PSIBLAST alignment of GI: 254780992 and protein with PDB id: 3bjk

>gi|168988889|pdb|3BJK|A Chain A, Crystal Structure Of Hi0827, A Hexameric Broad Specificity Acyl-Coenzyme A Thioesterase: The Asp44ala Mutant Enzyme Length = 153
>gi|168988890|pdb|3BJK|B Chain B, Crystal Structure Of Hi0827, A Hexameric Broad Specificity Acyl-Coenzyme A Thioesterase: The Asp44ala Mutant Enzyme Length = 153
 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 49/126 (38%), Positives = 69/126 (54%), Gaps = 1/126 (0%)

Query: 28  HSSGVLTLKIQTMPTDVNLDGNVFGGWIMSQIDIACGIRASQLCKCRVVTKAVTELLFEK 87
            S GVL L+   MP+D N +G++FGGWIMSQ+ +   I A ++   RVVT AV  + F K
Sbjct: 11  QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIK 70

Query: 88  PIQVSDLVHIYTQIRKIGKTSVTIYCDVWTCPR-NASSDVLQKTCEATVVMVAVDEKGNP 146
           PI V D+V  Y Q  K+G++S+ I  +VW     +          +A    VAVD  G  
Sbjct: 71  PISVGDVVCCYGQCLKVGRSSIKIKVEVWVKKVASEPIGERYCVTDAVFTFVAVDNNGRS 130

Query: 147 KSIRTE 152
           ++I  E
Sbjct: 131 RTIPRE 136