RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780996|ref|YP_003065409.1| hypothetical protein CLIBASIA_04485 [Candidatus Liberibacter asiaticus str. psy62] (109 letters) >gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional. Length = 252 Score = 31.1 bits (70), Expect = 0.056 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Query: 11 SGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINT----AIAIRKDVARVLQVSYPLP 66 SGCGK+ V S+ + +G I D++DI ++IR+ V V Q P P Sbjct: 39 SGCGKSTVLRSINRMHDLVPSARVTGKILLDDTDIYDRGVDPVSIRRRVGMVFQKPNPFP 98 Query: 67 A 67 A Sbjct: 99 A 99 >gnl|CDD|168927 PRK07374, dnaE, DNA polymerase III subunit alpha; Validated. Length = 1170 Score = 27.4 bits (61), Expect = 0.80 Identities = 10/17 (58%), Positives = 13/17 (76%) Query: 47 TAIAIRKDVARVLQVSY 63 T+ A+ KDVARVL + Y Sbjct: 445 TSKAVLKDVARVLDIPY 461 >gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional. Length = 251 Score = 27.3 bits (60), Expect = 1.0 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 12/64 (18%) Query: 11 SGCGKNPVWDSMKGCLNFSSYD-DN---SGNIDTDESDINTA----IAIRKDVARVLQVS 62 SGCGK+ + CLN + D +N +G I + +I + + +RK+V V Q Sbjct: 39 SGCGKS----TFLRCLNRMNDDIENIKITGEIKFEGQNIYGSKMDLVELRKEVGMVFQQP 94 Query: 63 YPLP 66 P P Sbjct: 95 TPFP 98 >gnl|CDD|181257 PRK08155, PRK08155, acetolactate synthase catalytic subunit; Validated. Length = 564 Score = 26.6 bits (59), Expect = 1.4 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Query: 38 IDTDESD---INTA-IAIRKDVARVLQVSYPLPAPQEITPRMGNRKTVELL 84 +D D ++ I +AI+ DV VL PL Q PR + V L Sbjct: 308 VDIDRAELGKIKQPHVAIQADVDDVLAQLLPLVEAQ---PRAEWHQLVADL 355 >gnl|CDD|180192 PRK05673, dnaE, DNA polymerase III subunit alpha; Validated. Length = 1135 Score = 26.2 bits (59), Expect = 1.7 Identities = 8/14 (57%), Positives = 9/14 (64%), Gaps = 1/14 (7%) Query: 50 AIRKDVARVLQVSY 63 IR DV RVL + Y Sbjct: 438 VIR-DVGRVLGMPY 450 >gnl|CDD|185341 PRK15444, pduC, propanediol dehydratase large subunit; Provisional. Length = 554 Score = 26.2 bits (58), Expect = 2.1 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 16/69 (23%) Query: 7 YIFYSGCGKNPVWDSMKGCLNFSS--YDD----------NSGNIDTDESDINTAIAIRKD 54 +IF SG P +D+M NF + +DD + G E ++ IA+R Sbjct: 359 FIF-SGYSAVPNYDNMFAGSNFDAEDFDDYNVLQRDLKVDGGLRPVREEEV---IAVRNK 414 Query: 55 VARVLQVSY 63 AR LQ + Sbjct: 415 AARALQAVF 423 >gnl|CDD|181933 PRK09532, PRK09532, DNA polymerase III subunit alpha; Reviewed. Length = 874 Score = 25.9 bits (57), Expect = 2.4 Identities = 10/17 (58%), Positives = 13/17 (76%) Query: 47 TAIAIRKDVARVLQVSY 63 T+ A+ KDVARVL + Y Sbjct: 443 TSKAVLKDVARVLDIPY 459 >gnl|CDD|181373 PRK08308, PRK08308, acyl-CoA synthetase; Validated. Length = 414 Score = 25.8 bits (57), Expect = 2.7 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 11/41 (26%) Query: 49 IAIRKDVARVLQVSYPLP-----------APQEITPRMGNR 78 ++I D+ L + PLP AP+EI +MG++ Sbjct: 251 VSICPDMKSHLDLGNPLPHVSVSAGSDENAPEEIVVKMGDK 291 >gnl|CDD|161981 TIGR00656, asp_kin_monofn, aspartate kinase, monofunctional class. The Lys-sensitive enzyme of Bacillus subtilis resembles the E. coli form but is an alpha 2/beta 2 heterotetramer, where the beta subunit is translated from an in-phase alternative initiator at Met-246. The protein slr0657 from Synechocystis PCC6803 is extended by a duplication of the C-terminal region corresponding to the beta chain. Incorporation of a second copy of the C-terminal domain may be quite common in this subgroup of aspartokinases. Length = 401 Score = 25.4 bits (56), Expect = 3.2 Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Query: 28 FSSYDDNSGNI---DTDESDINTAIAIRKDVARV 58 SS+D G + + + IA+RK+V RV Sbjct: 230 RSSFDPEEGTLITNSMENPPLVKGIALRKNVTRV 263 >gnl|CDD|183453 PRK12338, PRK12338, hypothetical protein; Provisional. Length = 319 Score = 25.1 bits (55), Expect = 3.6 Identities = 11/38 (28%), Positives = 19/38 (50%) Query: 41 DESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNR 78 D+ D I I++ R+ +SYP+P ++ R N Sbjct: 216 DDLDEVIEIIIKRHGGRITDISYPIPGFKDPLKREVNV 253 >gnl|CDD|167581 PRK03670, PRK03670, competence damage-inducible protein A; Provisional. Length = 252 Score = 24.8 bits (54), Expect = 4.7 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Query: 69 QEITPRMGNRKTVE--LLIEIDDQ 90 +E+ PR+G RK V+ L EI D+ Sbjct: 170 KEVLPRLGERKFVQKKFLAEITDE 193 >gnl|CDD|162580 TIGR01884, cas_HTH, CRISPR locus-related DNA-binding protein. Most but not all examples of this family are associated with CRISPR loci, a combination of DNA repeats and characteristic proteins encoded near the repeat cluster. The C-terminal region of this protein is homologous to DNA-binding helix-turn-helix domains with predicted transcriptional regulatory activity. Length = 203 Score = 25.0 bits (55), Expect = 5.0 Identities = 11/51 (21%), Positives = 19/51 (37%), Gaps = 7/51 (13%) Query: 47 TAIAIRKDVARVLQVSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNV 97 AI ++ V RV S L + LL + +++ +L V Sbjct: 108 LAILVKTRVFRVYYESEELIDFILLDLVP-------LLAGLSREELKVLEV 151 >gnl|CDD|150276 pfam09547, Spore_IV_A, Stage IV sporulation protein A (spore_IV_A). SpoIVA is designated stage IV sporulation protein A. It acts in the mother cell compartment and plays a role in spore coat morphogenesis. A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species. Length = 492 Score = 24.5 bits (54), Expect = 6.9 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 7/39 (17%) Query: 70 EITPRMGNRKTVELLI-------EIDDQKVWLLNVHLKS 101 EI+P +G K E L+ E D +K+W N+ KS Sbjct: 410 EISPIIGTEKQSEELVKYLLEEFEEDPEKIWESNIFGKS 448 >gnl|CDD|148956 pfam07632, DUF1593, Protein of unknown function (DUF1593). A family of proteins in Rhodopirellula baltica that are predicted to be secreted. Also, a member has been identified in Caulobacter crescentus. These proteins mat be related to pfam01156. Length = 261 Score = 24.1 bits (53), Expect = 9.0 Identities = 9/36 (25%), Positives = 17/36 (47%) Query: 60 QVSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLL 95 Y +P E G+ +E L++ D + +W+L Sbjct: 85 NPDYGMPFVGEGKDTEGSELIIEALLDDDPRPLWIL 120 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.135 0.417 Gapped Lambda K H 0.267 0.0705 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,759,068 Number of extensions: 95483 Number of successful extensions: 188 Number of sequences better than 10.0: 1 Number of HSP's gapped: 188 Number of HSP's successfully gapped: 24 Length of query: 109 Length of database: 5,994,473 Length adjustment: 75 Effective length of query: 34 Effective length of database: 4,373,873 Effective search space: 148711682 Effective search space used: 148711682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.1 bits)