HHsearch results for GI: 254780998 and protein with PDBid: 1ni7_A

>1ni7_A ER75, hypothetical protein YGDK; RD-structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Escherichia coli} SCOP: d.224.1.1
Probab=100.00  E-value=0  Score=312.57  Aligned_cols=137  Identities=28%  Similarity=0.510  Sum_probs=131.1

Q ss_pred             CCHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHCCHHHHHCCCCEEEEEEEEECCCCCCCCEEEEEECCHHHHHHH
Q ss_conf             88899999875099989999999999850899995686815502265601678873046545488799994162699999
Q gi|254780998|r    2 IPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCG   81 (146)
Q Consensus         2 ~~l~~i~e~f~~~~d~~~ry~~Li~lgk~l~~l~e~~k~~~~~V~GCqS~vWl~~~~~~~~~~~~~~~f~~dSda~IvkG   81 (146)
                      |++++|+++|+.|+||++||+|||++||++|++|+++|+++|+|+||||+|||+++.+    ++|+++|+|||||.||||
T Consensus        15 ~~~~~i~e~f~~~~dwedry~~Li~lgk~l~~l~e~~k~d~n~V~GCqS~vWl~~~~~----~~g~~~f~~dSDa~IvkG   90 (155)
T 1ni7_A           15 VTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVA----ENGKMHFFGDSEGRIVRG   90 (155)
T ss_dssp             SCHHHHHHHHTTCCSHHHHHHHHHHHHHHSCCCCHHHHHHSEEECSSSSCEEEECCCC----SSSCCCCEEEESSHHHHH
T ss_pred             CCHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCHHHHCHHHCCCCCCEEEEEEEEEC----CCCEEEEEECCCHHHHHH
T ss_conf             6899999999818999999999999884299999689554525067613688888862----697799984253399999


Q ss_pred             HHHHHHHHHCCCCHHHHHHCCHHHHHHHHCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999975998899980798999987090431694289999999999999999999633
Q gi|254780998|r   82 LLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDLTQEYLNVH  142 (146)
Q Consensus        82 l~~ll~~~~~g~t~~eI~~~d~~~f~~~lgL~~~Lt~~R~nGl~~m~~~ik~~a~~~l~~~  142 (146)
                      |++||+.+|||+||+||++++|.+|++++||.++|||+|+|||++|+++||++|++++.-+
T Consensus        91 l~aiL~~~~~g~t~~eI~~~~~~~~~~~lGL~~~LS~sR~NGl~~mi~~Ik~~a~~~l~~~  151 (155)
T 1ni7_A           91 LLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAATKQVLEHH  151 (155)
T ss_dssp             HHHHHHHHTTTCCHHHHHHSCTHHHHHHHTSSSSSCHHHHHHHHHHHHHHHHHHHHHHC--
T ss_pred             HHHHHHHHHCCCCHHHHHHCCHHHHHHHCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999987999999985698999987687400682189999999999999999998742