BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780996|ref|YP_003065409.1| hypothetical protein CLIBASIA_04485 [Candidatus Liberibacter asiaticus str. psy62] (109 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780996|ref|YP_003065409.1| hypothetical protein CLIBASIA_04485 [Candidatus Liberibacter asiaticus str. psy62] Length = 109 Score = 227 bits (579), Expect = 3e-62, Method: Compositional matrix adjust. Identities = 109/109 (100%), Positives = 109/109 (100%) Query: 1 MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ 60 MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ Sbjct: 1 MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ 60 Query: 61 VSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ 109 VSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ Sbjct: 61 VSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ 109 >gi|254781003|ref|YP_003065416.1| hypothetical protein CLIBASIA_04520 [Candidatus Liberibacter asiaticus str. psy62] Length = 304 Score = 82.4 bits (202), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 44/109 (40%), Positives = 64/109 (58%), Gaps = 18/109 (16%) Query: 1 MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ 60 P++ W IFYS + +N S D N+ DI+TAIA+RK RVLQ Sbjct: 84 FPKNTWCIFYS----------TERLINHSKRDSNN--------DIHTAIAVRKKNVRVLQ 125 Query: 61 VSYPLPAPQEITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ 109 SYPL ++ R GNR+ VELL+EI+ +K+W+L++HLKS C + ++ Sbjct: 126 QSYPLLGAKDSFSRAGNRRAVELLVEINGKKIWVLDIHLKSFCFLDSLE 174 >gi|254780797|ref|YP_003065210.1| hypothetical protein CLIBASIA_03440 [Candidatus Liberibacter asiaticus str. psy62] Length = 231 Score = 68.6 bits (166), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 40/110 (36%), Positives = 56/110 (50%), Gaps = 27/110 (24%) Query: 1 MPEDKWYIFYSGCGKNPVWDSMKGCLNFSSYDDNSGNIDTDESDINTAIAIRKDVARVLQ 60 P DKW I YSG +TD+ ++TAI IRK +LQ Sbjct: 67 FPNDKWDILYSGS-------------------------NTDKHAMHTAIVIRKGAIHLLQ 101 Query: 61 VSYPLPAPQE-ITPRMGNRKTVELLIEIDDQKVWLLNVHLKSSCVVKKIQ 109 SY LP E + + G R+ VE+L E+D +K+WLL++HLKS C + I+ Sbjct: 102 KSY-LPMDTEGLDSKAGKRRAVEILFEVDGRKIWLLDIHLKSFCFLDSIE 150 >gi|254780371|ref|YP_003064784.1| diaminopimelate decarboxylase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 431 Score = 22.3 bits (46), Expect = 2.1, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Query: 71 ITPRMGNRKTVELLIEIDDQKVWLLNVHLKSS 102 I PRM T + LIE+D WL +SS Sbjct: 401 IRPRM----TFQELIELDSIPAWLQKTPKQSS 428 >gi|254780537|ref|YP_003064950.1| periplasmic solute binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 294 Score = 20.8 bits (42), Expect = 6.1, Method: Compositional matrix adjust. Identities = 5/12 (41%), Positives = 8/12 (66%) Query: 2 PEDKWYIFYSGC 13 PE +W++ GC Sbjct: 182 PEKRWFVTSEGC 193 >gi|254780662|ref|YP_003065075.1| NAD-glutamate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 1576 Score = 20.4 bits (41), Expect = 9.4, Method: Compositional matrix adjust. Identities = 7/19 (36%), Positives = 13/19 (68%) Query: 33 DNSGNIDTDESDINTAIAI 51 DNSG ++ + ++N IA+ Sbjct: 1136 DNSGGVNCSDLEVNIKIAL 1154 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.135 0.417 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,331 Number of Sequences: 1233 Number of extensions: 2605 Number of successful extensions: 9 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 109 length of database: 328,796 effective HSP length: 62 effective length of query: 47 effective length of database: 252,350 effective search space: 11860450 effective search space used: 11860450 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)