RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780997|ref|YP_003065410.1| hypothetical protein CLIBASIA_04490 [Candidatus Liberibacter asiaticus str. psy62] (78 letters) >gnl|CDD|163551 TIGR03839, termin_org_P1, adhesin P1. Members of this protein family are the major adhesin of the Mycoplasma terminal organelle. The protein is called adhesin P1, cytadhesin P1, P140, attachment protein, and MgPa, with locus names MG191 in Mycoplasma genitalium and MPN141 in M. pneumoniae. A conserved C-terminal region is shared by additional paralogs in M. pneumoniae and M. gallisepticum, as well as by the member of this family. Length = 1425 Score = 29.7 bits (66), Expect = 0.18 Identities = 17/72 (23%), Positives = 28/72 (38%), Gaps = 4/72 (5%) Query: 3 NQILIDRSVVLLNLIGNPFSGFYAIRFSLLRSVDQSLLPPWQQFLFYLLPVAVLVPFISF 62 Q L R + P G + Q+ P+ Q+ Y+LP+A+ VP + Sbjct: 1312 RQTLGLRLEFNDFIKLLPQDGEFVPVLQASSVGPQTEFTPFNQWPDYVLPLAITVPIV-- 1369 Query: 63 FPFLIDAFALGL 74 + + LGL Sbjct: 1370 --VIALSVTLGL 1379 >gnl|CDD|149562 pfam08552, Kei1, Inositolphosphorylceramide synthase subunit Kei1. Kei1 is a subunit of Saccharomyces cerevisiae inositol phosphorylceramide (IPC) synthase. It is localized to the Golgi and is cleaved by the late Golgi processing endopeptidase Kex2. Kei1 is essential for both the activity and the Golgi localization of IPC synthase. Length = 178 Score = 28.4 bits (64), Expect = 0.40 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Query: 10 SVVLLNLIGNPFSGFYAIRFSLLRSVDQSLLPPWQQFLFYLLPVAVLVPFISFFP 64 ++LL+ I N SG Y I +L S Q+L YL V L+ + S P Sbjct: 14 ELILLSAIFNKASGLYGI-LALFTGHPLSFW----QWLMYLYSVLTLIVYASGLP 63 >gnl|CDD|166325 PLN02684, PLN02684, Probable galactinol--sucrose galactosyltransferase. Length = 750 Score = 26.1 bits (57), Expect = 2.0 Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Query: 47 LFYLLPVAVLVPFISFFPF-LIDAFALG 73 +F + P+ L P SF P LI+ + G Sbjct: 648 IFTVTPIKHLAPGFSFAPLGLINMYNAG 675 >gnl|CDD|152464 pfam12029, DUF3516, Domain of unknown function (DUF3516). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is typically between 460 to 473 amino acids in length. This domain is found associated with pfam00270, pfam00271. Length = 462 Score = 24.6 bits (54), Expect = 5.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 31 LLRSVDQSLLPPWQQ 45 L+R VD SLL W+Q Sbjct: 305 LVRQVDSSLLDEWEQ 319 >gnl|CDD|183017 PRK11177, PRK11177, phosphoenolpyruvate-protein phosphotransferase; Provisional. Length = 575 Score = 24.6 bits (54), Expect = 6.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Query: 19 NPFSGFYAIRFSLLR 33 NPF G+ AIR ++ R Sbjct: 352 NPFLGWRAIRIAMDR 366 >gnl|CDD|177929 PLN02292, PLN02292, ferric-chelate reductase. Length = 702 Score = 24.1 bits (52), Expect = 8.0 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Query: 47 LFYLLPVAV---LVPFISFFPFLIDAFALGLQ 75 LF++ V + L+ F F+ FL+D F LQ Sbjct: 291 LFFVFHVGISFALISFPGFYIFLVDRFLRFLQ 322 >gnl|CDD|178216 PLN02606, PLN02606, palmitoyl-protein thioesterase. Length = 306 Score = 24.2 bits (52), Expect = 8.4 Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 33 RSVDQSLLPPWQQFLFYLLPVAVLVPFISFFPF 65 +S +S L F+ +PV++ VPF+ F F Sbjct: 3 KSFQRSALLVTLSLFFFSIPVSLSVPFVLFHGF 35 >gnl|CDD|151683 pfam11241, DUF3043, Protein of unknown function (DUF3043). Some members in this family of proteins with unknown function are annotated as membrane proteins. This cannot be confirmed. Length = 168 Score = 23.8 bits (52), Expect = 9.9 Identities = 9/45 (20%), Positives = 16/45 (35%), Gaps = 18/45 (40%) Query: 49 YLLPVAVLVPFISFFP------------------FLIDAFALGLQ 75 + +PVA++V + P +ID LG + Sbjct: 80 FFMPVALVVLVLMLVPNPALQLIASLAMLVLILVMVIDGILLGRR 124 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.335 0.152 0.475 Gapped Lambda K H 0.267 0.0499 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,391,400 Number of extensions: 77466 Number of successful extensions: 397 Number of sequences better than 10.0: 1 Number of HSP's gapped: 393 Number of HSP's successfully gapped: 45 Length of query: 78 Length of database: 5,994,473 Length adjustment: 48 Effective length of query: 30 Effective length of database: 4,957,289 Effective search space: 148718670 Effective search space used: 148718670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 50 (23.6 bits)