thioesterase domain protein [Algoriphagus sp. PR1]
          Length = 175

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N   N+ GG +M  +D+   I A +     VVT +   + F++PI + ++V + +
Sbjct: 19  LPNDTNTLNNLMGGKLMHWLDVVAAIAAQKHSNRIVVTASADSISFKEPIALGNVVTLKS 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           Q+ +   +S+ ++ +V      A+  ++  T  A    VAVD+ G P
Sbjct: 79  QVTRSFNSSMEVFIEVIAEDIPANKKIM--THRAFFTFVAVDQNGKP 123


>gi|315926046|ref|ZP_07922247.1| thioesterase [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315620660|gb|EFV00640.1| thioesterase [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 155

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 52/117 (44%), Gaps = 15/117 (12%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           P+  N  GNV GG IM  +D +      +  K   VT  V E+ F  PI V DLV     
Sbjct: 15  PSQANAMGNVHGGEIMKLMDSSAAAVCIRYAKANCVTARVDEIDFHLPIMVGDLVTCTAS 74

Query: 101 IRKIGKTSVTIYCDVWT-------CPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           +  IG++S+ +Y  V T        PR+A S        A   +V +   G PK +R
Sbjct: 75  LVYIGQSSLEVYVTVDTEDMKSAAGPRHALS--------AFFTLVCLGRDGKPKPVR 123


>gi|304407342|ref|ZP_07388995.1| thioesterase superfamily protein [Paenibacillus curdlanolyticus
           YK9]
 gi|304343783|gb|EFM09624.1| thioesterase superfamily protein [Paenibacillus curdlanolyticus
           YK9]
          Length = 181

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 58/113 (51%), Gaps = 10/113 (8%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           +  PTDVN    +FGG +M+ +D    I AS+ C+  VVT +   + F  PI+ SD V +
Sbjct: 27  RVFPTDVNNHNTLFGGKLMAYVDDIASIAASKHCRRSVVTASTDSVDFLHPIRPSDSVCM 86

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVL--QKTCEAT--VVMVAVDEKGNP 146
            + +   G +S+ ++  +         D+L  ++T  AT  +  VA+DE   P
Sbjct: 87  ESYVTWTGNSSMEVFVKI------IKEDLLNGERTIAATSFLTFVALDENRKP 133


>gi|104783229|ref|YP_609727.1| long-chain acyl-CoA thioester hydrolase [Pseudomonas entomophila
           L48]
 gi|95112216|emb|CAK16943.1| putative long-chain acyl-CoA thioester hydrolase [Pseudomonas
           entomophila L48]
          Length = 135

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N    +FGG  ++ +D    I A++ C+  +VT +   + F+ PI    +V +  
Sbjct: 24  FPNTTNHHNTLFGGTALAWMDEVSFIAATRFCRLPLVTVSTDRIDFKHPIPAGSIVELVG 83

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            + K+G TS+ +  DV+    N   D  ++        VA+DE   P
Sbjct: 84  SVVKVGNTSLQVQVDVFV--ENMYLDGRERAIHGVFSFVAIDEDKRP 128


>gi|294497577|ref|YP_003561277.1| Thioesterase family protein [Bacillus megaterium QM B1551]
 gi|295702948|ref|YP_003596023.1| Thioesterase family protein [Bacillus megaterium DSM 319]
 gi|294347514|gb|ADE67843.1| Thioesterase family protein [Bacillus megaterium QM B1551]
 gi|294800607|gb|ADF37673.1| Thioesterase family protein [Bacillus megaterium DSM 319]
          Length = 169

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P D+N    +FGG +MS ID+   I A +  +   VT +   + F  PI   D V + +
Sbjct: 18  FPNDINNHNTLFGGKLMSDIDMIASISAYRHSRTECVTASADSIHFLHPITPQDSVCLES 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +   G++S+ ++  V     N  +   Q    + +  VA+D+ G P+++
Sbjct: 78  YVSWTGRSSMEVFVKV--IKENLKTGERQIAATSFLTFVAMDDDGKPRAV 125


>gi|330812679|ref|YP_004357141.1| thioesterase [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327380787|gb|AEA72137.1| putative thioesterase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 161

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +PI V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPIHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G TS+ +   V T   N     ++ T      MVAVD+   P ++
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHTNSCFFTMVAVDDLRKPAAV 122


>gi|304404470|ref|ZP_07386131.1| thioesterase superfamily protein [Paenibacillus curdlanolyticus
           YK9]
 gi|304346277|gb|EFM12110.1| thioesterase superfamily protein [Paenibacillus curdlanolyticus
           YK9]
          Length = 210

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P+D N  G +FGG +M  +D    I A +  +C VVT +   + F +PI++ D++ + +
Sbjct: 68  FPSDTNHLGTMFGGKVMEYMDKVAAISAMRHARCAVVTASTDHIDFVQPIRLGDVITVES 127

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            +    ++S+ +Y    +   N  +        A  + VA++++G P ++
Sbjct: 128 FVTWTHRSSMEVYVSAQS--ENLRTGDRITAVTAFFIFVALNDEGKPTAV 175


>gi|326797771|ref|YP_004315590.1| thioesterase superfamily protein [Sphingobacterium sp. 21]
 gi|326548535|gb|ADZ76920.1| thioesterase superfamily protein [Sphingobacterium sp. 21]
          Length = 132

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 52/107 (48%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N    ++GG  M+ +D    I  ++ C+ R+VT +   + F KPI    +V +  
Sbjct: 23  FPNTTNHYDTLYGGTAMALMDEVAFITGTRFCRKRLVTVSSDRIDFTKPIPAGTIVELIG 82

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ K+G+TS+ I  +++        +  +   + T   VA+D+  NP
Sbjct: 83  KVEKVGRTSLKIGVEIFV--EQMYEEHREIAIKGTFTFVAIDQDKNP 127


>gi|104784402|ref|YP_610900.1| long-chain acyl-CoA thioester hydrolase family protein [Pseudomonas
           entomophila L48]
 gi|95113389|emb|CAK18117.1| putative long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas entomophila L48]
          Length = 161

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 53/114 (46%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LTMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGTYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +LV     +   G TS+ +   V T   N     ++ +      MVAVD+   P
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHSNSCFFTMVAVDDDRRP 119


>gi|227547965|ref|ZP_03978014.1| acyl-CoA hydrolase [Corynebacterium lipophiloflavum DSM 44291]
 gi|227079976|gb|EEI17939.1| acyl-CoA hydrolase [Corynebacterium lipophiloflavum DSM 44291]
          Length = 334

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 56/119 (47%), Gaps = 6/119 (5%)

Query: 30  SGVLTLKIQTMPTDVNLDG--NVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
           S  +TL+    P DV L G   V GG ++  ID A    A Q      VT  V  + F +
Sbjct: 10  SPFVTLRFMAAPDDVILAGAQGVSGGRVLEWIDKAAYACAVQWSGTYCVTAYVGHIHFTR 69

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAVDEKGN 145
           PI    LV + ++I   G+TS+ I  +V +  PR     V  + C+  V+ VA D K N
Sbjct: 70  PIPSGHLVEVRSRIAMTGRTSMHIVNEVLSADPREG---VFTRACDCLVIFVAKDPKTN 125



 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 6/113 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQID---IACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           PTD+N  G V GG  M  ID   +AC +   +    R V      + F+KPI + DLV +
Sbjct: 183 PTDINWGGKVHGGSAMEWIDEAGVACTM---EWSGERTVAVYAGGIRFKKPISIGDLVEV 239

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
             +I +    S+ +   V +       + L     AT   V VD  G P + R
Sbjct: 240 DARITRTEARSMQLVIQVRSGNPRGGREALTPAIHATFTYVGVDIDGQPLAAR 292


>gi|264679593|ref|YP_003279500.1| thioesterase superfamily [Comamonas testosteroni CNB-2]
 gi|299533316|ref|ZP_07046700.1| thioesterase superfamily protein [Comamonas testosteroni S44]
 gi|262210106|gb|ACY34204.1| thioesterase superfamily [Comamonas testosteroni CNB-2]
 gi|298718846|gb|EFI59819.1| thioesterase superfamily protein [Comamonas testosteroni S44]
          Length = 159

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (45%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ +   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI
Sbjct: 5   SHQLSMTVLMSPDMANFSGNVHGGAILKLLDQVAYACASRYAGRYVVTLSVDQVMFLQPI 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   GK+S+ I   V        S V++        MVAVD+   P  +
Sbjct: 65  HVGELVTFLASVNHTGKSSMEIGIKV--IAEEIRSQVVRHVNSCFFTMVAVDDDKKPAPV 122


>gi|300772033|ref|ZP_07081903.1| thioesterase [Sphingobacterium spiritivorum ATCC 33861]
 gi|300760336|gb|EFK57162.1| thioesterase [Sphingobacterium spiritivorum ATCC 33861]
          Length = 175

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N   N+ GG ++  +DI   + A +     VVT +V  + F++ I++ +++ I  
Sbjct: 18  LPNDTNTFNNLMGGRLLYWMDICSAMAAQKHANSPVVTVSVDNVSFKRSIKLGEVLTIEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           Q+ +   TS+ +  +V+   +N       K+ EA    VAVDE   P+ I
Sbjct: 78  QVTRAFNTSLEVRMEVFA--QNLPLGTKVKSNEAYYTFVAVDEHTQPQPI 125


>gi|91216036|ref|ZP_01253005.1| long-chain acyl-CoA thioester hydrolase family protein
           [Psychroflexus torquis ATCC 700755]
 gi|91186013|gb|EAS72387.1| long-chain acyl-CoA thioester hydrolase family protein
           [Psychroflexus torquis ATCC 700755]
          Length = 127

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 50/107 (46%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N    +FGG  M  +D    I A++  + R+VT +  ++ F+KPI    ++ +  
Sbjct: 19  FPNTTNHYDTLFGGTAMQSMDETAFITATRFSRQRMVTVSSDKIDFKKPIPAGTIIELVG 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            +  +G TS+ +  D++       ++  +K        VA+DE  NP
Sbjct: 79  LVTYVGNTSLKVRVDIFV--EEMYTEFREKAVTGEFTFVAIDEDKNP 123


>gi|284040655|ref|YP_003390585.1| thioesterase superfamily protein [Spirosoma linguale DSM 74]
 gi|283819948|gb|ADB41786.1| thioesterase superfamily protein [Spirosoma linguale DSM 74]
          Length = 185

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 58/120 (48%), Gaps = 10/120 (8%)

Query: 34  TLKIQTMPTDVNLDGNVFGGWIMSQID---IACGIR-ASQLCKCRVVTKAVTELLFEKPI 89
           TL    +P+  N  G V GG ++S +D    AC  + A Q C    VT +V  + F +P+
Sbjct: 12  TLTELMIPSYANFGGRVHGGILLSLMDKVAYACAAKHAGQYC----VTVSVDGVNFRQPV 67

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +V +LV +   +  +G+TS+ +   +     N  S  ++ T  +   MVA DE   P  +
Sbjct: 68  EVGELVSLLASVNYVGRTSLVV--GIKVIAENVKSGTVKHTNTSYFTMVAKDEHERPTEV 125


>gi|186472960|ref|YP_001860302.1| thioesterase superfamily protein [Burkholderia phymatum STM815]
 gi|184195292|gb|ACC73256.1| thioesterase superfamily protein [Burkholderia phymatum STM815]
          Length = 160

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 55/107 (51%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAICQLDNQRVVTKFMSEINFVSSARQGDIIELGM 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
                G TS+T+  +V    RN  +     T E  +V V +DE GNP
Sbjct: 71  TATHFGTTSITLRAEV----RNKITRKSILTVE-KMVFVNLDENGNP 112


>gi|227536062|ref|ZP_03966111.1| possible acyl-CoA thioester hydrolase [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|227243959|gb|EEI93974.1| possible acyl-CoA thioester hydrolase [Sphingobacterium
           spiritivorum ATCC 33300]
          Length = 175

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N   N+ GG ++  +DI   + A +     VVT +V  + F++ I++ +++ I  
Sbjct: 18  LPNDTNTFNNLMGGRLLYWMDICSAMAAQKHANSPVVTVSVDNVSFKRSIKLGEVLTIEA 77

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           Q+ +   TS+ +  +V+   +N       K+ EA    VAVDE   P+ I
Sbjct: 78  QVTRAFNTSLEVRMEVFA--QNLPLGTKVKSNEAYYTFVAVDENTQPQPI 125


>gi|221065840|ref|ZP_03541945.1| thioesterase superfamily protein [Comamonas testosteroni KF-1]
 gi|220710863|gb|EED66231.1| thioesterase superfamily protein [Comamonas testosteroni KF-1]
          Length = 159

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (45%), Gaps = 2/120 (1%)

Query: 30  SGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPI 89
           S  L++ +   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI
Sbjct: 5   SHQLSMTVLMSPDMANFSGNVHGGAILKLLDQVAYACASRYAGRYVVTLSVDQVMFLQPI 64

Query: 90  QVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            V +LV     +   GK+S+ I   V        S V++        MVAVD+   P  +
Sbjct: 65  HVGELVTFLASVNHTGKSSMEIGIKV--IAEEIRSQVVRHVNSCFFTMVAVDDDKKPAPV 122


>gi|167623633|ref|YP_001673927.1| thioesterase superfamily protein [Shewanella halifaxensis HAW-EB4]
 gi|167353655|gb|ABZ76268.1| thioesterase superfamily protein [Shewanella halifaxensis HAW-EB4]
          Length = 140

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P+  N    +FGG  ++ +D    I A++ C+  +VT +   + F KPI    L  I  
Sbjct: 30  FPSITNHHNTLFGGEALAWMDETAFIAATRFCRKTLVTVSSDRIDFNKPIPAGSLAEIIA 89

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++  +G TS+ +  +++    +   D+ +         VAVDE+  P ++
Sbjct: 90  RVIHVGNTSIKVEVNIFV--EDMYQDLREHAIRGVFTFVAVDEQRKPTAV 137


>gi|163846124|ref|YP_001634168.1| thioesterase superfamily protein [Chloroflexus aurantiacus J-10-fl]
 gi|222523861|ref|YP_002568331.1| thioesterase superfamily protein [Chloroflexus sp. Y-400-fl]
 gi|163667413|gb|ABY33779.1| thioesterase superfamily protein [Chloroflexus aurantiacus J-10-fl]
 gi|222447740|gb|ACM52006.1| thioesterase superfamily protein [Chloroflexus sp. Y-400-fl]
          Length = 168

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 58/113 (51%), Gaps = 8/113 (7%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P   N  G +FGG +M+ +D A  I A + C+  VVT +   + F  PI   ++V  ++
Sbjct: 24  LPHQTNGYGTMFGGDVMALMDKAAAIAALRFCRLPVVTASTERIDFRTPIGQGEIVEAFS 83

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVL--QKTC-EATVVMVAVDEKGNPKSI 149
           ++  +G++S+ +   ++     A   ++  ++ C      MVA++ +G P  +
Sbjct: 84  RVIYVGRSSMVVRVHLF-----AEHPLIGDRRLCTTGYFSMVAINREGGPAPV 131


>gi|256829576|ref|YP_003158304.1| thioesterase superfamily protein [Desulfomicrobium baculatum DSM
           4028]
 gi|256578752|gb|ACU89888.1| thioesterase superfamily protein [Desulfomicrobium baculatum DSM
           4028]
          Length = 167

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 44/78 (56%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           + +P D N  GNV GG I+  +D+A  + A +  +  VVT ++  + F+  ++V +L+ +
Sbjct: 18  RALPEDANPAGNVHGGVILKHLDLAGAVCAMRHARMSVVTASIDRMEFKAAVKVGELMLL 77

Query: 98  YTQIRKIGKTSVTIYCDV 115
           +  + + GK S+ I   V
Sbjct: 78  HASVNRAGKQSMEIGVRV 95


>gi|225075865|ref|ZP_03719064.1| hypothetical protein NEIFLAOT_00888 [Neisseria flavescens
           NRL30031/H210]
 gi|224952811|gb|EEG34020.1| hypothetical protein NEIFLAOT_00888 [Neisseria flavescens
           NRL30031/H210]
          Length = 147

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 13/112 (11%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRV-----VTKAVTELLFEKPIQVSDL 94
           MP   N  GNV GG ++  +D     + +  C CR      VT +V ++LF++PI V +L
Sbjct: 6   MPYTANFSGNVHGGDLLRLLD-----QVAYSCACRYSGTYCVTLSVDKVLFKEPIHVGEL 60

Query: 95  VHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           V  Y  I   G+TS+ +   V    +N  +  ++ T      MVAV + G P
Sbjct: 61  VTFYASINYTGRTSMEVGIRVEA--QNIHTGEVRHTNSCYFTMVAVKD-GKP 109


>gi|184201749|ref|YP_001855956.1| hypothetical protein KRH_21030 [Kocuria rhizophila DC2201]
 gi|183581979|dbj|BAG30450.1| hypothetical protein [Kocuria rhizophila DC2201]
          Length = 144

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (49%), Gaps = 8/123 (6%)

Query: 27  MHSSGVLTLKIQTM--PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTEL 83
           M   G ++ + +    P D+N +G +FGG ++  ID    I A  QL   R VTK ++E+
Sbjct: 1   MRQPGDISFRTRKWVKPEDLNANGTLFGGSLLRWIDEEAAIYAIVQLGNRRAVTKYMSEI 60

Query: 84  LFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEK 143
            F       DL+ +     + G+TS+T+   V    RN  +  L  + +  +V V++DE 
Sbjct: 61  EFVSSAVEGDLIEMGLTATRFGRTSLTMRAQV----RNMITRELILSIDK-IVFVSLDEN 115

Query: 144 GNP 146
           G P
Sbjct: 116 GEP 118


>gi|126728176|ref|ZP_01743992.1| putative acyl-CoA thioester hydrolase protein [Sagittula stellata
           E-37]
 gi|126711141|gb|EBA10191.1| putative acyl-CoA thioester hydrolase protein [Sagittula stellata
           E-37]
          Length = 164

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + +   P   N  G V GG +++ +D      AS+  +   VT +V +++F++PI V 
Sbjct: 13  LEMTVLMTPDMANFSGKVHGGALLNLLDRVAFSCASRFSQRYAVTLSVDQVVFKEPINVG 72

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     + + G+TS+ I   V      +       +C  T  MVAVD+ G P  +
Sbjct: 73  ELVTFRASVNQAGRTSMEIGIRVEAQDIRSGRSRHTNSCYFT--MVAVDDDGRPAEV 127


>gi|328880210|emb|CCA53449.1| acyl-CoA hydrolase [Streptomyces venezuelae ATCC 10712]
          Length = 181

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQIR 102
           D NL G + GG +M  ID A    A +      VT +V  + F  P++  DL+ +   + 
Sbjct: 65  DTNLYGTIHGGVMMKLIDDAAAAAAGRHADGPAVTVSVDRMTFLAPVRAGDLLSVEAGLE 124

Query: 103 KIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           + G+TS+T+   V T  R   S    +   A +  VAVD +G+P+ +
Sbjct: 125 RAGRTSMTVGVRV-TAERWNHSGPATEVATAFLTFVAVDAEGSPRPV 170


>gi|226312719|ref|YP_002772613.1| hypothetical protein BBR47_31320 [Brevibacillus brevis NBRC 100599]
 gi|226095667|dbj|BAH44109.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 158

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 55/108 (50%), Gaps = 4/108 (3%)

Query: 40  MPTDVNLDGNVFGGWIMSQID-IACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIY 98
            P D N    +FGG +M+ +D IAC I A + C+  VVT +     F  PI+  + +++ 
Sbjct: 20  FPPDTNHHHTIFGGKVMAYVDKIAC-IAAMRHCRKPVVTASSDSFDFLAPIKTGEAINLE 78

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
             +    KTS+ ++  V     N  +   + T  A + M+A+D++G P
Sbjct: 79  AYVTWTHKTSMEVFVRVEA--ENLLTGEKRMTARAYLTMIALDDQGKP 124


>gi|89890806|ref|ZP_01202315.1| cytosolic long chain acyl-CoA thioester hydrolase [Flavobacteria
           bacterium BBFL7]
 gi|89516951|gb|EAS19609.1| cytosolic long chain acyl-CoA thioester hydrolase [Flavobacteria
           bacterium BBFL7]
          Length = 181

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 58/117 (49%), Gaps = 14/117 (11%)

Query: 35  LKIQTMPTDVNLDGNVFGGWIMS---QIDIACGIRASQLCKCRVVTKAVTELLFEKPIQV 91
           L +  +P+  N  G + GG+++S   QI  AC   AS+      VT +V  + F+ PI+V
Sbjct: 15  LSLLMLPSHANFSGKIHGGYVLSLIDQIAFAC---ASKHSGVYCVTASVDVVDFKAPIEV 71

Query: 92  SDLVHIYTQIRKIGKTS--VTIYCDVWTCPRNASSDVLQKTCEATVV-MVAVDEKGN 145
            ++V +   +  +GK+S  V I  D        S     K C ++ + MVA DE GN
Sbjct: 72  GEMVTLKASVNYVGKSSMVVGIRVDAENIQTGES-----KHCNSSFLTMVAKDEDGN 123


>gi|313207479|ref|YP_004046656.1| thioesterase superfamily protein [Riemerella anatipestifer DSM
           15868]
 gi|312446795|gb|ADQ83150.1| thioesterase superfamily protein [Riemerella anatipestifer DSM
           15868]
 gi|315023379|gb|EFT36389.1| thioesterase superfamily protein [Riemerella anatipestifer RA-YM]
 gi|325335061|gb|ADZ11335.1| Acyl-CoA hydrolase [Riemerella anatipestifer RA-GD]
          Length = 128

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 59/121 (48%), Gaps = 3/121 (2%)

Query: 26  QMHSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLF 85
           ++  S   T K+   P   N    +FGG IM  +D    I A++  +  +VT +  ++ F
Sbjct: 6   RIKQSETHTFKV-VFPDTTNHHNTMFGGTIMKIMDEVAFITATRFSRKTIVTVSCDQIDF 64

Query: 86  EKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
           +KPI    LV +  +++ +G TS+ +  +V+     A++   +K       +VA+DE   
Sbjct: 65  KKPIPADTLVELVGKVKSVGNTSLKVSVEVFIEEMYANT--REKAVFGDFTLVAIDENKK 122

Query: 146 P 146
           P
Sbjct: 123 P 123


>gi|167032084|ref|YP_001667315.1| thioesterase superfamily protein [Pseudomonas putida GB-1]
 gi|166858572|gb|ABY96979.1| thioesterase superfamily protein [Pseudomonas putida GB-1]
          Length = 135

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N    +FGG  ++ +D    I A++ C+  +VT +   + F+ PI    +V +  
Sbjct: 24  FPNTTNHHNTLFGGTALAWMDEVSFIAATRFCRLPLVTVSTDRIDFKHPIPAGSIVELVG 83

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            + K+G TS+ +  DV+    N   D  ++        VA+DE   P
Sbjct: 84  TVIKVGNTSLQVQVDVFV--ENMYLDGRERAIHGVFSFVAIDEDKRP 128


>gi|217973036|ref|YP_002357787.1| thioesterase superfamily protein [Shewanella baltica OS223]
 gi|217498171|gb|ACK46364.1| thioesterase superfamily protein [Shewanella baltica OS223]
          Length = 154

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 53/112 (47%), Gaps = 2/112 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P+  N    +FGG  ++ +D    I A++ C+  +VT +   + F+KPI    L  +  
Sbjct: 43  FPSITNHHNTLFGGEALAWMDETAFIAATRFCRKTLVTVSSDRIDFKKPIPAGTLAELIA 102

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           ++  +G TS+ +  +++    +   D  +         VAVDE+ NP  + T
Sbjct: 103 RVIHVGNTSLKVEVNIYV--EDMYQDHREHAIRGVFTFVAVDEQRNPTQVWT 152


>gi|170723314|ref|YP_001751002.1| thioesterase superfamily protein [Pseudomonas putida W619]
 gi|169761317|gb|ACA74633.1| thioesterase superfamily protein [Pseudomonas putida W619]
          Length = 135

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N    +FGG  ++ +D    I A++ C+  +VT +   + F+ PI    +V +  
Sbjct: 24  FPNTTNHHNTLFGGTALAWMDEVSFIAATRFCRLPLVTVSTDRIDFKHPIPAGSIVELVG 83

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            + K+G TS+ +  DV+    N   D  ++        VA+DE   P
Sbjct: 84  TVIKVGNTSLQVQVDVFV--ENMYLDGRERAIHGVFSFVAIDEDKRP 128


>gi|28872625|ref|NP_795244.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213968506|ref|ZP_03396649.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato T1]
 gi|301384748|ref|ZP_07233166.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato Max13]
 gi|302062454|ref|ZP_07253995.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato K40]
 gi|302133164|ref|ZP_07259154.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28855881|gb|AAO58939.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213926794|gb|EEB60346.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. tomato T1]
 gi|330878154|gb|EGH12303.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
 gi|330964444|gb|EGH64704.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. actinidiae str. M302091]
 gi|331017791|gb|EGH97847.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 161

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGRYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G TS+ +   V T   N     ++ +      MVAVD+   P ++
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHSNSCFFTMVAVDDNRKPAAV 122


>gi|325273830|ref|ZP_08140015.1| thioesterase superfamily protein [Pseudomonas sp. TJI-51]
 gi|324101036|gb|EGB98697.1| thioesterase superfamily protein [Pseudomonas sp. TJI-51]
          Length = 135

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N    +FGG  ++ +D    I A++ C+  +VT +   + F+ PI    +V +  
Sbjct: 24  FPNTTNHHNTLFGGTALAWMDEVSFIAATRFCRLPLVTVSTDRIDFKHPIPAGSIVELVG 83

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            + K+G TS+ +  DV+    N   D  ++        VA+DE   P
Sbjct: 84  TVIKVGNTSLQVQVDVFV--ENMYLDGRERAIHGVFSFVAIDEDKRP 128


>gi|26988199|ref|NP_743624.1| thioesterase superfamily protein [Pseudomonas putida KT2440]
 gi|24982936|gb|AAN67088.1|AE016337_11 long-chain acyl-CoA thioester hydrolase family protein [Pseudomonas
           putida KT2440]
          Length = 135

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N    +FGG  ++ +D    I A++ C+  +VT +   + F+ PI    +V +  
Sbjct: 24  FPNTTNHHNTLFGGTALAWMDEVSFIAATRFCRLPLVTVSTDRIDFKHPIPAGSIVELVG 83

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            + K+G TS+ +  DV+    N   D  ++        VA+DE   P
Sbjct: 84  TVIKVGNTSLQVQVDVFV--ENMYLDGRERAIHGVFSFVAIDEDKRP 128


>gi|121604600|ref|YP_981929.1| thioesterase superfamily protein [Polaromonas naphthalenivorans
           CJ2]
 gi|120593569|gb|ABM37008.1| thioesterase superfamily protein [Polaromonas naphthalenivorans
           CJ2]
          Length = 161

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT+ +   P   N  GNV GG I+  +D      AS+     VVT +V +++F +PI V 
Sbjct: 8   LTMTVLMTPDMANFSGNVHGGTILKFLDQVAYACASRYAGRYVVTLSVDQVMFRQPIYVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +LV     +   G +S+ I   V     N  +  L+        MVAVD++  P ++
Sbjct: 68  ELVTFQASVNYTGTSSMEIGIRVLA--ENIRTQELRHANSCFFTMVAVDDERKPVAV 122


>gi|126174705|ref|YP_001050854.1| thioesterase superfamily protein [Shewanella baltica OS155]
 gi|125997910|gb|ABN61985.1| thioesterase superfamily protein [Shewanella baltica OS155]
          Length = 154

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 53/112 (47%), Gaps = 2/112 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P+  N    +FGG  ++ +D    I A++ C+  +VT +   + F+KPI    L  +  
Sbjct: 43  FPSITNHHNTLFGGEALAWMDETAFIAATRFCRKTLVTVSSDRIDFKKPIPAGTLAELIA 102

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           ++  +G TS+ +  +++    +   D  +         VAVDE+ NP  + T
Sbjct: 103 RVIHVGNTSLKVEVNIYV--EDMYQDHREHAIRGVFTFVAVDEQRNPTQVWT 152


>gi|255975156|ref|ZP_05425742.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis T2]
 gi|256763136|ref|ZP_05503716.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis T3]
 gi|255968028|gb|EET98650.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis T2]
 gi|256684387|gb|EEU24082.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis T3]
          Length = 167

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 53/111 (47%), Gaps = 2/111 (1%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           +  P D+N  G +FGG +MS ID A  I  S+ C+   VT ++  L F KP++ +  V +
Sbjct: 6   RVFPFDLNPFGALFGGKLMSLIDDAASISVSRHCRRGAVTASLDNLNFLKPLKENHSVCV 65

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
            T +  +   S+ ++  V           L  TC  T   VA+    NP+S
Sbjct: 66  ETFVSGVHHKSMEVFVKVVGEDLTTGERYLAATCFTT--FVAIPSHMNPES 114


>gi|153001004|ref|YP_001366685.1| thioesterase superfamily protein [Shewanella baltica OS185]
 gi|160875717|ref|YP_001555033.1| thioesterase superfamily protein [Shewanella baltica OS195]
 gi|304409082|ref|ZP_07390703.1| thioesterase superfamily protein [Shewanella baltica OS183]
 gi|307303085|ref|ZP_07582840.1| thioesterase superfamily protein [Shewanella baltica BA175]
 gi|151365622|gb|ABS08622.1| thioesterase superfamily protein [Shewanella baltica OS185]
 gi|160861239|gb|ABX49773.1| thioesterase superfamily protein [Shewanella baltica OS195]
 gi|304352903|gb|EFM17300.1| thioesterase superfamily protein [Shewanella baltica OS183]
 gi|306913445|gb|EFN43867.1| thioesterase superfamily protein [Shewanella baltica BA175]
 gi|315267906|gb|ADT94759.1| thioesterase superfamily protein [Shewanella baltica OS678]
          Length = 154

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 53/112 (47%), Gaps = 2/112 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P+  N    +FGG  ++ +D    I A++ C+  +VT +   + F+KPI    L  +  
Sbjct: 43  FPSITNHHNTLFGGEALAWMDETAFIAATRFCRKTLVTVSSDRIDFKKPIPAGTLAELIA 102

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRT 151
           ++  +G TS+ +  +++    +   D  +         VAVDE+ NP  + T
Sbjct: 103 RVIHVGNTSLKVEVNIYV--EDMYQDHREHAIRGVFTFVAVDEQRNPTQVWT 152


>gi|325106155|ref|YP_004275809.1| thioesterase superfamily protein [Pedobacter saltans DSM 12145]
 gi|324975003|gb|ADY53987.1| thioesterase superfamily protein [Pedobacter saltans DSM 12145]
          Length = 130

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 6/107 (5%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N  G +FGG ++S ID    I +  QL   R VTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNAHGTLFGGSLLSWIDEEAAIYSIIQLGTNRCVTKYMSEINFINSAKQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +    G+TS+T+ C V    RN  +     T E  +V V+V+E G P
Sbjct: 71  KAVHFGRTSLTLTCQV----RNKITLKTILTIEK-IVFVSVNENGEP 112


>gi|284991276|ref|YP_003409830.1| thioesterase superfamily protein [Geodermatophilus obscurus DSM
           43160]
 gi|284064521|gb|ADB75459.1| thioesterase superfamily protein [Geodermatophilus obscurus DSM
           43160]
          Length = 180

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L + I   P   N  GNV GG ++  +D      A++  K   VT +V +++F +P+ V 
Sbjct: 23  LAMTILMTPDMSNFSGNVHGGTLLKYLDQVAYTCATRYAKTYAVTLSVDQVVFREPVHVG 82

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +LV     + + G+TS+ I   V T   +    V++ T      MVA+   G P
Sbjct: 83  ELVTFQASVNRTGRTSMEIGVRVTT--EDLVRQVVRHTNSCYFTMVALGADGRP 134


>gi|170724291|ref|YP_001751979.1| thioesterase superfamily protein [Pseudomonas putida W619]
 gi|169762294|gb|ACA75610.1| thioesterase superfamily protein [Pseudomonas putida W619]
          Length = 161

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 2/114 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           L++ +   P   N  GNV GG ++  +D      AS+     VVT +V +++F +P+ V 
Sbjct: 8   LSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASRYAGSYVVTLSVDQVIFREPVHVG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           +LV     +   G TS+ +   V T   N     ++ +      MVAVD+   P
Sbjct: 68  ELVTFLASVNYTGNTSMEVGIKVVT--ENIRERSVRHSNSCFFTMVAVDDNRRP 119


>gi|91083235|ref|XP_973760.1| PREDICTED: similar to AGAP003848-PA [Tribolium castaneum]
 gi|270007713|gb|EFA04161.1| hypothetical protein TcasGA2_TC014407 [Tribolium castaneum]
          Length = 426

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 49/91 (53%), Gaps = 3/91 (3%)

Query: 37  IQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVH 96
           I + P + NL   VFGG+IM Q      +   +  K R   K+++++ F KPI V+ L+H
Sbjct: 276 IFSQPENRNLHNTVFGGFIMRQAAELSWVLGFKFSKYRPKVKSISDIKFNKPIAVNSLIH 335

Query: 97  IYTQI--RKIGKTSVTIYCDVWTCPRNASSD 125
           +Y  +   ++    + +Y +V+  P+  ++D
Sbjct: 336 MYAHVVFTQMQFIQIVVYVEVFD-PQTGNTD 365


>gi|332520859|ref|ZP_08397319.1| thioesterase superfamily protein [Lacinutrix algicola 5H-3-7-4]
 gi|332043389|gb|EGI79585.1| thioesterase superfamily protein [Lacinutrix algicola 5H-3-7-4]
          Length = 184

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 53/108 (49%), Gaps = 8/108 (7%)

Query: 40  MPTDVNLDGNVFGGWIMS---QIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVH 96
           +P+  N  G V GG+I+S   QI  AC   AS+  K   VT +V  + F  PI+V +LV 
Sbjct: 19  LPSHSNFSGKVHGGYILSLMDQIAFAC---ASKHSKTYCVTASVDTVDFLNPIEVGELVT 75

Query: 97  IYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           +   +  +G+TS+ +   V     N  +   +    +   MVA DE G
Sbjct: 76  MKASVNYVGRTSMVVGIRVEA--ENIQTGAKKHCNSSYFTMVAKDENG 121


>gi|255972089|ref|ZP_05422675.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis T1]
 gi|255963107|gb|EET95583.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis T1]
          Length = 167

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 53/111 (47%), Gaps = 2/111 (1%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           +  P D+N  G +FGG +MS ID A  I  S+ C+   VT ++  L F KP++ +  V +
Sbjct: 6   RVFPFDLNPFGALFGGKLMSLIDDAASISVSRHCRRGAVTASLDNLNFLKPLKENHSVCV 65

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
            T +  +   S+ ++  V           L  TC  T   VA+    NP+S
Sbjct: 66  ETFVSGVHHKSMEVFVKVVGEDLTTGKRYLAATCFTT--FVAIPSHMNPES 114


>gi|298208841|ref|YP_003717020.1| putative acyl-CoA thioester hydrolase [Croceibacter atlanticus
           HTCC2559]
 gi|83848768|gb|EAP86637.1| putative acyl-CoA thioester hydrolase [Croceibacter atlanticus
           HTCC2559]
          Length = 180

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 55/111 (49%), Gaps = 12/111 (10%)

Query: 40  MPTDVNLDGNVFGGWI---MSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVH 96
           +P+  N  G + GG+I   M Q+   C   AS+      VT +V  + F  PI+V +LV 
Sbjct: 19  LPSHSNFRGKIHGGYILEIMDQVAFTC---ASKYSGAYCVTASVDTVNFRNPIEVGELVT 75

Query: 97  IYTQIRKIGKTSVTIYCDVWTCP-RNASSDVLQKTCEAT-VVMVAVDEKGN 145
           +   I  +G TS+ +   V +   RN S    +K C ++   MVA D+ GN
Sbjct: 76  LKASINYVGNTSMVVGIRVESENIRNGS----KKHCNSSYFTMVAKDDDGN 122


>gi|154251061|ref|YP_001411885.1| thioesterase superfamily protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154155011|gb|ABS62228.1| thioesterase superfamily protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 265

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 2/100 (2%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  G +FGG  ++ +D A  I A++L + ++VT     + F +P+   +L  +  
Sbjct: 26  FPEQTNHHGTLFGGASLALMDRAAYIAATRLTRRKMVTAGFDGVEFGRPVLPGELAEVTA 85

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVA 139
            +RK G++SV    DV     N  +   ++    T+ MVA
Sbjct: 86  TVRKTGRSSVVF--DVELLAENLLTGERERAVGGTIAMVA 123



 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 48/110 (43%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N    +FGG  ++ +  A  I A++ C   VV  A   + F  P++V     +  
Sbjct: 153 FPDAANHRDILFGGNALAMMGKAAFIAATRHCHQTVVMAASERIDFRAPVKVGAFADVTA 212

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +I   G++S+ +  +V      A S   + +     VMVA+   G P ++
Sbjct: 213 RIVMTGRSSICV--EVELVAEEALSGERELSARGRFVMVAIGGNGRPVAV 260


>gi|120598579|ref|YP_963153.1| thioesterase superfamily protein [Shewanella sp. W3-18-1]
 gi|146293342|ref|YP_001183766.1| thioesterase superfamily protein [Shewanella putrefaciens CN-32]
 gi|120558672|gb|ABM24599.1| thioesterase superfamily protein [Shewanella sp. W3-18-1]
 gi|145565032|gb|ABP75967.1| thioesterase superfamily protein [Shewanella putrefaciens CN-32]
 gi|319426642|gb|ADV54716.1| thioesterase superfamily protein [Shewanella putrefaciens 200]
          Length = 143

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 54/113 (47%), Gaps = 2/113 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P+  N    +FGG  ++ +D    I A++ C+  +VT +   + F+KPI    L  +  
Sbjct: 32  FPSITNHHNTLFGGEALAWMDETAFIAATRFCRKALVTVSSDRIDFKKPIPAGTLAELIA 91

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIRTE 152
           ++  +G TS+ +  +++    +   D  +         VAVDE+ NP  + T+
Sbjct: 92  RVIHVGNTSLKVEVNIFV--EDMYHDHREHAIRGVFTFVAVDEQRNPTQVWTK 142


>gi|332968005|gb|EGK07092.1| thioesterase [Desmospora sp. 8437]
          Length = 165

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  G +FGG +++ ID   GI A +     VVT ++  + F  P++  D++ +  
Sbjct: 28  LPPDTNYMGTIFGGKVLAYIDEVAGIAAMRHSGRPVVTASIDSVDFLLPVREGDIMTVEA 87

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGN 145
            +   G+TS+ +Y  V T         L  T  + V MVAV + G 
Sbjct: 88  FVTWTGRTSMEVYTQVTTEKGPGGEPRL--TATSFVTMVAVGDDGK 131


>gi|149916690|ref|ZP_01905192.1| putative acyl-CoA thioester hydrolase [Plesiocystis pacifica SIR-1]
 gi|149822407|gb|EDM81796.1| putative acyl-CoA thioester hydrolase [Plesiocystis pacifica SIR-1]
          Length = 143

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 54/114 (47%), Gaps = 10/114 (8%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  G +FGG  ++ +D A  + AS+ C+  VVT +  +  F  P+    LV +  
Sbjct: 28  FPEQTNHYGTLFGGQALALMDKAAFVVASRYCRRTVVTASSEKTDFWAPVSQGQLVELDA 87

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQK----TCEATVVMVAVDEKGNPKSI 149
            + ++G++S+ +  ++W      + D+L            V+VA+D  G P  +
Sbjct: 88  TVVEVGRSSIRVRVELW------AEDLLSGDRHLATRGDFVLVALDAHGKPTRV 135


>gi|227519839|ref|ZP_03949888.1| acyl-CoA thioester hydrolase [Enterococcus faecalis TX0104]
 gi|227553976|ref|ZP_03984023.1| acyl-CoA thioester hydrolase [Enterococcus faecalis HH22]
 gi|229545136|ref|ZP_04433861.1| acyl-CoA thioester hydrolase [Enterococcus faecalis TX1322]
 gi|293383547|ref|ZP_06629457.1| acyl-CoA thioester hydrolase [Enterococcus faecalis R712]
 gi|293387340|ref|ZP_06631896.1| acyl-CoA thioester hydrolase [Enterococcus faecalis S613]
 gi|294780833|ref|ZP_06746188.1| thioesterase family protein [Enterococcus faecalis PC1.1]
 gi|307270797|ref|ZP_07552087.1| thioesterase family protein [Enterococcus faecalis TX4248]
 gi|307271551|ref|ZP_07552823.1| thioesterase family protein [Enterococcus faecalis TX0855]
 gi|307277122|ref|ZP_07558226.1| thioesterase family protein [Enterococcus faecalis TX2134]
 gi|307285774|ref|ZP_07565908.1| thioesterase family protein [Enterococcus faecalis TX0860]
 gi|307287677|ref|ZP_07567720.1| thioesterase family protein [Enterococcus faecalis TX0109]
 gi|312899874|ref|ZP_07759192.1| thioesterase family protein [Enterococcus faecalis TX0470]
 gi|312905167|ref|ZP_07764288.1| thioesterase family protein [Enterococcus faecalis TX0635]
 gi|312906097|ref|ZP_07765109.1| thioesterase family protein [Enterococcus faecalis DAPTO 512]
 gi|312909443|ref|ZP_07768298.1| thioesterase family protein [Enterococcus faecalis DAPTO 516]
 gi|227072729|gb|EEI10692.1| acyl-CoA thioester hydrolase [Enterococcus faecalis TX0104]
 gi|227176879|gb|EEI57851.1| acyl-CoA thioester hydrolase [Enterococcus faecalis HH22]
 gi|229309681|gb|EEN75668.1| acyl-CoA thioester hydrolase [Enterococcus faecalis TX1322]
 gi|291079059|gb|EFE16423.1| acyl-CoA thioester hydrolase [Enterococcus faecalis R712]
 gi|291083238|gb|EFE20201.1| acyl-CoA thioester hydrolase [Enterococcus faecalis S613]
 gi|294452078|gb|EFG20525.1| thioesterase family protein [Enterococcus faecalis PC1.1]
 gi|306501415|gb|EFM70718.1| thioesterase family protein [Enterococcus faecalis TX0109]
 gi|306502535|gb|EFM71802.1| thioesterase family protein [Enterococcus faecalis TX0860]
 gi|306506052|gb|EFM75218.1| thioesterase family protein [Enterococcus faecalis TX2134]
 gi|306511823|gb|EFM80821.1| thioesterase family protein [Enterococcus faecalis TX0855]
 gi|306512911|gb|EFM81553.1| thioesterase family protein [Enterococcus faecalis TX4248]
 gi|310627743|gb|EFQ11026.1| thioesterase family protein [Enterococcus faecalis DAPTO 512]
 gi|310631557|gb|EFQ14840.1| thioesterase family protein [Enterococcus faecalis TX0635]
 gi|311290116|gb|EFQ68672.1| thioesterase family protein [Enterococcus faecalis DAPTO 516]
 gi|311292870|gb|EFQ71426.1| thioesterase family protein [Enterococcus faecalis TX0470]
 gi|315025369|gb|EFT37301.1| thioesterase family protein [Enterococcus faecalis TX2137]
 gi|315032937|gb|EFT44869.1| thioesterase family protein [Enterococcus faecalis TX0017]
 gi|315144864|gb|EFT88880.1| thioesterase family protein [Enterococcus faecalis TX2141]
 gi|315150118|gb|EFT94134.1| thioesterase family protein [Enterococcus faecalis TX0012]
 gi|315155377|gb|EFT99393.1| thioesterase family protein [Enterococcus faecalis TX0043]
 gi|315161640|gb|EFU05657.1| thioesterase family protein [Enterococcus faecalis TX0645]
 gi|315164846|gb|EFU08863.1| thioesterase family protein [Enterococcus faecalis TX1302]
 gi|315166362|gb|EFU10379.1| thioesterase family protein [Enterococcus faecalis TX1341]
 gi|315173708|gb|EFU17725.1| thioesterase family protein [Enterococcus faecalis TX1346]
 gi|315574324|gb|EFU86515.1| thioesterase family protein [Enterococcus faecalis TX0309B]
 gi|315579117|gb|EFU91308.1| thioesterase family protein [Enterococcus faecalis TX0630]
 gi|315580201|gb|EFU92392.1| thioesterase family protein [Enterococcus faecalis TX0309A]
 gi|323481433|gb|ADX80872.1| thioesterase superfamily protein [Enterococcus faecalis 62]
 gi|329572342|gb|EGG53999.1| thioesterase family protein [Enterococcus faecalis TX1467]
          Length = 185

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 53/111 (47%), Gaps = 2/111 (1%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           +  P D+N  G +FGG +MS ID A  I  S+ C+   VT ++  L F KP++ +  V +
Sbjct: 24  RVFPFDLNPFGALFGGKLMSLIDDAASISVSRHCRRGAVTASLDNLNFLKPLKENHSVCV 83

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
            T +  +   S+ ++  V           L  TC  T   VA+    NP+S
Sbjct: 84  ETFVSGVHHKSMEVFVKVVGEDLTTGERYLAATCFTT--FVAIPSHMNPES 132


>gi|58582916|ref|YP_201932.1| acyl-CoA thioester hydrolase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624773|ref|YP_452145.1| acyl-CoA thioester hydrolase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188577755|ref|YP_001914684.1| acyl-CoA thioester hydrolase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|58427510|gb|AAW76547.1| acyl-CoA thioester hydrolase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84368713|dbj|BAE69871.1| acyl-CoA thioester hydrolase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188522207|gb|ACD60152.1| acyl-CoA thioester hydrolase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 163

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 51/112 (45%), Gaps = 2/112 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT +    P+DVN  G V GG +M  ID      AS       VT AV  + F  P+++ 
Sbjct: 8   LTFRFLAEPSDVNFGGKVHGGVVMKWIDQVGFAAASGWSGHYCVTVAVGGIRFVAPVRIG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           DLV +  ++   G++S+ +  DV           L   C   +V VA+D  G
Sbjct: 68  DLVAVSAKLVYTGRSSMHLAIDVRARSPMGGDSRLCTHC--IIVFVAMDPDG 117


>gi|298242333|ref|ZP_06966140.1| thioesterase superfamily protein [Ktedonobacter racemifer DSM
           44963]
 gi|297555387|gb|EFH89251.1| thioesterase superfamily protein [Ktedonobacter racemifer DSM
           44963]
          Length = 181

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 54/108 (50%), Gaps = 3/108 (2%)

Query: 43  DVNLDGNVFGGWIMSQIDIACGIRASQLC-KCRVVTKAVTELLFEKPIQVSDLVHIYTQI 101
           D N  GNV GG IM  +D A  + A + C +  VVT  V    F  P  + D+V ++ ++
Sbjct: 40  DANSQGNVHGGVIMRMVDEAAAVVAIKHCHRPYVVTARVERFDFLAPAFIGDVVTVHCEL 99

Query: 102 RKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
              G+TS+ +  +V     +  +  ++K   + V+ VA+DE   P  I
Sbjct: 100 HYAGRTSMDVGVEVTA--EDLITREVRKIASSNVIYVALDENRKPTPI 145


>gi|320449521|ref|YP_004201617.1| acyl-CoA thioesterase [Thermus scotoductus SA-01]
 gi|320149690|gb|ADW21068.1| acyl-CoA thioesterase [Thermus scotoductus SA-01]
          Length = 119

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N  G  FGG+++  +D      A++  +  VVT AV+ + F+ PI+  DL+ +  
Sbjct: 10  FPEHTNPLGAAFGGFVLGLMDKVGSYAAARRARKPVVTVAVSSVEFKVPIRTGDLLEVVA 69

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++ ++G+TS+T+  +V+   R    D      +  +  VAV+EKG P
Sbjct: 70  RVVRVGRTSLTVEVEVYKE-RFGQEDGRVLATKGVLTYVAVNEKGQP 115


>gi|299536023|ref|ZP_07049341.1| YkhA [Lysinibacillus fusiformis ZC1]
 gi|298728522|gb|EFI69079.1| YkhA [Lysinibacillus fusiformis ZC1]
          Length = 182

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 2/109 (1%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           +  P DVN    +FGG +MS ID    I A++  +   VT +   + F  PI+ +D V+ 
Sbjct: 18  RVFPNDVNNHNTLFGGRLMSDIDQVASISAAKHSRRDCVTASTDSVDFLHPIRPTDSVYF 77

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
            + +   G++S+ ++  V     N  +   +    A +  VA+DE   P
Sbjct: 78  ESYVTWTGRSSMEVFVKV--ISENLKTGERKVAATALLTFVALDENNKP 124


>gi|21232024|ref|NP_637941.1| acyl-CoA thioester hydrolase [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|21113762|gb|AAM41865.1| acyl-CoA thioester hydrolase [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
          Length = 163

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 50/112 (44%), Gaps = 2/112 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT +    P+DVN  G V GG +M  ID      AS       VT AV  + F  P+++ 
Sbjct: 8   LTFRFLAEPSDVNFGGKVHGGVVMKWIDQVGFAAASGWSGHYCVTVAVGGIRFVAPVRIG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           DLV +  ++   G++S+    DV           L   C   +V VA+D  G
Sbjct: 68  DLVAVSAKLVYTGRSSMHFAIDVRARSPMGGDSRLCTHC--IIVFVAMDPDG 117


>gi|170292135|pdb|2EIS|A Chain A, X-Ray Structure Of Acyl-Coa Hydrolase-Like Protein,
           Tt1379, From Thermus Thermophilus Hb8
 gi|170292136|pdb|2EIS|B Chain B, X-Ray Structure Of Acyl-Coa Hydrolase-Like Protein,
           Tt1379, From Thermus Thermophilus Hb8
          Length = 133

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P + N  G +FGG +++  D A  + A++  + +VVT     + F++P+ +  +V +  
Sbjct: 11  FPGETNHYGTLFGGTVLAWXDQAAFVAATRHARKKVVTVHADAVDFKRPVPLGAIVELVA 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           +++++G+TS  +  + W  P     +          V+VAVDE+G P  +
Sbjct: 71  RLKEVGRTSXRVEVEXWVEPVKEGEEAYL-AARGGFVLVAVDERGRPSPV 119


>gi|229549384|ref|ZP_04438109.1| acyl-CoA thioester hydrolase [Enterococcus faecalis ATCC 29200]
 gi|312953525|ref|ZP_07772363.1| thioesterase family protein [Enterococcus faecalis TX0102]
 gi|229305621|gb|EEN71617.1| acyl-CoA thioester hydrolase [Enterococcus faecalis ATCC 29200]
 gi|310628537|gb|EFQ11820.1| thioesterase family protein [Enterococcus faecalis TX0102]
 gi|315035759|gb|EFT47691.1| thioesterase family protein [Enterococcus faecalis TX0027]
 gi|315146720|gb|EFT90736.1| thioesterase family protein [Enterococcus faecalis TX4244]
 gi|315152015|gb|EFT96031.1| thioesterase family protein [Enterococcus faecalis TX0031]
 gi|315159047|gb|EFU03064.1| thioesterase family protein [Enterococcus faecalis TX0312]
 gi|327535728|gb|AEA94562.1| acyl-CoA thioester hydrolase [Enterococcus faecalis OG1RF]
          Length = 185

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 53/111 (47%), Gaps = 2/111 (1%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           +  P D+N  G +FGG +MS ID A  I  S+ C+   VT ++  L F KP++ +  V +
Sbjct: 24  RVFPFDLNPFGALFGGKLMSLIDDAASISVSRHCRRGAVTASLDNLNFLKPLKENHSVCV 83

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
            T +  +   S+ ++  V           L  TC  T   VA+    NP+S
Sbjct: 84  ETFVSGVHHKSMEVFVKVVGEDLTTGKRYLAATCFTT--FVAIPSHMNPES 132


>gi|29376938|ref|NP_816092.1| acyl-CoA thioester hydrolase [Enterococcus faecalis V583]
 gi|256616999|ref|ZP_05473845.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis ATCC 4200]
 gi|256961262|ref|ZP_05565433.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis Merz96]
 gi|256963611|ref|ZP_05567782.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis HIP11704]
 gi|257079675|ref|ZP_05574036.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis JH1]
 gi|257081978|ref|ZP_05576339.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis E1Sol]
 gi|257087474|ref|ZP_05581835.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis D6]
 gi|257090633|ref|ZP_05584994.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis CH188]
 gi|257416681|ref|ZP_05593675.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis AR01/DG]
 gi|257419897|ref|ZP_05596891.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis T11]
 gi|257421915|ref|ZP_05598905.1| acyl-CoA thioester hydrolase [Enterococcus faecalis X98]
 gi|29344403|gb|AAO82162.1| acyl-CoA thioester hydrolase [Enterococcus faecalis V583]
 gi|256596526|gb|EEU15702.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis ATCC 4200]
 gi|256951758|gb|EEU68390.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis Merz96]
 gi|256954107|gb|EEU70739.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis HIP11704]
 gi|256987705|gb|EEU75007.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis JH1]
 gi|256990008|gb|EEU77310.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis E1Sol]
 gi|256995504|gb|EEU82806.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis D6]
 gi|256999445|gb|EEU85965.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis CH188]
 gi|257158509|gb|EEU88469.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis ARO1/DG]
 gi|257161725|gb|EEU91685.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis T11]
 gi|257163739|gb|EEU93699.1| acyl-CoA thioester hydrolase [Enterococcus faecalis X98]
 gi|295113491|emb|CBL32128.1| Acyl-CoA hydrolase [Enterococcus sp. 7L76]
          Length = 178

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 53/111 (47%), Gaps = 2/111 (1%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           +  P D+N  G +FGG +MS ID A  I  S+ C+   VT ++  L F KP++ +  V +
Sbjct: 17  RVFPFDLNPFGALFGGKLMSLIDDAASISVSRHCRRGAVTASLDNLNFLKPLKENHSVCV 76

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
            T +  +   S+ ++  V           L  TC  T   VA+    NP+S
Sbjct: 77  ETFVSGVHHKSMEVFVKVVGEDLTTGERYLAATCFTT--FVAIPSHMNPES 125


>gi|312887580|ref|ZP_07747174.1| thioesterase superfamily protein [Mucilaginibacter paludis DSM
           18603]
 gi|311299950|gb|EFQ77025.1| thioesterase superfamily protein [Mucilaginibacter paludis DSM
           18603]
          Length = 130

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 57/109 (52%), Gaps = 10/109 (9%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N  G +FGG ++S ID    I +  QL     VTK ++E+ F    +  D+V +  
Sbjct: 11  PEDLNAHGTLFGGSLLSWIDEEAAIYSIIQLGTNGCVTKYMSEINFINSAKQGDIVELGI 70

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEA--TVVMVAVDEKGNP 146
           +    G+TS+T+ C+V    RN    + QKT      +V V+VDE G P
Sbjct: 71  KAVSFGRTSLTLTCEV----RNK---ITQKTILTIDKIVFVSVDENGVP 112


>gi|253699820|ref|YP_003021009.1| thioesterase superfamily protein [Geobacter sp. M21]
 gi|251774670|gb|ACT17251.1| thioesterase superfamily protein [Geobacter sp. M21]
          Length = 144

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 2/103 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  GN+FGG IMS +D   G+   +  + RVVT     + F  PI V ++V+   
Sbjct: 13  LPKDTNSYGNIFGGVIMSIMDKTAGVVCWRYARKRVVTACAHRIDFHTPINVGEVVYSRA 72

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
            I  +G++S+ +  +      N +    ++       MVAVDE
Sbjct: 73  TIIHVGRSSMEVELE--VEVENVTDGSTRRAASGLFTMVAVDE 113


>gi|298504916|gb|ADI83639.1| long-chain acyl-CoA thioesterase, BFIT_BACH family [Geobacter
           sulfurreducens KN400]
          Length = 157

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  G++FGG IM  +D A  I A +  +  VVT     +   +P++++++V +  
Sbjct: 19  LPQDTNPAGSIFGGVIMGLMDKAAAIAAWRYTRREVVTAGAEHISLLRPVRLAEVVKVEA 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++   G+TS+ +  DV     N  +            MVA+D++G P  +
Sbjct: 79  RVVCTGRTSIDV--DVVVETENVLTGESAVAATGFFTMVALDKEGKPTEV 126


>gi|70733082|ref|YP_262855.1| thioesterase family protein [Pseudomonas fluorescens Pf-5]
 gi|68347381|gb|AAY94987.1| thioesterase family protein domain protein [Pseudomonas fluorescens
           Pf-5]
          Length = 134

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDV 115
              + G+TS+T+ C+V
Sbjct: 71  TATEFGRTSITLTCEV 86


>gi|330812320|ref|YP_004356782.1| thioesterase [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327380428|gb|AEA71778.1| putative thioesterase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 133

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDV 115
              + G+TS+T+ C+V
Sbjct: 71  TATEFGRTSITLTCEV 86


>gi|238022845|ref|ZP_04603271.1| hypothetical protein GCWU000324_02765 [Kingella oralis ATCC 51147]
 gi|237865653|gb|EEP66791.1| hypothetical protein GCWU000324_02765 [Kingella oralis ATCC 51147]
          Length = 151

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 58/113 (51%), Gaps = 11/113 (9%)

Query: 41  PTDVNLDGNVFGGWIMSQID---IACGIRAS-QLCKCRVVTKAVTELLFEKPIQVSDLVH 96
           P   N  GN+ GG ++  +D    AC  R S  +C    VT +V +++F++PI V +LV+
Sbjct: 17  PAMANFSGNLHGGELLKMLDQVAYACASRYSGNMC----VTLSVDQVMFKEPIHVGELVN 72

Query: 97  IYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
            Y  +  +G+TS+ I   V     N  +  ++ T      MVA+ + G P ++
Sbjct: 73  YYASVNLVGRTSMEIGIRVEA--ENIQTRTVRHTNSCYFTMVAMKD-GKPVAV 122


>gi|39995902|ref|NP_951853.1| acyl-CoA thioester hydrolase [Geobacter sulfurreducens PCA]
 gi|39982666|gb|AAR34126.1| acyl-CoA thioester hydrolase, putative [Geobacter sulfurreducens
           PCA]
          Length = 157

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  G++FGG IM  +D A  I A +  +  VVT     +   +P++++++V +  
Sbjct: 19  LPQDTNPAGSIFGGVIMGLMDKAAAIAAWRYTRREVVTAGAEHISLLRPVRLAEVVKVEA 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSI 149
           ++   G+TS+ +  DV     N  +            MVA+D++G P  +
Sbjct: 79  RVVCTGRTSIDV--DVVVETENVLTGESAVAATGFFTMVALDKEGKPTEV 126


>gi|325916933|ref|ZP_08179178.1| acyl-CoA hydrolase [Xanthomonas vesicatoria ATCC 35937]
 gi|325536879|gb|EGD08630.1| acyl-CoA hydrolase [Xanthomonas vesicatoria ATCC 35937]
          Length = 163

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 50/112 (44%), Gaps = 2/112 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT +    P+DVN  G V GG +M  ID      AS       VT AV  + F  P+++ 
Sbjct: 8   LTFRFLAEPSDVNFGGKVHGGVVMKWIDQVGFAAASGWSGHYCVTVAVGGIRFVAPVRIG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           DLV +  ++   G++S+    DV           L   C   +V VA+D  G
Sbjct: 68  DLVAVSAKLVYTGRSSMHFAIDVRARSPMGGDSRLCTHC--IIVFVAMDPDG 117


>gi|294625508|ref|ZP_06704136.1| acyl-CoA thioester hydrolase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294664726|ref|ZP_06730056.1| acyl-CoA thioester hydrolase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292600177|gb|EFF44286.1| acyl-CoA thioester hydrolase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292605504|gb|EFF48825.1| acyl-CoA thioester hydrolase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 163

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 50/112 (44%), Gaps = 2/112 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT +    P+DVN  G V GG +M  ID      AS       VT AV  + F  P+++ 
Sbjct: 8   LTFRFLAEPSDVNFGGKVHGGVVMKWIDQVGFAAASGWSGHYCVTVAVGGIRFVAPVRIG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           DLV +  ++   G++S+    DV           L   C   +V VA+D  G
Sbjct: 68  DLVAVSAKLVYTGRSSMHFAIDVRARSPMGGDSRLCTHC--IIVFVAMDPDG 117


>gi|327405819|ref|YP_004346657.1| thioesterase superfamily protein [Fluviicola taffensis DSM 16823]
 gi|327321327|gb|AEA45819.1| thioesterase superfamily protein [Fluviicola taffensis DSM 16823]
          Length = 129

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N    +FGG  M  +D    I A++  + R+VT +  ++ F+KPI    ++ +  
Sbjct: 19  FPNTTNHYDTLFGGTAMQLMDEVAFIAATRFSRQRMVTVSSDKIDFKKPIPAGTIIELIG 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++  +G TS+ I  +++       S+V +K        VA+DE   P
Sbjct: 79  KVTYLGSTSLKIRVEIFI--EQMYSEVREKAVTGEFTFVAIDENKQP 123


>gi|256956721|ref|ZP_05560892.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis DS5]
 gi|300860715|ref|ZP_07106802.1| thioesterase family protein [Enterococcus faecalis TUSoD Ef11]
 gi|256947217|gb|EEU63849.1| cytosolic long-chain acyl-CoA thioester hydrolase [Enterococcus
           faecalis DS5]
 gi|300849754|gb|EFK77504.1| thioesterase family protein [Enterococcus faecalis TUSoD Ef11]
          Length = 178

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 53/111 (47%), Gaps = 2/111 (1%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           +  P D+N  G +FGG +MS ID A  I  S+ C+   VT ++  L F KP++ +  V +
Sbjct: 17  RVFPFDLNPFGALFGGKLMSLIDDAASISVSRHCRRGAVTASLDNLNFLKPLKENHSVCV 76

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKS 148
            T +  +   S+ ++  V           L  TC  T   VA+    NP+S
Sbjct: 77  ETFVSGVHHKSMEVFVKVVGEDLTTGKRYLAATCFTT--FVAIPSHMNPES 125


>gi|229593092|ref|YP_002875211.1| putative thioesterase [Pseudomonas fluorescens SBW25]
 gi|229364958|emb|CAY53074.1| putative thioesterase [Pseudomonas fluorescens SBW25]
          Length = 134

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDV 115
              + G+TS+T+ C+V
Sbjct: 71  TATEFGRTSITLTCEV 86


>gi|46578576|ref|YP_009384.1| thioesterase family protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603847|ref|YP_968247.1| thioesterase superfamily protein [Desulfovibrio vulgaris DP4]
 gi|46447987|gb|AAS94643.1| thioesterase family protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120564076|gb|ABM29820.1| thioesterase superfamily protein [Desulfovibrio vulgaris DP4]
 gi|311232500|gb|ADP85354.1| thioesterase superfamily protein [Desulfovibrio vulgaris RCH1]
          Length = 173

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           + +P D N  G V GG I+  ID+A  + A + C+  VVT ++  + F  P+ V +L+ +
Sbjct: 16  RPLPQDANPAGYVHGGVILKHIDLAGAVAAMRHCRTPVVTASIDRMDFRAPVNVGELMLL 75

Query: 98  YTQIRKIGKTSVTI 111
              +   G TS+ +
Sbjct: 76  KASVNLTGGTSLEV 89


>gi|325285075|ref|YP_004260865.1| thioesterase superfamily protein [Cellulophaga lytica DSM 7489]
 gi|324320529|gb|ADY27994.1| thioesterase superfamily protein [Cellulophaga lytica DSM 7489]
          Length = 181

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 53/108 (49%), Gaps = 8/108 (7%)

Query: 40  MPTDVNLDGNVFGGWI---MSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVH 96
           +P+  N  G V GG+I   M QI  AC   AS+  +   VT +V  + F  PI+V +LV 
Sbjct: 19  LPSHSNFGGKVHGGYILNLMDQIAFAC---ASKHSRSYCVTASVNRVDFLNPIEVGELVT 75

Query: 97  IYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           +   I   G+TS+ +   V +   N ++ V +    +   MVA D  G
Sbjct: 76  LKASINYTGRTSMVVGVRVES--ENITTGVKKHCNSSYFTMVAKDAHG 121


>gi|311740211|ref|ZP_07714043.1| acyl-CoA hydrolase [Corynebacterium pseudogenitalium ATCC 33035]
 gi|311304766|gb|EFQ80837.1| acyl-CoA hydrolase [Corynebacterium pseudogenitalium ATCC 33035]
          Length = 336

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 47/110 (42%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYTQ 100
           PTDVN  G V GG  M  ID A      +    R V      + F +PI + DL+ +  +
Sbjct: 186 PTDVNWGGKVHGGTAMQWIDEAGAACTMEWSAERTVAVYAGGIRFYRPISIGDLIEVDAR 245

Query: 101 IRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNPKSIR 150
           + +    S+ +   V +       + LQ    ATV  + +D  G P+  R
Sbjct: 246 MMRTDTRSMQMSIHVRSGNPRGGREHLQTAIHATVAYITLDHDGQPQVAR 295



 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 57/121 (47%), Gaps = 6/121 (4%)

Query: 24  VCQMHSSGVLTLKIQTMPTDVNLDG--NVFGGWIMSQIDIACGIRASQLCKCRVVTKAVT 81
           V +   S  LTL+    PTDV + G   + GG ++  ID A    A Q      VT  V 
Sbjct: 7   VAENQKSPALTLRFMASPTDVTMAGATGISGGRVLEWIDKAAYACAVQWSGQYCVTAYVG 66

Query: 82  ELLFEKPIQVSDLVHIYTQIRKIGKTSVTIYCDVWTC-PRNASSDVLQKTCEATVVMVAV 140
            + F +PI    +V + ++I   G++S+ I  +V +  PR     +  + C+  V+ VA 
Sbjct: 67  HIHFTRPIPSGHIVEVRSRIAMTGRSSMHIVNEVLSADPREG---IFTRACDCLVIFVAK 123

Query: 141 D 141
           D
Sbjct: 124 D 124


>gi|312963573|ref|ZP_07778054.1| thioesterase superfamily [Pseudomonas fluorescens WH6]
 gi|311282082|gb|EFQ60682.1| thioesterase superfamily [Pseudomonas fluorescens WH6]
          Length = 134

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDV 115
              + G+TS+T+ C+V
Sbjct: 71  TATEFGRTSITLTCEV 86


>gi|197119442|ref|YP_002139869.1| long-chain acyl-CoA thioesterase [Geobacter bemidjiensis Bem]
 gi|197088802|gb|ACH40073.1| long-chain acyl-CoA thioesterase, BFIT_BACH family [Geobacter
           bemidjiensis Bem]
          Length = 144

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 2/103 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           +P D N  GN+FGG IMS +D   G+   +  + RVVT     + F  PI V ++V+   
Sbjct: 13  LPKDTNSYGNIFGGVIMSIMDKTAGVVCWRYARKRVVTACAHRIDFHTPINVGEVVYSRA 72

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDE 142
            I  +G++S+ +  +      N +    ++       MVAVDE
Sbjct: 73  TIIHVGRSSMEVELE--VEVENVTDGSTRRAASGLFTMVAVDE 113


>gi|77461500|ref|YP_351007.1| thioesterase superfamily protein [Pseudomonas fluorescens Pf0-1]
 gi|77385503|gb|ABA77016.1| putative thioesterase [Pseudomonas fluorescens Pf0-1]
          Length = 135

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 41  PTDVNLDGNVFGGWIMSQIDIACGIRA-SQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
           P D+N +G +FGG ++  ID    I A  QL   RVVTK ++E+ F    +  D++ +  
Sbjct: 11  PEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYISEINFVSASRQGDIIELGI 70

Query: 100 QIRKIGKTSVTIYCDV 115
              + G+TS+T+ C+V
Sbjct: 71  TATEFGRTSITLTCEV 86


>gi|313637145|gb|EFS02683.1| cytosolic long-chain acyl-CoA thioester hydrolase family protein
           [Listeria seeligeri FSL S4-171]
          Length = 168

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 53/107 (49%), Gaps = 2/107 (1%)

Query: 38  QTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHI 97
           +  P+D N    +FGG +M+ ID    I AS+ C+  +VT +   + F KPI+    V +
Sbjct: 15  RVFPSDTNNHNTLFGGRLMTYIDDTASISASRHCRTEIVTASTDSVDFLKPIKNDHSVCL 74

Query: 98  YTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
            + +   G++S+ I+  +           L  T  + +  VA+D++G
Sbjct: 75  ESYVASTGRSSMEIFVKIIAENLKTGERYLAAT--SFLTFVALDKEG 119


>gi|291547843|emb|CBL20951.1| Acyl-CoA hydrolase [Ruminococcus sp. SR1/5]
          Length = 148

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (49%), Gaps = 6/109 (5%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKC-RVVTKAVTELLFEKPIQVSDLVHIY 98
           M   +N  G +FGG +M  +D   G+ A +  +  RVVT AV  L F+  I   ++V + 
Sbjct: 9   MQQHLNGGGRLFGGALMQWLDEVAGVVAMRHAETYRVVTAAVDNLQFKHAIYEGEIVVLK 68

Query: 99  TQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTC-EATVVMVAVDEKGNP 146
             +  +G+TS+ +  D +        D ++ T   A  VMVAVDE   P
Sbjct: 69  GYVTYVGRTSMEVEIDTYV----EQPDGMRHTVNRAFFVMVAVDEDQKP 113


>gi|300776766|ref|ZP_07086624.1| long-chain acyl-CoA thioester hydrolase [Chryseobacterium gleum
           ATCC 35910]
 gi|300502276|gb|EFK33416.1| long-chain acyl-CoA thioester hydrolase [Chryseobacterium gleum
           ATCC 35910]
          Length = 127

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 2/107 (1%)

Query: 40  MPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVSDLVHIYT 99
            P   N    +FGG  M  +D    I A++  + RVVT +  ++ F+KPI    +V +  
Sbjct: 19  FPNTTNHYDTLFGGTAMQLMDEVAFITATRFARKRVVTVSSDKIDFKKPIPAGTIVELIG 78

Query: 100 QIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKGNP 146
           ++  +GKTS+ +  +++T      S   +K        VA+DE   P
Sbjct: 79  KVSYVGKTSMKVNVEIYT--EQMYSYEREKAIVGDFTFVAIDEFKKP 123


>gi|289663213|ref|ZP_06484794.1| acyl-CoA thioester hydrolase [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289668292|ref|ZP_06489367.1| acyl-CoA thioester hydrolase [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 163

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 50/112 (44%), Gaps = 2/112 (1%)

Query: 33  LTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEKPIQVS 92
           LT +    P+DVN  G V GG +M  ID      AS       VT AV  + F  P+++ 
Sbjct: 8   LTFRFLAEPSDVNFGGKVHGGVVMKWIDQVGFAAASGWSGHYCVTVAVGGIRFVAPVRIG 67

Query: 93  DLVHIYTQIRKIGKTSVTIYCDVWTCPRNASSDVLQKTCEATVVMVAVDEKG 144
           DLV +  ++   G++S+    DV           L   C   +V VA+D  G
Sbjct: 68  DLVAVSAKLVYTGRSSMHFAIDVRARSPMGGDSRLCTHC--IIVFVAMDPDG 117


>gi|21243483|ref|NP_643065.1| acyl-CoA thioester hydrolase [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109042|gb|AAM37601.1| acyl-CoA thioester hydrolase [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 163

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 50/112 (44%), Gaps = 2/112 (1%)

Query: 33  LTLKIQTMPTDVNLDGNV