RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780996|ref|YP_003065409.1| hypothetical protein CLIBASIA_04485 [Candidatus Liberibacter asiaticus str. psy62] (109 letters) >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A (A:) Length = 121 Score = 27.3 bits (60), Expect = 0.72 Identities = 6/15 (40%), Positives = 7/15 (46%) Query: 28 FSSYDDNSGNIDTDE 42 F S SG I D+ Sbjct: 39 FHSLKPISGFITGDQ 53 >1yrz_A Xylan beta-1,4-xylosidase; structural genomics, nysgxrc target T1997, PSI, protein structure initiative; 2.00A {Bacillus halodurans c-125} (A:68-237) Length = 170 Score = 26.3 bits (57), Expect = 1.4 Identities = 2/30 (6%), Positives = 10/30 (33%) Query: 3 EDKWYIFYSGCGKNPVWDSMKGCLNFSSYD 32 + +Y+ Y+ + ++ + Sbjct: 16 DGTFYLIYTDVKQWHGAFKDAHNYLVTAQN 45 >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} (A:1-231) Length = 231 Score = 26.1 bits (57), Expect = 1.6 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Query: 11 SGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ 60 SG GK+ + ++ G Y SG I DE D+ ++V V Q Sbjct: 38 SGSGKSTLLYTIAGI-----YKPTSGKIYFDEKDVTELPPKDRNVGLVFQ 82 >2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} (A:1-66) Length = 66 Score = 25.5 bits (56), Expect = 2.2 Identities = 7/13 (53%), Positives = 11/13 (84%) Query: 32 DDNSGNIDTDESD 44 DD +G++D +ESD Sbjct: 26 DDANGDVDVEESD 38 >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} (A:) Length = 106 Score = 25.3 bits (55), Expect = 2.6 Identities = 4/15 (26%), Positives = 7/15 (46%) Query: 28 FSSYDDNSGNIDTDE 42 F S +G + D+ Sbjct: 21 FDSLSPVNGFLSGDK 35 >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} (A:433-550) Length = 118 Score = 25.4 bits (55), Expect = 2.8 Identities = 2/15 (13%), Positives = 5/15 (33%) Query: 28 FSSYDDNSGNIDTDE 42 F + G + + Sbjct: 32 FYNLAPADGKLSGSK 46 >1vkd_A Conserved hypothetical protein TM1225; structural genomics, JCSG, PSI, protein structure initiative; 2.10A {Thermotoga maritima MSB8} (A:109-283) Length = 175 Score = 25.0 bits (54), Expect = 3.4 Identities = 5/17 (29%), Positives = 7/17 (41%) Query: 3 EDKWYIFYSGCGKNPVW 19 ED +YI + P Sbjct: 17 EDTYYITFCTDDHGPTI 33 >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, papain-like, EF-hand, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} (A:1-158) Length = 158 Score = 24.9 bits (53), Expect = 3.9 Identities = 3/15 (20%), Positives = 5/15 (33%) Query: 28 FSSYDDNSGNIDTDE 42 S +ID + Sbjct: 11 SSGLVPRGSDIDATQ 25 >1vps_A Polyomavirus VP1 pentamer; virus coat protein, oligosaccharide binding, virus assembly, sialic acid, viral protein; HET: SIA GAL NAG; 1.90A {Murine polyomavirus} (A:) Length = 289 Score = 24.8 bits (54), Expect = 4.7 Identities = 11/32 (34%), Positives = 15/32 (46%) Query: 71 ITPRMGNRKTVELLIEIDDQKVWLLNVHLKSS 102 + PRMG T E L E W ++L +S Sbjct: 22 LNPRMGQPPTPESLTEGGQYYGWSRGINLATS 53 >1sid_A Polyomavirus coat protein VP1; icosahedral virus; HET: SIA GAL BGC; 3.65A {Mouse polyomavirus} (A:1-342) Length = 342 Score = 24.8 bits (54), Expect = 4.7 Identities = 11/32 (34%), Positives = 15/32 (46%) Query: 71 ITPRMGNRKTVELLIEIDDQKVWLLNVHLKSS 102 + PRMG T E L E W ++L +S Sbjct: 53 LNPRMGQPPTPESLTEGGQYYGWSRGINLATS 84 >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} (A:1-228) Length = 228 Score = 24.5 bits (53), Expect = 4.8 Identities = 10/50 (20%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Query: 11 SGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ 60 +G GK+ + + G + G + + +DI R+ + V Q Sbjct: 33 TGAGKSVFLELIAGIVKPDR-----GEVRLNGADITPLPPERRGIGFVPQ 77 >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} (A:1-157) Length = 157 Score = 24.7 bits (52), Expect = 5.0 Identities = 2/15 (13%), Positives = 5/15 (33%) Query: 28 FSSYDDNSGNIDTDE 42 F+ + + E Sbjct: 10 FAQLAGDDMEVSATE 24 >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} (A:1-224) Length = 224 Score = 24.4 bits (53), Expect = 5.0 Identities = 14/56 (25%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Query: 11 SGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQVSYPLP 66 +G GK + + G + +SG I D D+ + D+A V Q P Sbjct: 35 TGAGKTLFLELIAGF-----HVPDSGRILLDGKDVTDLSPEKHDIAFVYQNYSLFP 85 >1f8v_A Mature capsid protein beta; nodavirus, coat protein, nucleoprotein, protein-RNA interactions, RNA duplex, RNA CAGE, gamma polypeptide; 3.00A {Pariacato virus} (A:) Length = 355 Score = 24.2 bits (52), Expect = 6.0 Identities = 8/28 (28%), Positives = 11/28 (39%) Query: 52 RKDVARVLQVSYPLPAPQEITPRMGNRK 79 RK V+R + PA Q P + Sbjct: 7 RKVVSRSTALVPMAPASQRTGPAPRKPR 34 >3c2u_A Xylosidase/arabinosidase; tetramer, glycoside hydrolase, GH43, alpha-L- arabinofuranosidase; HET: B3P; 1.30A {Selenomonas ruminantium} PDB: 1y7b_A* 1yi7_A* (A:66-231) Length = 166 Score = 24.3 bits (52), Expect = 6.5 Identities = 3/30 (10%), Positives = 10/30 (33%) Query: 3 EDKWYIFYSGCGKNPVWDSMKGCLNFSSYD 32 + K+++ Y+ ++ D Sbjct: 16 DGKFWLIYTDVKVVDGMWKDCHNYLTTAED 45 >2exh_A Beta-D-xylosidase; glykosidase, hydrolsase, family43, hydrolase; HET: MES; 1.88A {Geobacillus stearothermophilus} (A:67-236) Length = 170 Score = 24.3 bits (52), Expect = 6.6 Identities = 2/28 (7%), Positives = 8/28 (28%) Query: 3 EDKWYIFYSGCGKNPVWDSMKGCLNFSS 30 + K+++ Y+ + Sbjct: 16 DGKFWLIYTDVKVVEGQWKDGHNYLVTC 43 >1yif_A Beta-1,4-xylosidase; glycosidase, xylan, structural genomics, PSI, protein structure initiative; 1.80A {Bacillus subtilis} (A:66-231) Length = 166 Score = 24.0 bits (51), Expect = 7.5 Identities = 2/28 (7%), Positives = 8/28 (28%) Query: 3 EDKWYIFYSGCGKNPVWDSMKGCLNFSS 30 + K+++ Y+ + Sbjct: 16 DGKFWLIYTDVKVVDGAWKDCHNYLVTC 43 >2hnh_A DNA polymerase III alpha subunit; DNA replication, nucleotidyltransferase, POL beta, PHP; HET: DNA; 2.30A {Escherichia coli} PDB: 2hqa_A* (A:438-502) Length = 65 Score = 23.7 bits (52), Expect = 8.1 Identities = 8/15 (53%), Positives = 8/15 (53%), Gaps = 1/15 (6%) Query: 50 AIRKDVARVLQVSYP 64 IR DV RVL Y Sbjct: 4 VIR-DVGRVLGHPYG 17 >2i49_A Bicarbonate transporter; alpha-beta protein, C-clamp, ABC transporter, periplasmic solute-binding protein, bicarbonate-binding protein; 1.35A {Synechocystis SP} PDB: 2i48_A 2i4b_A 2i4c_A (A:124-242,A:301-341) Length = 160 Score = 23.8 bits (51), Expect = 8.4 Identities = 8/58 (13%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Query: 35 SGNID---TDESDINTAIAIRKDVARVLQVSYPLPAPQEITPRMGNRKTVELLIEIDD 89 +G +D T + + +++ + ++ + +P G + IDD Sbjct: 87 NGTMDAFSTGDP--WPYRIVTENIGYMAGLTAQIWTTILESPFKGQYTMGDGQPAIDD 142 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.317 0.135 0.417 Gapped Lambda K H 0.267 0.0552 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 848,214 Number of extensions: 32596 Number of successful extensions: 131 Number of sequences better than 10.0: 1 Number of HSP's gapped: 131 Number of HSP's successfully gapped: 24 Length of query: 109 Length of database: 4,956,049 Length adjustment: 65 Effective length of query: 44 Effective length of database: 2,758,724 Effective search space: 121383856 Effective search space used: 121383856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.4 bits)