Query gi|254780996|ref|YP_003065409.1| hypothetical protein CLIBASIA_04485 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 109 No_of_seqs 3 out of 5 Neff 1.6 Searched_HMMs 39220 Date Mon May 30 03:10:00 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780996.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 KOG2756 consensus 76.0 2.6 6.6E-05 23.6 2.8 72 27-104 146-218 (349) 2 KOG3147 consensus 65.4 2.2 5.6E-05 24.0 0.5 25 3-37 69-93 (252) 3 TIGR02491 NrdG anaerobic ribon 64.1 2.7 7E-05 23.5 0.8 45 6-63 18-62 (158) 4 COG3839 MalK ABC-type sugar tr 53.3 3.4 8.6E-05 22.9 -0.2 50 10-65 37-86 (338) 5 cd03261 ABC_Org_Solvent_Resist 50.6 2.2 5.7E-05 24.0 -1.5 53 10-62 34-86 (235) 6 COG1117 PstB ABC-type phosphat 50.1 2.7 7E-05 23.5 -1.1 59 7-66 38-101 (253) 7 cd03288 ABCC_SUR2 The SUR doma 44.8 3.5 8.8E-05 22.9 -1.3 57 9-68 54-110 (257) 8 smart00128 IPPc Inositol polyp 41.0 36 0.00092 16.9 5.1 56 43-101 91-149 (310) 9 COG3842 PotA ABC-type spermidi 40.4 9.4 0.00024 20.3 0.4 49 11-65 40-88 (352) 10 PRK10070 glycine betaine trans 40.0 4.4 0.00011 22.3 -1.4 32 10-41 62-93 (400) 11 cd03255 ABC_MJ0796_Lo1CDE_FtsE 38.2 4 0.0001 22.5 -1.8 55 10-64 38-93 (218) 12 cd03229 ABC_Class3 This class 38.1 8.8 0.00022 20.5 -0.1 54 10-64 34-87 (178) 13 cd03290 ABCC_SUR1_N The SUR do 37.9 6.1 0.00016 21.4 -0.9 59 10-68 35-94 (218) 14 PRK11176 lipid transporter ATP 37.2 13 0.00032 19.6 0.6 64 10-76 376-439 (581) 15 cd03294 ABC_Pro_Gly_Bertaine T 37.0 4.4 0.00011 22.3 -1.8 52 10-61 58-110 (269) 16 cd03257 ABC_NikE_OppD_transpor 34.7 5.8 0.00015 21.5 -1.4 54 10-63 39-92 (228) 17 cd03297 ABC_ModC_molybdenum_tr 34.6 12 0.00031 19.7 0.2 53 10-62 31-84 (214) 18 PRK11308 dppF dipeptide transp 33.5 3.7 9.5E-05 22.7 -2.6 54 10-63 49-102 (327) 19 cd03244 ABCC_MRP_domain2 Domai 33.2 7.8 0.0002 20.8 -1.0 56 10-68 38-93 (221) 20 cd03262 ABC_HisP_GlnQ_permease 32.9 7.1 0.00018 21.1 -1.2 56 10-66 34-89 (213) 21 cd03256 ABC_PhnC_transporter A 32.8 6.4 0.00016 21.3 -1.5 56 10-65 35-90 (241) 22 PRK08457 motB flagellar motor 32.3 33 0.00083 17.1 2.1 25 63-90 207-231 (251) 23 COG1124 DppF ABC-type dipeptid 32.2 19 0.00049 18.5 0.9 57 10-68 41-97 (252) 24 PRK10790 putative multidrug tr 31.9 17 0.00043 18.9 0.5 64 10-76 375-438 (593) 25 cd03228 ABCC_MRP_Like The MRP 31.0 9.9 0.00025 20.2 -0.7 56 10-68 36-91 (171) 26 cd03251 ABCC_MsbA MsbA is an e 30.4 8.5 0.00022 20.6 -1.2 57 10-69 36-92 (234) 27 PRK10789 putative multidrug tr 30.2 16 0.00041 18.9 0.2 66 10-78 349-414 (569) 28 COG4988 CydD ABC-type transpor 30.1 13 0.00034 19.4 -0.2 67 9-78 354-420 (559) 29 PRK11121 nrdG anaerobic ribonu 30.0 25 0.00063 17.8 1.2 35 2-41 15-49 (154) 30 cd03246 ABCC_Protease_Secretio 29.6 10 0.00026 20.1 -0.9 56 10-68 36-91 (173) 31 PRK10908 cell division protein 29.6 7.9 0.0002 20.8 -1.4 58 10-67 36-93 (222) 32 TIGR01187 potA polyamine ABC t 28.7 29 0.00074 17.5 1.3 49 11-65 5-53 (331) 33 cd03258 ABC_MetN_methionine_tr 28.1 7.5 0.00019 20.9 -1.8 57 10-66 39-95 (233) 34 cd03260 ABC_PstB_phosphate_tra 27.8 13 0.00033 19.5 -0.6 56 10-66 34-94 (227) 35 cd03254 ABCC_Glucan_exporter_l 27.5 11 0.00027 20.0 -1.1 56 10-68 37-92 (229) 36 PRK11432 fbpC ferric transport 27.1 12 0.00031 19.7 -0.8 12 48-59 275-286 (351) 37 PRK09493 glnQ glutamine ABC tr 27.0 12 0.00031 19.7 -0.9 56 10-66 35-90 (240) 38 PRK10261 glutathione transport 26.3 12 0.00029 19.8 -1.1 28 11-38 359-386 (623) 39 PRK11831 putative ABC transpor 26.1 10 0.00026 20.1 -1.4 56 10-65 42-97 (269) 40 COG1125 OpuBA ABC-type proline 25.8 22 0.00057 18.1 0.3 60 3-65 26-87 (309) 41 PRK10419 nikE nickel transport 25.7 7.6 0.00019 20.9 -2.1 54 10-63 46-99 (266) 42 cd03299 ABC_ModC_like Archeal 25.5 12 0.0003 19.8 -1.2 51 10-65 33-83 (235) 43 TIGR03265 PhnT2 putative 2-ami 25.3 15 0.00039 19.1 -0.6 11 48-58 272-282 (353) 44 PRK13657 cyclic beta-1,2-gluca 25.2 15 0.00039 19.1 -0.6 66 10-78 369-434 (585) 45 cd03249 ABC_MTABC3_MDL1_MDL2 M 25.0 13 0.00032 19.6 -1.1 57 10-69 37-93 (238) 46 KOG1191 consensus 24.8 58 0.0015 15.7 2.3 25 73-97 298-323 (531) 47 cd03369 ABCC_NFT1 Domain 2 of 24.3 14 0.00035 19.3 -1.0 56 10-68 42-97 (207) 48 cd03219 ABC_Mj1267_LivG_branch 23.4 15 0.00038 19.2 -1.0 54 10-65 34-87 (236) 49 cd03245 ABCC_bacteriocin_expor 23.0 12 0.0003 19.8 -1.6 56 10-68 38-93 (220) 50 cd03259 ABC_Carb_Solutes_like 22.0 25 0.00063 17.9 -0.1 48 10-62 34-81 (213) 51 TIGR03608 L_ocin_972_ABC putat 21.5 12 0.00031 19.6 -1.7 57 10-66 32-89 (206) 52 cd03292 ABC_FtsE_transporter F 21.5 13 0.00034 19.4 -1.5 57 10-66 35-91 (214) 53 cd03248 ABCC_TAP TAP, the Tran 21.3 15 0.00037 19.2 -1.3 56 10-68 48-103 (226) 54 PRK13635 cbiO cobalt transport 20.9 16 0.00041 18.9 -1.2 49 10-61 41-89 (279) 55 TIGR03415 ABC_choXWV_ATP choli 20.7 19 0.00048 18.6 -0.9 26 10-35 58-83 (382) 56 PRK11629 lolD lipoprotein tran 20.7 15 0.00038 19.1 -1.4 57 10-66 43-100 (233) 57 PRK13632 cbiO cobalt transport 20.7 15 0.00039 19.1 -1.4 49 10-61 44-92 (273) 58 pfam03664 Glyco_hydro_62 Glyco 20.4 75 0.0019 15.0 2.1 92 2-99 86-206 (271) 59 cd03296 ABC_CysA_sulfate_impor 20.0 27 0.00069 17.6 -0.2 50 10-64 36-85 (239) No 1 >KOG2756 consensus Probab=75.98 E-value=2.6 Score=23.63 Aligned_cols=72 Identities=19% Similarity=0.213 Sum_probs=49.8 Q ss_pred CCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCCCCCCHHCCCCEEEEE-EEEECCEEEEEEEEEEEEEEE Q ss_conf 852111123577765100012445640001133322478771012300077136899-999789089999874101353 Q gi|254780996|r 27 NFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNRKTVEL-LIEIDDQKVWLLNVHLKSSCV 104 (109) Q Consensus 27 n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~~~~~sraGnRraVEl-L~Eidg~KiWlLdiHLKSfCf 104 (109) ++.||.++|--+-.|+.---+++..-+.-..|-.++--+.. .|.|| |+.-| -++|-|+|+.+++-||.|-|- T Consensus 146 ~~~K~~s~y~i~~~~~~~~~~~~~l~~s~~~Vks~~~i~F~----NS~M~--R~L~I~Ev~v~G~Kl~l~tsHLEStr~ 218 (349) T KOG2756 146 YLKKRSSNYEIITGHEEGYFTAIMLKKSRVKVKSQEIIPFP----NSKMM--RNLLIVEVNVSGNKLCLMTSHLESTRG 218 (349) T ss_pred HHHHHHHHEEEEEECCCEEEEEEEEEHHHCCCCCCCEEECC----CCHHH--HEEEEEEEEECCEEEEEEECCCCCCCC T ss_conf 89876543068995145156522110244285201211057----52121--046799985177069998413357889 No 2 >KOG3147 consensus Probab=65.41 E-value=2.2 Score=24.03 Aligned_cols=25 Identities=28% Similarity=0.470 Sum_probs=22.1 Q ss_pred CCEEEEEECCCCCCCHHHHHHHHCCCCCCCCCCCC Q ss_conf 75289997377887246678752385211112357 Q gi|254780996|r 3 EDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGN 37 (109) Q Consensus 3 ~~~w~ify~~~~~~~~~~s~kr~~n~sk~D~n~~~ 37 (109) --+|.||+ +-+|+.+++.-|+||+. T Consensus 69 w~kW~if~----------~DER~Vp~~~~dSNyg~ 93 (252) T KOG3147 69 WSKWHIFF----------VDERVVPLDDPDSNYGL 93 (252) T ss_pred CCCEEEEE----------EECCCCCCCCCCCCHHH T ss_conf 65507998----------74223677787544799 No 3 >TIGR02491 NrdG anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012837 This enzyme is a member of the radical-SAM protein and utilises S-adenosyl methionine, an iron-sulphur cluster and a reductant (dihydroflavodoxin ) to produce a glycine-centred radical in the class III (anaerobic) ribonucleotide triphosphate reductase (NrdD, IPR009161 from INTERPRO). The two components form an alpha-2/beta-2 heterodimer.; GO: 0043365 [formate-C-acetyltransferase]-activating enzyme activity, 0051539 4 iron 4 sulfur cluster binding, 0005737 cytoplasm. Probab=64.08 E-value=2.7 Score=23.48 Aligned_cols=45 Identities=29% Similarity=0.543 Sum_probs=32.3 Q ss_pred EEEEECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHC Q ss_conf 8999737788724667875238521111235777651000124456400011333224 Q gi|254780996|r 6 WYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSY 63 (109) Q Consensus 6 w~ify~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SY 63 (109) --+|-|||-. .=+||||-++|..|+|---|-+ -++..++-|..++ T Consensus 18 ~slfvaGC~H-----~C~GC~N~~TW~~~~G~~~t~~--------~~~~i~~~l~~~~ 62 (158) T TIGR02491 18 VSLFVAGCKH-----HCEGCFNKETWNFNGGEEFTEE--------LEKEIIRDLNDNP 62 (158) T ss_pred EEEEECCCCC-----CCCCCCCCCCCCCCCCCCCCHH--------HHHHHHHHHCCCC T ss_conf 9986047603-----8888878355576789420368--------8999999851288 No 4 >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Probab=53.27 E-value=3.4 Score=22.93 Aligned_cols=50 Identities=22% Similarity=0.272 Sum_probs=31.3 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCC Q ss_conf 73778872466787523852111123577765100012445640001133322478 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPL 65 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl 65 (109) -|||||...-..+-|+..-++=++..+|-+ ++. ..-.|-.+-..-|||.| T Consensus 37 PSGcGKSTlLr~IAGLe~p~~G~I~i~g~~-----vt~-l~P~~R~iamVFQ~yAL 86 (338) T COG3839 37 PSGCGKSTLLRMIAGLEEPTSGEILIDGRD-----VTD-LPPEKRGIAMVFQNYAL 86 (338) T ss_pred CCCCCHHHHHHHHHCCCCCCCCEEEECCEE-----CCC-CCHHHCCEEEEECCCCC T ss_conf 998888999999968877887159999999-----998-99557888999378301 No 5 >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=50.58 E-value=2.2 Score=23.98 Aligned_cols=53 Identities=19% Similarity=0.166 Sum_probs=39.5 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHH Q ss_conf 73778872466787523852111123577765100012445640001133322 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVS 62 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~S 62 (109) -|||||...--.+-|+...++=.+...|.+-....-.--..+|+...-|.|.. T Consensus 34 ~SGsGKSTll~~i~gL~~p~~G~I~~~g~~i~~~~~~~~~~~r~~ig~vfQ~~ 86 (235) T cd03261 34 PSGSGKSTLLRLIVGLLRPDSGEVLIDGEDISGLSEAELYRLRRRMGMLFQSG 86 (235) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHCCEEEEECCC T ss_conf 99972999999997599989858999999999899889999757829970498 No 6 >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Probab=50.05 E-value=2.7 Score=23.47 Aligned_cols=59 Identities=20% Similarity=0.362 Sum_probs=36.0 Q ss_pred EEEECCCCCCCHHHHHHHHCCCCC-----CCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCC Q ss_conf 999737788724667875238521-----111235777651000124456400011333224787 Q gi|254780996|r 7 YIFYSGCGKNPVWDSMKGCLNFSS-----YDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLP 66 (109) Q Consensus 7 ~ify~~~~~~~~~~s~kr~~n~sk-----~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~ 66 (109) .|=-|||||...--+.-|...--. -.+++.|.|.-+..++ .+.+|+.+--|.|+--|.| T Consensus 38 lIGPSGcGKST~LR~lNRmndl~~~~r~~G~v~~~g~ni~~~~~d-~~~lRr~vGMVFQkPnPFp 101 (253) T COG1117 38 LIGPSGCGKSTLLRCLNRMNDLIPGARVEGEVLLDGKNIYDPKVD-VVELRRRVGMVFQKPNPFP 101 (253) T ss_pred EECCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEECCEECCCCCCC-HHHHHHHHEEECCCCCCCC T ss_conf 888988678889999875411566656878998888243577779-9999877403415899998 No 7 >cd03288 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity. Probab=44.82 E-value=3.5 Score=22.87 Aligned_cols=57 Identities=14% Similarity=0.138 Sum_probs=44.4 Q ss_pred EECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCC Q ss_conf 973778872466787523852111123577765100012445640001133322478771 Q gi|254780996|r 9 FYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAP 68 (109) Q Consensus 9 fy~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~ 68 (109) =.|||||...-..+-|.++.++=.+...|.|...-+.+ .+|+...-|.|.+++..++ T Consensus 54 G~sGsGKSTL~~ll~gl~~p~~G~I~idg~di~~~~~~---~lr~~i~~v~Q~~~lf~~T 110 (257) T cd03288 54 GRTGSGKSSLSLAFFRMVDIFDGKIVIDGIDISKLPLH---TLRSRLSIILQDPILFSGS 110 (257) T ss_pred CCCCCCHHHHHHHHHHCCCCCCCEEEECCEEHHHCCHH---HHHHHEEEEECCCCCCCCH T ss_conf 99998199999999605667888899998996879999---9975057994567343613 No 8 >smart00128 IPPc Inositol polyphosphate phosphatase, catalytic domain homologues. Mg(2+)-dependent/Li(+)-sensitive enzymes. Probab=41.04 E-value=36 Score=16.89 Aligned_cols=56 Identities=14% Similarity=0.222 Sum_probs=40.9 Q ss_pred HCEEEEEEEECCHH---HHHHHHCCCCCCCCCCHHCCCCEEEEEEEEECCEEEEEEEEEEEE Q ss_conf 00012445640001---133322478771012300077136899999789089999874101 Q gi|254780996|r 43 SDINTAIAIRKDVA---RVLQVSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKS 101 (109) Q Consensus 43 ~dihTAIaiRK~~~---rvLQ~SYpl~~~~~~~sraGnRraVElL~Eidg~KiWlLdiHLKS 101 (109) -.|..+|-+|++.. +..+.+.-.. |+...+||.-||-+-+.+.+..+=..+.||.+ T Consensus 91 ~gi~l~Vf~k~~~~~~i~~v~~~~v~~---G~~g~~gnKGaV~vr~~i~~t~~~Fvn~HL~a 149 (310) T smart00128 91 VGILVLVFVKANHLVYIKDVETFTVKT---GMGGLWGNKGAVAVRFKLSDTSFCFVNSHLAA 149 (310) T ss_pred CCEEEEEEECHHHCCCCCCCCCCCCCC---CCCCCCCCCCCEEEEEEECCEEEEEEEECCCC T ss_conf 444999998012256466641011567---87762255751899999978688887623777 No 9 >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Probab=40.36 E-value=9.4 Score=20.33 Aligned_cols=49 Identities=27% Similarity=0.308 Sum_probs=24.7 Q ss_pred CCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCC Q ss_conf 3778872466787523852111123577765100012445640001133322478 Q gi|254780996|r 11 SGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPL 65 (109) Q Consensus 11 ~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl 65 (109) |||||...--.+-|.-.-++-.+..+|-+-.. ....|-.+-..=|||-| T Consensus 40 SGcGKTTlLR~IAGfe~p~~G~I~l~g~~i~~------lpp~kR~ig~VFQ~YAL 88 (352) T COG3842 40 SGCGKTTLLRMIAGFEQPSSGEILLDGEDITD------VPPEKRPIGMVFQSYAL 88 (352) T ss_pred CCCCHHHHHHHHHCCCCCCCCEEEECCEECCC------CCHHHCCCCEEECCCCC T ss_conf 88888999999967778888659999999888------99422652326067666 No 10 >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Probab=40.01 E-value=4.4 Score=22.29 Aligned_cols=32 Identities=16% Similarity=0.160 Sum_probs=26.0 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCC Q ss_conf 73778872466787523852111123577765 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTD 41 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td 41 (109) -|||||...-..+-|++.-++=.+...|.|.. T Consensus 62 ~SGsGKSTLlr~i~gL~~Pt~G~I~i~G~di~ 93 (400) T PRK10070 62 LSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIA 93 (400) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEECC T ss_conf 99846999999997599989818999999999 No 11 >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane. Probab=38.24 E-value=4 Score=22.51 Aligned_cols=55 Identities=20% Similarity=0.175 Sum_probs=39.0 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEE-CCHHHHHHHHCC Q ss_conf 7377887246678752385211112357776510001244564-000113332247 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIR-KDVARVLQVSYP 64 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiR-K~~~rvLQ~SYp 64 (109) -|||||...-..+-|+++-++-.+.+.|.+..+........+| +...-|.|...+ T Consensus 38 ~sGsGKTTll~~i~Gl~~p~~G~I~~~g~~i~~~~~~~~~~~rr~~Ig~v~Q~~~L 93 (218) T cd03255 38 PSGSGKSTLLNILGGLDRPTSGEVRVDGTDISKLSEKELAAFRRRHIGFVFQSFNL 93 (218) T ss_pred CCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHHCCEEEECCCCCC T ss_conf 99986999999996699999649999999988799899999865047898667521 No 12 >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=38.08 E-value=8.8 Score=20.50 Aligned_cols=54 Identities=19% Similarity=0.127 Sum_probs=36.5 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCC Q ss_conf 7377887246678752385211112357776510001244564000113332247 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYP 64 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYp 64 (109) -|||||...-..+-|+..-++=.+...|-+-++..-+.. ..|+...-|.|...+ T Consensus 34 pSG~GKSTllr~i~Gl~~p~~G~I~~~g~~i~~~~~~~~-~~rr~ig~vFQ~~~L 87 (178) T cd03229 34 PSGSGKSTLLRCIAGLEEPDSGSILIDGEDLTDLEDELP-PLRRRIGMVFQDFAL 87 (178) T ss_pred CCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCCHHH-HHCCCEEEEECCCCC T ss_conf 999839999999985999996399999999988861024-541775999269988 No 13 >cd03290 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity. Probab=37.92 E-value=6.1 Score=21.41 Aligned_cols=59 Identities=22% Similarity=0.242 Sum_probs=36.0 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEE-EECCHHHHHHHHCCCCCC Q ss_conf 73778872466787523852111123577765100012445-640001133322478771 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIA-IRKDVARVLQVSYPLPAP 68 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIa-iRK~~~rvLQ~SYpl~~~ 68 (109) -|||||...-.++-|.+...+-.+...|.+-++......-. -|+...-+-|.+++..++ T Consensus 35 ~sGsGKSTLl~~l~g~~~~~~G~I~~~~~~~~~~~~~~~~~~~r~~i~~v~Q~~~lf~~T 94 (218) T cd03290 35 QVGCGKSSLLLAILGEMQTLEGKVHWSNKNESEPSFEATRSRNRYSVAYAAQKPWLLNAT 94 (218) T ss_pred CCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHCCEEEEEECCCCCCCCC T ss_conf 999809999999855565677649989866686467778887565389981566567889 No 14 >PRK11176 lipid transporter ATP-binding/permease protein; Provisional Probab=37.21 E-value=13 Score=19.57 Aligned_cols=64 Identities=16% Similarity=0.114 Sum_probs=46.4 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCCCCCCHHCC Q ss_conf 7377887246678752385211112357776510001244564000113332247877101230007 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMG 76 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~~~~~sraG 76 (109) -|||||-..-.-+-|..+-++=.+..+|.|-.+-+.. ..|+...-|.|..+...++=.---+.| T Consensus 376 ~SGsGKSTL~~LL~gly~p~~G~I~idg~di~~~~~~---~lr~~i~~V~Q~~~lF~~TI~eNi~~~ 439 (581) T PRK11176 376 RSGSGKSTIANLLTRFYDIDEGEILLDGHDLRDYTLA---SLRNQVALVSQNVHLFNDTVANNIAYA 439 (581) T ss_pred CCCCCHHHHHHHHHHHCCCCCCEEEECCEEHHHCCHH---HHHCCCCCCCCCCEEECCCHHHHHHCC T ss_conf 9998678999999853667887487898851214766---650345560777611077299997226 No 15 >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=37.01 E-value=4.4 Score=22.27 Aligned_cols=52 Identities=17% Similarity=0.196 Sum_probs=32.0 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECC-HHHHHHH Q ss_conf 737788724667875238521111235777651000124456400-0113332 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKD-VARVLQV 61 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~-~~rvLQ~ 61 (109) -|||||...-..+-|+..-++=.+...|-+-....-..-..+|+. ..-|.|. T Consensus 58 ~SGsGKSTLLr~i~GL~~p~~G~I~~~G~~i~~~~~~~l~~~r~~~igmVFQ~ 110 (269) T cd03294 58 LSGSGKSTLLRCINRLIEPTSGKVLIDGQDIAAMSRKELRELRRKKISMVFQS 110 (269) T ss_pred CCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHCCCEEEEEEC T ss_conf 99848999999997599999759999999999999899988525646999615 No 16 >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE). The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF. Probab=34.73 E-value=5.8 Score=21.54 Aligned_cols=54 Identities=22% Similarity=0.117 Sum_probs=36.6 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHC Q ss_conf 737788724667875238521111235777651000124456400011333224 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSY 63 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SY 63 (109) -|||||...-..+-|+++-++=.+.+.|.+.-..+-...-..|+...-|.|..+ T Consensus 39 ~sGsGKSTLl~~i~Gl~~p~~G~I~~~g~~i~~~~~~~~~~~~~~ig~v~Q~~~ 92 (228) T cd03257 39 ESGSGKSTLARAILGLLKPTSGSIIFDGKDLLKLSRRLRKIRRKEIQMVFQDPM 92 (228) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHCCCEEEEECCCH T ss_conf 999869999999972898788669989964677999999972463799932813 No 17 >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=34.58 E-value=12 Score=19.70 Aligned_cols=53 Identities=15% Similarity=0.096 Sum_probs=32.6 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEE-EECCHHHHHHHH Q ss_conf 73778872466787523852111123577765100012445-640001133322 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIA-IRKDVARVLQVS 62 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIa-iRK~~~rvLQ~S 62 (109) -|||||...-..+-|+..-++-.+...|.+.....-.+... .|....-|.|.. T Consensus 31 pSGsGKSTll~~i~GL~~p~sG~I~~~G~~~~~~~~~~~~~~~~r~ig~VfQ~~ 84 (214) T cd03297 31 ASGAGKSTLLRCIAGLEKPDGGTIVLNGTVLFDSRKKINLPPQQRKIGLVFQQY 84 (214) T ss_pred CCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCCCCCCCCCCCCEEEEECCC T ss_conf 997359999999984999996499999999766541246771348758976787 No 18 >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Probab=33.46 E-value=3.7 Score=22.68 Aligned_cols=54 Identities=22% Similarity=0.215 Sum_probs=35.4 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHC Q ss_conf 737788724667875238521111235777651000124456400011333224 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSY 63 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SY 63 (109) -|||||...--++-++.+-++=.+.+.|.|.-+.+-..--.+|++..-|.|..| T Consensus 49 eSGsGKSTL~~~l~gl~~p~~G~I~~~G~dl~~~~~~~~~~~r~~i~~VfQ~p~ 102 (327) T PRK11308 49 ESGCGKSTLARLLTMIETPTGGELYYQGQDLLKADPEAQKLLRRKVQIVFQNPY 102 (327) T ss_pred CCCHHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHCCEEEEEECCH T ss_conf 983199999999956999886379989995577999999997557799986863 No 19 >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate. Probab=33.19 E-value=7.8 Score=20.79 Aligned_cols=56 Identities=14% Similarity=0.185 Sum_probs=39.7 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCC Q ss_conf 73778872466787523852111123577765100012445640001133322478771 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAP 68 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~ 68 (109) -|||||...-..+-|.++-++=.+...|.|..+-+.+ .+|+...-|.|.+++..++ T Consensus 38 ~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~~---~~r~~i~~v~Q~~~lf~~T 93 (221) T cd03244 38 RTGSGKSSLLLALFRLVELSSGSILIDGVDISKIGLH---DLRSRISIIPQDPVLFSGT 93 (221) T ss_pred CCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHH---HHHHHEEEEECCCCCCCCC T ss_conf 9999899999999679718984899999996619999---9974079993035235600 No 20 >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively. Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM Probab=32.90 E-value=7.1 Score=21.05 Aligned_cols=56 Identities=20% Similarity=0.153 Sum_probs=39.0 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCC Q ss_conf 737788724667875238521111235777651000124456400011333224787 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLP 66 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~ 66 (109) -|||||...--.+-++..-++=.+...|.+.....-+. -.+|+...-|.|...+.| T Consensus 34 pSGsGKSTLL~~i~gL~~p~~G~i~i~g~~i~~~~~~~-~~~rr~iG~VFQ~~~L~p 89 (213) T cd03262 34 PSGSGKSTLLRCINLLEEPDSGTIIIDGLKLTDDKKNI-NELRQKVGMVFQQFNLFP 89 (213) T ss_pred CCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCHHHH-HHHHCCCEEEECCCCCCC T ss_conf 99844999999998199998649999999999981569-998678279967987589 No 21 >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=32.76 E-value=6.4 Score=21.30 Aligned_cols=56 Identities=16% Similarity=0.195 Sum_probs=37.4 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCC Q ss_conf 73778872466787523852111123577765100012445640001133322478 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPL 65 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl 65 (109) -|||||...-..+-+++.-++=.+...|.+..+..-..--.+|++..-|.|...+. T Consensus 35 psGsGKSTLl~~i~gl~~p~~G~I~~~g~~i~~~~~~~l~~~R~~ig~vfQ~~~l~ 90 (241) T cd03256 35 PSGAGKSTLLRCLNGLVEPTSGSVLIDGTDINKLKGKALRQLRRQIGMIFQQFNLI 90 (241) T ss_pred CCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHCCCEEECCCCCCC T ss_conf 99833999999997499998559999999989899899999864918980799789 No 22 >PRK08457 motB flagellar motor protein MotB; Reviewed Probab=32.27 E-value=33 Score=17.14 Aligned_cols=25 Identities=28% Similarity=0.506 Sum_probs=16.9 Q ss_pred CCCCCCCCCCHHCCCCEEEEEEEEECCE Q ss_conf 4787710123000771368999997890 Q gi|254780996|r 63 YPLPAPQEITPRMGNRKTVELLIEIDDQ 90 (109) Q Consensus 63 Ypl~~~~~~~sraGnRraVElL~Eidg~ 90 (109) |-|.++. ..|+-||| |||+|..|.. T Consensus 207 ~~Pi~~N--e~ra~NRR-VeI~i~~~~~ 231 (251) T PRK08457 207 NNPIAPN--ENRLKNNR-VEIFFKVDAN 231 (251) T ss_pred CCCCCCC--CCHHHCCC-EEEEEECCCC T ss_conf 8879899--76556395-7999942887 No 23 >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Probab=32.19 E-value=19 Score=18.52 Aligned_cols=57 Identities=25% Similarity=0.146 Sum_probs=41.6 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCC Q ss_conf 73778872466787523852111123577765100012445640001133322478771 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAP 68 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~ 68 (109) -|||||..+--.+-|....+.-++...|....+.. -+.+.++.+--|.|-+|--+.| T Consensus 41 eSGsGKSTL~r~l~Gl~~p~~G~I~~~G~~~~~~~--~~~~~~~~VQmVFQDp~~SLnP 97 (252) T COG1124 41 ESGSGKSTLARLLAGLEKPSSGSILLDGKPLAPKK--RAKAFYRPVQMVFQDPYSSLNP 97 (252) T ss_pred CCCCCHHHHHHHHHCCCCCCCCEEEECCCCCCCCC--CCHHHCCCEEEEECCCCCCCCC T ss_conf 89898889999995656788862898884057665--3033304506995187224684 No 24 >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Probab=31.89 E-value=17 Score=18.86 Aligned_cols=64 Identities=17% Similarity=0.139 Sum_probs=42.9 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCCCCCCHHCC Q ss_conf 7377887246678752385211112357776510001244564000113332247877101230007 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMG 76 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~~~~~sraG 76 (109) -|||||...-..+-|..+-++=.+..+|.|-.+-+. -..|+...-|.|.+|+.-++=.--=+.| T Consensus 375 ~SGsGKSTL~~LL~rly~p~~G~I~idG~di~~i~~---~~lR~~i~~V~Q~~~LF~gTI~eNi~~g 438 (593) T PRK10790 375 HTGSGKSTLASLLMGYYPLTEGEIRLDGRPLSSLSH---SVLRQGVAMVQQDPVVLADTFLANVTLG 438 (593) T ss_pred CCCCCHHHHHHHHHHHCCCCCCCCCCCCEECCCCCH---HHHHHCCCCCCCCCCCCCCCHHHHHHHH T ss_conf 998868999999998556789941659932442468---8886315751666514565299997760 No 25 >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=31.04 E-value=9.9 Score=20.18 Aligned_cols=56 Identities=21% Similarity=0.281 Sum_probs=39.7 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCC Q ss_conf 73778872466787523852111123577765100012445640001133322478771 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAP 68 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~ 68 (109) -|||||...-..+-|.+..++=.+...|.+..+-+.. .+|+...-|.|..++..++ T Consensus 36 ~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~~---~~~~~i~~v~Q~~~lf~~t 91 (171) T cd03228 36 PSGSGKSTLLKLLLRLYDPTSGEILIDGVDLRDLDLE---SLRKNIAYVPQDPFLFSGT 91 (171) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHH---HHHHHEEEECCCCCCCCCC T ss_conf 9998399999999767758974899999998859989---9863189996668437577 No 26 >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=30.37 E-value=8.5 Score=20.57 Aligned_cols=57 Identities=16% Similarity=0.180 Sum_probs=40.7 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCCC Q ss_conf 737788724667875238521111235777651000124456400011333224787710 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQ 69 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~~ 69 (109) -|||||...-..+-|++.-++=.+...|.|..+-+++. +|+...-|.|.+++..++= T Consensus 36 ~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~~~---~r~~i~~v~Q~~~lf~~Ti 92 (234) T cd03251 36 PSGSGKSTLVNLIPRFYDVDSGRILIDGHDVRDYTLAS---LRRQIGLVSQDVFLFNDTV 92 (234) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHH---HHHCEEEECCCCEECCCCH T ss_conf 99982999999996676678868999999966089999---9731799936894716459 No 27 >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Probab=30.21 E-value=16 Score=18.95 Aligned_cols=66 Identities=17% Similarity=0.220 Sum_probs=45.5 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCCCCCCHHCCCC Q ss_conf 737788724667875238521111235777651000124456400011333224787710123000771 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNR 78 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~~~~~sraGnR 78 (109) -|||||...-..+-|...-++=.+..+|.|-.+-+.. ..|+...-|.|..++..++=.--=++|+. T Consensus 349 ~SGsGKSTLl~LL~g~y~p~~G~I~idg~di~~i~~~---~lR~~I~~V~Q~~~LF~~TI~eNI~lg~~ 414 (569) T PRK10789 349 PTGSGKSTLLSLIQRHFDVSEGDIRFHDIPLTKLQLD---SWRSRLAVVSQTPFLFSDTVANNIALGRP 414 (569) T ss_pred CCCCCHHHHHHHHHHHHHCCCCCEEEECEECCCCCHH---HHHHCCCCCCCCCCCCCCCHHHHHHCCCC T ss_conf 9999879999999977642678746501013425768---88631476588750256629999865797 No 28 >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Probab=30.10 E-value=13 Score=19.41 Aligned_cols=67 Identities=21% Similarity=0.204 Sum_probs=46.7 Q ss_pred EECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCCCCCCHHCCCC Q ss_conf 9737788724667875238521111235777651000124456400011333224787710123000771 Q gi|254780996|r 9 FYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNR 78 (109) Q Consensus 9 fy~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~~~~~sraGnR 78 (109) =-|||||...-..+-|..+-..-.+.-.|.+-++- +.-+.||...-|=|++|.+.++-.---++|+. T Consensus 354 G~SGaGKSTLl~lL~G~~~~~~G~I~vng~~l~~l---~~~~~~k~i~~v~Q~p~lf~gTireNi~l~~~ 420 (559) T COG4988 354 GASGAGKSTLLNLLLGFLAPTQGEIRVNGIDLRDL---SPEAWRKQISWVSQNPYLFAGTIRENILLARP 420 (559) T ss_pred CCCCCCHHHHHHHHHCCCCCCCCEEEECCCCCCCC---CHHHHHHHEEEECCCCCCCCCCHHHHHHCCCC T ss_conf 89999789999998475777784488899310006---87788867246279984056418877731687 No 29 >PRK11121 nrdG anaerobic ribonucleotide reductase-activating protein; Provisional Probab=30.02 E-value=25 Score=17.84 Aligned_cols=35 Identities=37% Similarity=0.604 Sum_probs=27.2 Q ss_pred CCCEEEEEECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCC Q ss_conf 8752899973778872466787523852111123577765 Q gi|254780996|r 2 PEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTD 41 (109) Q Consensus 2 p~~~w~ify~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td 41 (109) |--.--||.+||-. .-++|+|-+.||.+.|..-|. T Consensus 15 PG~R~~iw~qGC~~-----~C~GC~Np~tw~~~~G~~~~~ 49 (154) T PRK11121 15 PGTRCTLFVSGCVH-----QCPGCYNKSTWRLNSGHPFTK 49 (154) T ss_pred CCEEEEEEECCCCC-----CCCCCCCHHHCCCCCCEECHH T ss_conf 97799999568877-----797999977858758977619 No 30 >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain. They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substra Probab=29.61 E-value=10 Score=20.14 Aligned_cols=56 Identities=21% Similarity=0.148 Sum_probs=40.6 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCC Q ss_conf 73778872466787523852111123577765100012445640001133322478771 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAP 68 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~ 68 (109) -|||||...-..+-|.++-++=.+...|.+..+-+.. ..|+...-|.|..++..++ T Consensus 36 ~sGsGKSTLl~ll~gl~~p~~G~i~i~g~~~~~~~~~---~~~~~i~~v~Q~~~lf~~t 91 (173) T cd03246 36 PSGSGKSTLARLILGLLRPTSGRVRLDGADISQWDPN---ELGDHVGYLPQDDELFSGS 91 (173) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHH---HHHCCEEEEECCCEECCCC T ss_conf 9998099999999666667999899999993328998---9842089990888367775 No 31 >PRK10908 cell division protein FtsE; Provisional Probab=29.57 E-value=7.9 Score=20.77 Aligned_cols=58 Identities=17% Similarity=0.086 Sum_probs=38.4 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCC Q ss_conf 7377887246678752385211112357776510001244564000113332247877 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPA 67 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~ 67 (109) -|||||...-..+-|...-++=.+.+.|.+..+-.-...-.+|+...-+.|...+.+. T Consensus 36 ~nGsGKSTLl~~i~Gl~~p~~G~i~~~g~~i~~~~~~~~~~~r~~ig~v~Q~~~l~~~ 93 (222) T PRK10908 36 HSGAGKSTLLKLICGIERPSAGKIWFSGHDITRLKNREVPFLRRQIGMIFQDHHLLMD 93 (222) T ss_pred CCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHHCCEEECCCCCCCCC T ss_conf 9980799999999659999862999999998756666779987302477468301689 No 32 >TIGR01187 potA polyamine ABC transporter, ATP-binding protein; InterPro: IPR005893 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family comprises the spermidine/putrescine ABC transporter, ATP binding subunit in bacteria and its equivalents in archaea. This transport system belongs to the larger ATP-Binding Cassette (ABC) transporter superfamily. Polyamines like spermidine and putrescine play a vital role in cell proliferation, differentiation, and ion homeostasis. The concentration of polyamines within the cell are regulated by biosynthesis, degradation and transport (uptake and efflux included).; GO: 0015417 polyamine-transporting ATPase activity, 0015846 polyamine transport, 0016020 membrane. Probab=28.72 E-value=29 Score=17.45 Aligned_cols=49 Identities=24% Similarity=0.321 Sum_probs=31.7 Q ss_pred CCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCC Q ss_conf 3778872466787523852111123577765100012445640001133322478 Q gi|254780996|r 11 SGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPL 65 (109) Q Consensus 11 ~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl 65 (109) |||||..+---+-|...-|+=.+. -|+.|+-. .+-.+-.|-+.=|||-| T Consensus 5 SGcGKTTlLrlLAGf~~pd~G~i~-----ldg~d~~~-vPp~~R~in~vFQsYAL 53 (331) T TIGR01187 5 SGCGKTTLLRLLAGFEQPDSGSIM-----LDGEDVTE-VPPHLRSINMVFQSYAL 53 (331) T ss_pred CCCCHHHHHHHHHCCCCCCCCEEE-----ECCCCCCC-CCCCCCCCCCEEECCCC T ss_conf 887479999998345877755077-----56710121-57220614605735435 No 33 >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport. Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=28.09 E-value=7.5 Score=20.88 Aligned_cols=57 Identities=18% Similarity=0.099 Sum_probs=36.4 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCC Q ss_conf 737788724667875238521111235777651000124456400011333224787 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLP 66 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~ 66 (109) -|||||...--.+-++..-++=.+.+.|.|...-.-..--.+|+...-|.|...+.+ T Consensus 39 ~SGsGKSTllr~i~gL~~p~sG~I~~~g~~i~~~~~~~~~~~Rr~ig~VFQ~~~L~~ 95 (233) T cd03258 39 RSGAGKSTLIRCINGLERPTSGSVLVDGTDLTLLSGKELRKARRRIGMIFQHFNLLS 95 (233) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHCCCCEEECCCCCCC T ss_conf 980589999999967999998089999999897999999998625877943778899 No 34 >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD). Probab=27.77 E-value=13 Score=19.50 Aligned_cols=56 Identities=23% Similarity=0.408 Sum_probs=35.5 Q ss_pred ECCCCCCCHHHHHHHHCCC-----CCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCC Q ss_conf 7377887246678752385-----21111235777651000124456400011333224787 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNF-----SSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLP 66 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~-----sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~ 66 (109) -|||||...--.+-|+++. ++-.+...|.|.-..+.. ...+|+...-|.|...+.+ T Consensus 34 ~SGsGKSTll~~i~gL~~~~~~~p~~G~I~~~g~~i~~~~~~-~~~~R~~ig~VfQ~~~lf~ 94 (227) T cd03260 34 PSGCGKSTLLRLLNRLNDLIPGAPDEGEVLLDGKDIYDLDVD-VLELRRRVGMVFQKPNPFP 94 (227) T ss_pred CCCCCHHHHHHHHHHHHHCCCCCCCCEEEEECCEECCCCCCC-HHHHHHCCEEECCCCCCCC T ss_conf 999819999999974450268998146999999999889958-7889628268764776677 No 35 >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=27.45 E-value=11 Score=20.03 Aligned_cols=56 Identities=16% Similarity=0.178 Sum_probs=39.2 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCC Q ss_conf 73778872466787523852111123577765100012445640001133322478771 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAP 68 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~ 68 (109) -|||||...-..+-|.++.++=.+...|.+...-+. -.+|+...-|.|..++..++ T Consensus 37 ~sGsGKSTLl~ll~gl~~p~~G~I~idg~~i~~~~~---~~~r~~i~~v~Q~~~lf~~T 92 (229) T cd03254 37 PTGAGKTTLINLLMRFYDPQKGQILIDGIDIRDISR---KSLRSMIGVVLQDTFLFSGT 92 (229) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCH---HHHHHCEEEECCCCEECCCC T ss_conf 999809999999966866787389999999541899---99963289990389875745 No 36 >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Probab=27.12 E-value=12 Score=19.67 Aligned_cols=12 Identities=8% Similarity=0.310 Sum_probs=6.7 Q ss_pred EEEEECCHHHHH Q ss_conf 445640001133 Q gi|254780996|r 48 AIAIRKDVARVL 59 (109) Q Consensus 48 AIaiRK~~~rvL 59 (109) .+.||-..+++- T Consensus 275 ~l~iRPe~i~l~ 286 (351) T PRK11432 275 LVGVRPEAITLS 286 (351) T ss_pred EEEECCCCCEEC T ss_conf 999987646865 No 37 >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Probab=27.01 E-value=12 Score=19.67 Aligned_cols=56 Identities=21% Similarity=0.334 Sum_probs=38.9 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCC Q ss_conf 737788724667875238521111235777651000124456400011333224787 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLP 66 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~ 66 (109) -|||||...-..+-|..+-++=.+...|.+......+. -.+|+....+.|...+.+ T Consensus 35 ~nGsGKSTll~~i~Gl~~~~~G~i~~~G~~i~~~~~~~-~~~r~~ig~v~Q~~~l~~ 90 (240) T PRK09493 35 PSGSGKSTLLRCINKLEEITSGDLIVDGLKVNDPKVDE-RLIRQEAGMVFQQFYLFP 90 (240) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHH-HHHHHHCEEECCCCCCCC T ss_conf 99980999999996389999974878999878876658-998752428801122478 No 38 >PRK10261 glutathione transporter ATP-binding protein; Provisional Probab=26.28 E-value=12 Score=19.80 Aligned_cols=28 Identities=14% Similarity=0.043 Sum_probs=12.5 Q ss_pred CCCCCCCHHHHHHHHCCCCCCCCCCCCC Q ss_conf 3778872466787523852111123577 Q gi|254780996|r 11 SGCGKNPVWDSMKGCLNFSSYDDNSGNI 38 (109) Q Consensus 11 ~~~~~~~~~~s~kr~~n~sk~D~n~~~~ 38 (109) |||||...-.++-|+++-++-.+.+.|- T Consensus 359 sGsGKSTl~r~l~gl~~~~~G~I~~~G~ 386 (623) T PRK10261 359 SGSGKSTTGRALLRLVESQGGEIIFNGQ 386 (623) T ss_pred CCCCHHHHHHHHHCCCCCCCCEEEECCE T ss_conf 8766899999985664667867999999 No 39 >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Probab=26.09 E-value=10 Score=20.14 Aligned_cols=56 Identities=14% Similarity=0.105 Sum_probs=38.2 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCC Q ss_conf 73778872466787523852111123577765100012445640001133322478 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPL 65 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl 65 (109) -|||||...-..+-|.+.-++=.+.+.|.|.....-+....+|++...+.|...+. T Consensus 42 pnGsGKSTLlk~i~Gl~~p~~G~I~~~G~~i~~~~~~~~~~~r~~i~~v~Q~~~l~ 97 (269) T PRK11831 42 PSGIGKTTLLRLIGGQIAPDHGEILFDGENIPAMSRSRLYTVRKRMSMLFQSGALF 97 (269) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHHCEEEECCCCCCC T ss_conf 99975999999996798889866999998887658878998761468985376326 No 40 >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Probab=25.76 E-value=22 Score=18.12 Aligned_cols=60 Identities=18% Similarity=0.266 Sum_probs=41.7 Q ss_pred CCEEEEE--ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCC Q ss_conf 7528999--73778872466787523852111123577765100012445640001133322478 Q gi|254780996|r 3 EDKWYIF--YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPL 65 (109) Q Consensus 3 ~~~w~if--y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl 65 (109) +...+.| -|||||...-.-+.|++..++-.+.-.|.++-.-| ++..|...--|+|+--+. T Consensus 26 ~gef~vliGpSGsGKTTtLkMINrLiept~G~I~i~g~~i~~~d---~~~LRr~IGYviQqigLF 87 (309) T COG1125 26 EGEFLVLIGPSGSGKTTTLKMINRLIEPTSGEILIDGEDISDLD---PVELRRKIGYVIQQIGLF 87 (309) T ss_pred CCEEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCC---HHHHHHHHHHHHHHCCCC T ss_conf 97289998789975787999996055888853898990446588---899987533542221567 No 41 >PRK10419 nikE nickel transporter ATP-binding protein; Provisional Probab=25.72 E-value=7.6 Score=20.86 Aligned_cols=54 Identities=24% Similarity=0.210 Sum_probs=33.1 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHC Q ss_conf 737788724667875238521111235777651000124456400011333224 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSY 63 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SY 63 (109) -|||||...--.+-|+..-++=.+.+.|.|..+-.-...-.+|+...-|.|-++ T Consensus 46 eSGsGKSTL~r~i~gl~~p~sG~I~~~g~~l~~~~~~~~~~~rr~i~~VfQ~~~ 99 (266) T PRK10419 46 RSGCGKSTLARLLVGLESPSQGNISWRGEPLAKLNRAQRKAFRRDIQMVFQDSI 99 (266) T ss_pred CCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHCCCEEEEECCH T ss_conf 999779999999966999996299889995675899999997547389973913 No 42 >cd03299 ABC_ModC_like Archeal protein closely related to ModC. ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=25.48 E-value=12 Score=19.75 Aligned_cols=51 Identities=20% Similarity=0.193 Sum_probs=35.2 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCC Q ss_conf 73778872466787523852111123577765100012445640001133322478 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPL 65 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl 65 (109) -|||||...--.+-|+..-++=.+...|. ||...-..|+...-|.|...+. T Consensus 33 pSGsGKSTLlr~i~Gl~~p~~G~I~~~G~-----di~~~~~~~r~ig~vfQ~~~Lf 83 (235) T cd03299 33 PTGSGKSVLLETIAGFIKPDSGKILLNGK-----DITNLPPEKRDISYVPQNYALF 83 (235) T ss_pred CCCCHHHHHHHHHHCCCCCCCEEEEECCE-----ECCCCCHHHCCEEEECCCCCCC T ss_conf 99635999999997499999659999999-----9999997678978945798668 No 43 >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transport system, ATP-binding protein component. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely. Probab=25.26 E-value=15 Score=19.07 Aligned_cols=11 Identities=36% Similarity=0.573 Sum_probs=5.4 Q ss_pred EEEEECCHHHH Q ss_conf 44564000113 Q gi|254780996|r 48 AIAIRKDVARV 58 (109) Q Consensus 48 AIaiRK~~~rv 58 (109) .+.||-..+++ T Consensus 272 ~~~IRPe~i~l 282 (353) T TIGR03265 272 RLAVRPEDIRV 282 (353) T ss_pred EEEECCCCEEE T ss_conf 99998201096 No 44 >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Probab=25.17 E-value=15 Score=19.07 Aligned_cols=66 Identities=17% Similarity=0.197 Sum_probs=43.1 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCCCCCCHHCCCC Q ss_conf 737788724667875238521111235777651000124456400011333224787710123000771 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNR 78 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~~~~~sraGnR 78 (109) -|||||...-.-+-|.+.-++=.+..+|.|-.+-+ .-..|+...-|.|.+++.-++=.--=+.|+. T Consensus 369 ~SGsGKSTL~~LL~gly~p~~G~I~idg~di~~i~---~~~lR~~i~~V~Q~~~LF~gTI~eNI~~g~~ 434 (585) T PRK13657 369 PTGAGKSTLINLLHRVFDPQSGRIRIDGTDIRTVT---RASLRRNIGVVFQEAGLFNRSIEDNLRVGRP 434 (585) T ss_pred CCCCCHHHHHHHHHHHCCCCCCCEEECCEECHHCC---HHHHHHHCCEECCCCCCCCHHHHHHHHCCCC T ss_conf 98986999999986015788796758989610168---9999852522166763547659988752799 No 45 >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another. Probab=24.96 E-value=13 Score=19.57 Aligned_cols=57 Identities=19% Similarity=0.243 Sum_probs=38.5 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCCC Q ss_conf 737788724667875238521111235777651000124456400011333224787710 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAPQ 69 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~~ 69 (109) -|||||...-..+-|.+.-++=.+...|.+..+-+.. ..|+...-|.|.++...++- T Consensus 37 ~sGsGKSTLl~ll~gl~~p~~G~I~idg~~i~~~~~~---~~r~~i~~v~Q~~~lf~~Ti 93 (238) T cd03249 37 SSGCGKSTVVSLLERFYDPTSGEILLDGVDIRDLNLR---WLRSQIGLVSQEPVLFDGTI 93 (238) T ss_pred CCCCCHHHHHHHHHHCCCCCCCEEEECCEECCCCCHH---HHHHCEEEECCCCEECCCCH T ss_conf 9999899999998238618851899999992318999---99740699915896727529 No 46 >KOG1191 consensus Probab=24.84 E-value=58 Score=15.67 Aligned_cols=25 Identities=24% Similarity=0.430 Sum_probs=18.2 Q ss_pred HHCC-CCEEEEEEEEECCEEEEEEEE Q ss_conf 0007-713689999978908999987 Q gi|254780996|r 73 PRMG-NRKTVELLIEIDDQKVWLLNV 97 (109) Q Consensus 73 sraG-nRraVElL~Eidg~KiWlLdi 97 (109) |-+| .|-++|-.|+++|.++-|.|- T Consensus 298 pv~GTTRDaiea~v~~~G~~v~L~DT 323 (531) T KOG1191 298 PVPGTTRDAIEAQVTVNGVPVRLSDT 323 (531) T ss_pred CCCCCCHHHHEEEEECCCEEEEEEEC T ss_conf 89996410012276308758999734 No 47 >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1). NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate. Probab=24.34 E-value=14 Score=19.32 Aligned_cols=56 Identities=14% Similarity=0.106 Sum_probs=40.4 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCC Q ss_conf 73778872466787523852111123577765100012445640001133322478771 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAP 68 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~ 68 (109) -|||||...-..+-|.+.-++=.+...|.|..+-+ .-.+|+...-|-|..++..++ T Consensus 42 ~sGsGKSTLl~ll~g~~~p~~G~I~idg~di~~~~---~~~~r~~i~~v~Q~~~lf~~t 97 (207) T cd03369 42 RTGAGKSTLILALFRFLEAEEGKIEIDGIDISTIP---LEDLRSSLTIIPQDPTLFSGT 97 (207) T ss_pred CCCCCHHHHHHHHHHHCCCCCCEEEECCEECCCCC---HHHHHHHCEEEECCCEECCCC T ss_conf 99987999999999872888878999999954079---999995153770356332754 No 48 >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). Probab=23.42 E-value=15 Score=19.15 Aligned_cols=54 Identities=19% Similarity=0.193 Sum_probs=39.5 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCC Q ss_conf 73778872466787523852111123577765100012445640001133322478 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPL 65 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl 65 (109) -+||||...-..+-|.+..++-.+...|.+......+ -+.|++..++.|...+. T Consensus 34 ~nGaGKSTL~~~i~Gl~~p~~G~I~~~G~~i~~~~~~--~~~~~gi~~v~Q~~~l~ 87 (236) T cd03219 34 PNGAGKTTLFNLISGFLRPTSGSVLFDGEDITGLPPH--EIARLGIGRTFQIPRLF 87 (236) T ss_pred CCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHH--HHHHCCCEEEECCCCCC T ss_conf 9997399999999679878831899999966889999--99975976760141026 No 49 >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane. Probab=23.03 E-value=12 Score=19.78 Aligned_cols=56 Identities=18% Similarity=0.151 Sum_probs=41.4 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCC Q ss_conf 73778872466787523852111123577765100012445640001133322478771 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAP 68 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~ 68 (109) -|||||...-..+-|.++-.+-.+...|.+..+-+.+ .+|+...-|.|.+++..++ T Consensus 38 ~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~~~~~~~~---~~r~~i~~v~Q~~~lf~~T 93 (220) T cd03245 38 RVGSGKSTLLKLLAGLYKPTSGSVLLDGTDIRQLDPA---DLRRNIGYVPQDVTLFYGT 93 (220) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEEHHHHCHH---HHHHCEEEECCCCEEECCC T ss_conf 9998599999999672547865899999995772599---9973269991689676675 No 50 >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup. This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=22.01 E-value=25 Score=17.86 Aligned_cols=48 Identities=23% Similarity=0.234 Sum_probs=34.5 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHH Q ss_conf 73778872466787523852111123577765100012445640001133322 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVS 62 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~S 62 (109) -+||||...-..+-|+.+.++=++.+.|.+....+.. |++...+.|.. T Consensus 34 pnGaGKSTl~~~i~Gl~~p~~G~I~~~g~~i~~~~~~-----~r~ig~v~Q~~ 81 (213) T cd03259 34 PSGCGKTTLLRLIAGLERPDSGEILIDGRDVTGVPPE-----RRNIGMVFQDY 81 (213) T ss_pred CCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHH-----HCCEEEEECCC T ss_conf 9997399999999759998970899999998889977-----87869990698 No 51 >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins. Probab=21.51 E-value=12 Score=19.64 Aligned_cols=57 Identities=16% Similarity=0.077 Sum_probs=36.1 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEEC-CHHHHHHHHCCCC Q ss_conf 73778872466787523852111123577765100012445640-0011333224787 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRK-DVARVLQVSYPLP 66 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK-~~~rvLQ~SYpl~ 66 (109) -|||||...--.+-++...++=.+...|-+...-.-.....+|. ..--|.|..++++ T Consensus 32 pSGsGKSTLL~~i~gl~~p~sG~i~~~g~~~~~~~~~~~~~~rr~~iG~VfQ~~~L~~ 89 (206) T TIGR03608 32 ESGSGKSTLLNIIGLLEKPDSGQVYLNGQETPPINSKKASKFRREKLGYLFQNFALIE 89 (206) T ss_pred CCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHHCCEEEECCCCCCCC T ss_conf 9997099999999759998975999999999989988999998658899857987679 No 52 >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane. The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring. Probab=21.49 E-value=13 Score=19.44 Aligned_cols=57 Identities=19% Similarity=0.095 Sum_probs=40.0 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCC Q ss_conf 737788724667875238521111235777651000124456400011333224787 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLP 66 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~ 66 (109) -|||||...---+-++..-++=.+...|.|+.+-.-...-.+|+..--|.|...+.+ T Consensus 35 pSGsGKSTLl~~i~gl~~p~sG~i~i~g~~~~~~~~~~~~~~Rr~iG~VfQ~~~L~~ 91 (214) T cd03292 35 PSGAGKSTLLKLIYKEELPTSGTIRVNGQDVSDLRGRAIPYLRRKIGVVFQDFRLLP 91 (214) T ss_pred CCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHCCEEEEEECCCCCC T ss_conf 999539999999962989886499999999898997789998667499901876479 No 53 >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules. Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes. Probab=21.26 E-value=15 Score=19.18 Aligned_cols=56 Identities=14% Similarity=0.042 Sum_probs=38.8 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCCCCCC Q ss_conf 73778872466787523852111123577765100012445640001133322478771 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLPAP 68 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYpl~~~ 68 (109) .|||||...-..+-|.++-++=.+...|.+..+-+.. ..|+...-|-|..+...++ T Consensus 48 ~sGsGKSTL~~ll~gl~~p~~G~I~idg~~i~~~~~~---~lr~~i~~v~Q~~~lf~~t 103 (226) T cd03248 48 PSGSGKSTVVALLENFYQPQGGQVLLDGKPISQYEHK---YLHSKVSLVGQEPVLFARS 103 (226) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEEHHHCCHH---HHHHCEEEEECCCEECCCC T ss_conf 9998499999999645467887899999993448999---9973269992479576773 No 54 >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=20.94 E-value=16 Score=18.94 Aligned_cols=49 Identities=22% Similarity=0.275 Sum_probs=37.0 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHH Q ss_conf 7377887246678752385211112357776510001244564000113332 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQV 61 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~ 61 (109) -|||||...-..+-|+++-++=.+...|.+..+.... .+|+.+.-|.|. T Consensus 41 ~nGsGKSTL~k~l~Gl~~p~~G~I~i~G~~i~~~~~~---~lr~~ig~VfQ~ 89 (279) T PRK13635 41 HNGSGKSTLAKLLNGLLLPEAGTITVGGMVLSEETVW---DVRKQIGMVFQN 89 (279) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHH---HHHHHEEEEECC T ss_conf 9996599999999728888896499999999857879---997436688218 No 55 >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein. Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines. Probab=20.75 E-value=19 Score=18.56 Aligned_cols=26 Identities=23% Similarity=0.222 Sum_probs=21.4 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCC Q ss_conf 73778872466787523852111123 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNS 35 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~ 35 (109) -|||||...-..+-|+.+-++=.+.. T Consensus 58 pSGsGKSTLLr~i~GL~~pt~G~I~i 83 (382) T TIGR03415 58 LSGSGKSSLLRAVNGLNPVSRGSVLV 83 (382) T ss_pred CCCCHHHHHHHHHHCCCCCCCEEEEE T ss_conf 99734999999997599988529999 No 56 >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Probab=20.71 E-value=15 Score=19.12 Aligned_cols=57 Identities=19% Similarity=0.172 Sum_probs=35.4 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEE-CCHHHHHHHHCCCC Q ss_conf 7377887246678752385211112357776510001244564-00011333224787 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIR-KDVARVLQVSYPLP 66 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiR-K~~~rvLQ~SYpl~ 66 (109) -|||||...-..+-|+..-++-.+.+.|-+..+-....-..+| +...-+.|...+.+ T Consensus 43 ~sGsGKSTLl~~i~Gl~~p~~G~I~~~g~~i~~~~~~~~~~~r~~~ig~v~Q~~~l~~ 100 (233) T PRK11629 43 SSGSGKSTLLHLLGGLDTPTSGDVIFNGQPMSKLSSAAKAELRNQKLGFIYQFHHLLP 100 (233) T ss_pred CCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHHHHHHCCCEEEECCCCCCCC T ss_conf 9994099999999669999863999999998869988999873797899916752377 No 57 >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=20.65 E-value=15 Score=19.07 Aligned_cols=49 Identities=20% Similarity=0.288 Sum_probs=38.0 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHH Q ss_conf 7377887246678752385211112357776510001244564000113332 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQV 61 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~ 61 (109) -|||||...-..+.|++.-++-.+.+.|.+..+..+. .+|+.+.-|.|. T Consensus 44 ~nGsGKSTLlk~l~Gll~p~~G~I~v~G~~i~~~~~~---~~~~~ig~VfQ~ 92 (273) T PRK13632 44 HNGSGKSTISKILTGLLKPQSGEIKIFGITISKENLK---YLRKKIGIIFQN 92 (273) T ss_pred CCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHH---HHHHHEEEEEEC T ss_conf 9998699999999738778887599999999968989---987435699877 No 58 >pfam03664 Glyco_hydro_62 Glycosyl hydrolase family 62. Family of alpha -L-arabinofuranosidase (EC 3.2.1.55). This enzyme hydrolysed aryl alpha-L-arabinofuranosides and cleaves arabinosyl side chains from arabinoxylan and arabinan. Probab=20.37 E-value=75 Score=15.01 Aligned_cols=92 Identities=24% Similarity=0.458 Sum_probs=43.5 Q ss_pred CCCEEEEEECCCCC-----------CCH-HHHHHHHCCCCCCCCCCCCCCC----CHHCEEEEEEEECCHHHHHHHHCCC Q ss_conf 87528999737788-----------724-6678752385211112357776----5100012445640001133322478 Q gi|254780996|r 2 PEDKWYIFYSGCGK-----------NPV-WDSMKGCLNFSSYDDNSGNIDT----DESDINTAIAIRKDVARVLQVSYPL 65 (109) Q Consensus 2 p~~~w~ify~~~~~-----------~~~-~~s~kr~~n~sk~D~n~~~~~t----d~~dihTAIaiRK~~~rvLQ~SYpl 65 (109) |++.||..|.-++. ||- |-+-+-+|.-+.-++..|.+|- |...|+- ---.|+-++-.-+-|+ T Consensus 86 Pk~~W~L~yQwg~~~fsY~Ts~DpsnpngWSapq~lf~g~~~~~~~g~iD~~vI~D~~n~yL--Ffs~DnG~iYRs~~~i 163 (271) T pfam03664 86 PKNIWVLAYQWGPTTFSYRTSSDPTNPNGWSAKQPLFSGKISGSSTGAIDQTVIGDDTNMYL--FFAGDNGKIYRSSMPI 163 (271) T ss_pred CCCEEEEEEECCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCEEE--EECCCCCEEEEECCCH T ss_conf 87589999955898630255899899766677730457853678888602689946983699--9718998088804606 Q ss_pred CCCCCCCHH-CCCCE------EEEEEEE------ECCEEEEEEEEEE Q ss_conf 771012300-07713------6899999------7890899998741 Q gi|254780996|r 66 PAPQEITPR-MGNRK------TVELLIE------IDDQKVWLLNVHL 99 (109) Q Consensus 66 ~~~~~~~sr-aGnRr------aVElL~E------idg~KiWlLdiHL 99 (109) - -||. +|+-- +..-||| |+|+.-+||-|.- T Consensus 164 ~----nFP~~fgs~~~~~~sd~~~nLFEA~~VYkv~G~nqYLmiVEA 206 (271) T pfam03664 164 A----NFPGSFGTQYTIIMSDTTNNLFEAVQVYTVDGQNKYLMIVEA 206 (271) T ss_pred H----HCCCCCCCCEEEEECCCCCCEEEEEEEEEECCCCEEEEEEEE T ss_conf 4----387877983189961783556454467997589748999999 No 59 >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=20.00 E-value=27 Score=17.61 Aligned_cols=50 Identities=22% Similarity=0.102 Sum_probs=34.6 Q ss_pred ECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHCEEEEEEEECCHHHHHHHHCC Q ss_conf 7377887246678752385211112357776510001244564000113332247 Q gi|254780996|r 10 YSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYP 64 (109) Q Consensus 10 y~~~~~~~~~~s~kr~~n~sk~D~n~~~~~td~~dihTAIaiRK~~~rvLQ~SYp 64 (109) -|||||...-..+-|+..-++=.+...|-+ +...-..+++...|.|..-+ T Consensus 36 pSGsGKSTll~~i~Gl~~p~~G~I~~~g~~-----i~~~~~~~r~ig~vfQ~~~L 85 (239) T cd03296 36 PSGSGKTTLLRLIAGLERPDSGTILFGGED-----ATDVPVQERNVGFVFQHYAL 85 (239) T ss_pred CCCCHHHHHHHHHHCCCCCCCEEEEECCEE-----CCCCCHHHCCEEEECCCCCC T ss_conf 999779999999976999986399999999-----99999656776798178210 Done!